F324560

General Info

Members Datasets Scaffolds Average Seq Length
213 132 426 142

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_132789_c1|nmdc:mga0n895_132789_c1_1126_1632
Length 168
Sequence MARRAIGVGGIIGAEIVCSPRKEARMARINVGRVIGGGLLAGVVINVVDGLTNGGVLGARWAEETKRFGIEMTGAAQSRSLAGWMTFGFLCGIMIVWLYASMRPRYGPGPKTAVIAGLAVWFITRLAFAAWWFSGLYSLDLVAASAVGGLVADVAAGLAGGVLYKETA

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
73 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
92 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
93 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
103 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
104 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
107 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
108 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
109 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
110 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
113 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
116 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
117 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
118 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
119 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
120 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 0
Rhizosphere 99.53
Stem 0
Stem Tuber 0
Unclassified 29.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_132789_c1 3300050512 Bacteria 2515
2 Ga0065704_10020789 3300005289 Bacteria 1292
3 Ga0065715_10089196 3300005293 Bacteria 12749
4 Ga0065707_10445787 3300005295 Bacteria 805
5 Ga0070676_10384310 3300005328 Bacteria 973
6 Ga0070690_100633290 3300005330 Bacteria 815
7 Ga0070677_10268956 3300005333 Bacteria 854
8 Ga0068869_100159634 3300005334 Bacteria 1754
9 Ga0070682_101454893 3300005337 Unclassified 588
10 Ga0068868_100092082 3300005338 Bacteria 2443
11 Ga0070691_10595302 3300005341 Bacteria 652
12 Ga0070687_100874354 3300005343 Bacteria 642
13 Ga0070687_101041104 3300005343 Unclassified 595
14 Ga0070668_100004989 3300005347 Bacteria 9830
15 Ga0070675_100187006 3300005354 Bacteria 1793
16 Ga0070675_100308901 3300005354 Bacteria 1395
17 Ga0070674_100006579 3300005356 Bacteria 6792
18 Ga0070673_101383712 3300005364 Unclassified 662
19 Ga0070688_100056887 3300005365 Bacteria 2457
20 Ga0070709_10031487 3300005434 Unclassified 3190
21 Ga0070714_100337352 3300005435 Bacteria 1413
22 Ga0070711_100000492 3300005439 Bacteria 20564
23 Ga0070705_100041394 3300005440 Unclassified 2626
24 Ga0070705_100200214 3300005440 Unclassified 1368
25 Ga0070705_100421262 3300005440 Unclassified 994
26 Ga0070694_100465206 3300005444 Unclassified 1001
27 Ga0070694_101071342 3300005444 Bacteria 671
28 Ga0070708_100017125 3300005445 Bacteria 6035
29 Ga0070708_100054314 3300005445 Bacteria 3557
30 Ga0070708_100726524 3300005445 Unclassified 934
31 Ga0068867_100072851 3300005459 Bacteria 2572
32 Ga0070706_100015244 3300005467 Bacteria 7095
33 Ga0070706_100027581 3300005467 Bacteria 5226
34 Ga0070706_100147543 3300005467 Bacteria 2196
35 Ga0070706_100158676 3300005467 Bacteria 2112
36 Ga0070706_100290618 3300005467 Bacteria 1525
37 Ga0070706_100319087 3300005467 Bacteria 1449
38 Ga0070706_100728255 3300005467 Bacteria 919
39 Ga0070707_100027374 3300005468 Bacteria 5424
40 Ga0070707_100609765 3300005468 Unclassified 1054
41 Ga0070707_101079796 3300005468 Bacteria 768
42 Ga0070698_100015141 3300005471 Bacteria 8154
43 Ga0070698_100044745 3300005471 Bacteria 4530
44 Ga0070698_100396979 3300005471 Unclassified 1312
45 Ga0070699_100005179 3300005518 Bacteria 11468
46 Ga0070699_100178576 3300005518 Bacteria 1883
47 Ga0070699_101417829 3300005518 Unclassified 637
48 Ga0070697_100009119 3300005536 Bacteria 7750
49 Ga0070697_100116375 3300005536 Unclassified 2232
50 Ga0070697_100586563 3300005536 Bacteria 979
51 Ga0070697_100903531 3300005536 Bacteria 783
52 Ga0070695_100027747 3300005545 Unclassified 3509
53 Ga0070695_100096682 3300005545 Bacteria 1982
54 Ga0070695_100150709 3300005545 Bacteria 1623
55 Ga0070695_101088252 3300005545 Bacteria 654
56 Ga0070696_100025046 3300005546 Bacteria 4055
57 Ga0070696_100038783 3300005546 Bacteria 3289
58 Ga0070696_100441168 3300005546 Bacteria 1026
59 Ga0070704_100049383 3300005549 Unclassified 2952
60 Ga0070704_100147939 3300005549 Bacteria 1843
61 Ga0068861_100127703 3300005719 Unclassified 2060
62 Ga0068860_100572351 3300005843 Unclassified 1133
63 Ga0068862_102052165 3300005844 Unclassified 583
64 Ga0070717_10133236 3300006028 Bacteria 2139
65 Ga0075364_10889673 3300006051 Bacteria 606
66 Ga0070716_100000006 3300006173 Bacteria 268067
67 Ga0070716_100005125 3300006173 Bacteria 6330
68 Ga0075428_100320738 3300006844 Unclassified 1665
69 Ga0075428_100642372 3300006844 Bacteria 1132
70 Ga0075428_100673529 3300006844 Unclassified 1103
71 Ga0075430_100828882 3300006846 Unclassified 762
72 Ga0075431_100316668 3300006847 Bacteria 1574
73 Ga0075433_10071688 3300006852 Bacteria 3045
74 Ga0075433_10186284 3300006852 Unclassified 1847
75 Ga0075433_10194797 3300006852 Bacteria 1803
76 Ga0075433_10589591 3300006852 Bacteria 976
77 Ga0075434_100032734 3300006871 Bacteria 5127
78 Ga0075434_100057488 3300006871 Bacteria 3865
79 Ga0075434_100726503 3300006871 Bacteria 1010
80 Ga0075429_101498249 3300006880 Bacteria 587
81 Ga0075436_100078974 3300006914 Unclassified 2279
82 Ga0075436_100527012 3300006914 Unclassified 866
83 Ga0075435_100253806 3300007076 Bacteria 1497
84 Ga0111539_10000907 3300009094 Bacteria 38710
85 Ga0111539_10016600 3300009094 Bacteria 9126
86 Ga0111539_10040211 3300009094 Bacteria 5630
87 Ga0111539_10068035 3300009094 Bacteria 4204
88 Ga0111539_10773897 3300009094 Bacteria 1117
89 Ga0105245_10026473 3300009098 Bacteria 5105
90 Ga0114129_10009694 3300009147 Bacteria 13744
91 Ga0114129_10014203 3300009147 Bacteria 11345
92 Ga0114129_10053468 3300009147 Bacteria 5663
93 Ga0114129_10196816 3300009147 Bacteria 2732
94 Ga0105249_10059178 3300009553 Bacteria 3513
95 Ga0157380_10267081 3300014326 Bacteria 1557
96 Ga0157380_10348448 3300014326 Bacteria 1385
97 Ga0182008_10346382 3300014497 Unclassified 787
98 Ga0207684_10011550 3300025910 Bacteria 7717
99 Ga0207684_10020259 3300025910 Bacteria 5682
100 Ga0207684_10093122 3300025910 Bacteria 2569
101 Ga0207684_10109492 3300025910 Bacteria 2364
102 Ga0207684_10149392 3300025910 Bacteria 2010
103 Ga0207684_10234336 3300025910 Bacteria 1584
104 Ga0207663_10000116 3300025916 Bacteria 38574
105 Ga0207646_10002078 3300025922 Bacteria 24029
106 Ga0207646_10129664 3300025922 Bacteria 2269
107 Ga0207646_10365102 3300025922 Bacteria 1304
108 Ga0207646_10614799 3300025922 Unclassified 975
109 Ga0207646_10804809 3300025922 Bacteria 837
110 Ga0207659_10501331 3300025926 Bacteria 1028
111 Ga0207664_10298399 3300025929 Bacteria 1417
112 Ga0207706_10360255 3300025933 Bacteria 1263
113 Ga0207669_10358242 3300025937 Bacteria 1129
114 Ga0207665_10000056 3300025939 Bacteria 73322
115 Ga0207665_10015351 3300025939 Bacteria 5029
116 Ga0207665_11457823 3300025939 Unclassified 544
117 Ga0207689_10254181 3300025942 Bacteria 1453
118 Ga0207712_10105813 3300025961 Unclassified 2100
119 Ga0207658_11327546 3300025986 Bacteria 658
120 Ga0207677_10143062 3300026023 Bacteria 1834
121 Ga0207708_11087940 3300026075 Unclassified 697
122 Ga0207648_10025197 3300026089 Bacteria 5303
123 Ga0207674_10735066 3300026116 Bacteria 952
124 Ga0207675_100165047 3300026118 Bacteria 2115
125 Ga0207675_100282874 3300026118 Bacteria 1612
126 Ga0207428_10004671 3300027907 Bacteria 12979
127 Ga0207428_10005725 3300027907 Bacteria 11552
128 Ga0207428_10059506 3300027907 Unclassified 3029
129 Ga0207428_10385061 3300027907 Unclassified 1028
130 Ga0268265_11971055 3300028380 Unclassified 591
131 Ga0268264_10354769 3300028381 Bacteria 1397
132 Ga0316579_10084201 3300031691 Bacteria 1516
133 Ga0316576_10484623 3300031727 Bacteria 911
134 Ga0307407_11694053 3300031903 Unclassified 503
135 Ga0307416_100535304 3300032002 Bacteria 1242
136 Ga0307416_100899688 3300032002 Unclassified 985
137 Ga0373924_0319163 3300035410 Unclassified 691
138 Ga0373937_0133132 3300036401 Unclassified 2323
139 Ga0373937_0164579 3300036401 Bacteria 2080
140 Ga0451577_0000212 3300042876 Bacteria 122106
141 Ga0451577_0988847 3300042876 Bacteria 756
142 Ga0453683_0205103 3300044673 Bacteria 1252
143 Ga0453684_0016771 3300044712 Bacteria 11412
144 Ga0453684_0458652 3300044712 Bacteria 1417
145 Ga0495651_0215846 3300046462 Bacteria 1331
146 Ga0495662_0013010 3300046476 Bacteria 4054
147 Ga0495608_0040732 3300046511 Bacteria 3111
148 Ga0495630_0102186 3300046517 Unclassified 2168
149 Ga0495652_0313861 3300046529 Bacteria 1135
150 Ga0495640_0074574 3300046533 Bacteria 2268
151 Ga0495587_0104871 3300046536 Unclassified 1627
152 Ga0495587_0462620 3300046536 Unclassified 702
153 Ga0495645_0496834 3300046543 Bacteria 763
154 Ga0495634_0669573 3300046642 Unclassified 598
155 Ga0495635_0080499 3300046663 Unclassified 2229
156 Ga0495657_0026667 3300046675 Bacteria 4089
157 Ga0495623_0102565 3300046679 Unclassified 1742
158 Ga0495646_0164530 3300046680 Unclassified 1226
159 Ga0495658_0224146 3300046683 Bacteria 1178
160 Ga0495613_0022435 3300046689 Bacteria 4704
161 Ga0495624_0072794 3300046690 Bacteria 2137
162 Ga0495600_0046181 3300046809 Bacteria 2842
163 Ga0495604_0031893 3300047317 Bacteria 4178
164 Ga0495674_0039857 3300047319 Bacteria 4206
165 Ga0495675_0475280 3300047444 Bacteria 720
166 Ga0495684_0293895 3300047471 Bacteria 1168
167 Ga0501296_030102 3300049519 Bacteria 728
168 Ga0501300_010411 3300049523 Bacteria 1357
169 Ga0501303_005718 3300049526 Unclassified 1068
170 Ga0501038_0666897 3300049574 Unclassified 782
171 Ga0501068_0927649 3300049584 Unclassified 573
172 Ga0501071_0789764 3300049587 Bacteria 732
173 Ga0501072_0308948 3300049588 Bacteria 1257
174 Ga0501074_0563807 3300049590 Unclassified 806
175 Ga0501075_0113150 3300049591 Unclassified 2064
176 Ga0501075_0175349 3300049591 Bacteria 1636
177 Ga0501077_1068814 3300049593 Unclassified 519
178 Ga0501198_006942 3300049649 Bacteria 1622
179 Ga0501216_016881 3300049660 Unclassified 1243
180 Ga0501217_043595 3300049661 Bacteria 1150
181 Ga0501227_051404 3300049665 Bacteria 1041
182 Ga0501235_039329 3300049669 Bacteria 1080
183 Ga0501253_078259 3300049683 Unclassified 742
184 Ga0501261_116471 3300049690 Unclassified 525
185 Ga0501219_023014 3300049703 Unclassified 552
186 Ga0501234_033036 3300049707 Bacteria 838
187 Ga0501079_0049639 3300049741 Bacteria 3239
188 Ga0501080_0395495 3300049742 Unclassified 1244
189 nmdc:mga05p37_247041_c1 3300050507 Bacteria 2142
190 nmdc:mga05p37_25885_c1 3300050507 Bacteria 7132
191 nmdc:mga05p37_48719_c1 3300050507 Bacteria 5210
192 nmdc:mga06r32_357606_c1 3300050510 Bacteria 1444
193 nmdc:mga08y16_10105_c1 3300050511 Bacteria 9906
194 nmdc:mga08y16_2881_c1 3300050511 Bacteria 17699
195 nmdc:mga08y16_575139_c1 3300050511 Unclassified 1138
196 nmdc:mga08y16_8078_c1 3300050511 Bacteria 11011
197 nmdc:mga08y16_997016_c1 3300050511 Unclassified 818
198 nmdc:mga0n895_202198_c1 3300050512 Bacteria 2017
199 nmdc:mga0n895_43813_c1 3300050512 Bacteria 4362
200 nmdc:mga0rr50_105547_c1 3300050513 Bacteria 2221
201 nmdc:mga0rr50_185493_c1 3300050513 Bacteria 1702
202 nmdc:mga0rr50_604023_c1 3300050513 Bacteria 935
203 nmdc:mga08x19_48937_c1 3300050514 Unclassified 2710
204 nmdc:mga08x19_611824_c1 3300050514 Unclassified 772
205 nmdc:mga0a205_13306_c1 3300050515 Bacteria 7653
206 nmdc:mga0a205_377848_c1 3300050515 Unclassified 1282
207 nmdc:mga0a205_52171_c1 3300050515 Bacteria 3948
208 nmdc:mga0a205_564051_c1 3300050515 Unclassified 993
209 nmdc:mga0a205_57993_c1 3300050515 Bacteria 3739
210 Ga0495619_0068265 3300053085 Bacteria 2375
211 Ga0501084_0738147 3300054114 Unclassified 830
212 Ga0501082_0409207 3300060353 Unclassified 1184
213 Ga0530510_1218766 3300061734 Unclassified 577
214 nmdc:mga0n895_132789_c1
215 Ga0065704_10020789
216 Ga0065715_10089196
217 Ga0065707_10445787
218 Ga0070676_10384310
219 Ga0070690_100633290
220 Ga0070677_10268956
221 Ga0068869_100159634
222 Ga0070682_101454893
223 Ga0068868_100092082
224 Ga0070691_10595302
225 Ga0070687_100874354
226 Ga0070687_101041104
227 Ga0070668_100004989
228 Ga0070675_100187006
229 Ga0070675_100308901
230 Ga0070674_100006579
231 Ga0070673_101383712
232 Ga0070688_100056887
233 Ga0070709_10031487
234 Ga0070714_100337352
235 Ga0070711_100000492
236 Ga0070705_100041394
237 Ga0070705_100200214
238 Ga0070705_100421262
239 Ga0070694_100465206
240 Ga0070694_101071342
241 Ga0070708_100017125
242 Ga0070708_100054314
243 Ga0070708_100726524
244 Ga0068867_100072851
245 Ga0070706_100015244
246 Ga0070706_100027581
247 Ga0070706_100147543
248 Ga0070706_100158676
249 Ga0070706_100290618
250 Ga0070706_100319087
251 Ga0070706_100728255
252 Ga0070707_100027374
253 Ga0070707_100609765
254 Ga0070707_101079796
255 Ga0070698_100015141
256 Ga0070698_100044745
257 Ga0070698_100396979
258 Ga0070699_100005179
259 Ga0070699_100178576
260 Ga0070699_101417829
261 Ga0070697_100009119
262 Ga0070697_100116375
263 Ga0070697_100586563
264 Ga0070697_100903531
265 Ga0070695_100027747
266 Ga0070695_100096682
267 Ga0070695_100150709
268 Ga0070695_101088252
269 Ga0070696_100025046
270 Ga0070696_100038783
271 Ga0070696_100441168
272 Ga0070704_100049383
273 Ga0070704_100147939
274 Ga0068861_100127703
275 Ga0068860_100572351
276 Ga0068862_102052165
277 Ga0070717_10133236
278 Ga0075364_10889673
279 Ga0070716_100000006
280 Ga0070716_100005125
281 Ga0075428_100320738
282 Ga0075428_100642372
283 Ga0075428_100673529
284 Ga0075430_100828882
285 Ga0075431_100316668
286 Ga0075433_10071688
287 Ga0075433_10186284
288 Ga0075433_10194797
289 Ga0075433_10589591
290 Ga0075434_100032734
291 Ga0075434_100057488
292 Ga0075434_100726503
293 Ga0075429_101498249
294 Ga0075436_100078974
295 Ga0075436_100527012
296 Ga0075435_100253806
297 Ga0111539_10000907
298 Ga0111539_10016600
299 Ga0111539_10040211
300 Ga0111539_10068035
301 Ga0111539_10773897
302 Ga0105245_10026473
303 Ga0114129_10009694
304 Ga0114129_10014203
305 Ga0114129_10053468
306 Ga0114129_10196816
307 Ga0105249_10059178
308 Ga0157380_10267081
309 Ga0157380_10348448
310 Ga0182008_10346382
311 Ga0207684_10011550
312 Ga0207684_10020259
313 Ga0207684_10093122
314 Ga0207684_10109492
315 Ga0207684_10149392
316 Ga0207684_10234336
317 Ga0207663_10000116
318 Ga0207646_10002078
319 Ga0207646_10129664
320 Ga0207646_10365102
321 Ga0207646_10614799
322 Ga0207646_10804809
323 Ga0207659_10501331
324 Ga0207664_10298399
325 Ga0207706_10360255
326 Ga0207669_10358242
327 Ga0207665_10000056
328 Ga0207665_10015351
329 Ga0207665_11457823
330 Ga0207689_10254181
331 Ga0207712_10105813
332 Ga0207658_11327546
333 Ga0207677_10143062
334 Ga0207708_11087940
335 Ga0207648_10025197
336 Ga0207674_10735066
337 Ga0207675_100165047
338 Ga0207675_100282874
339 Ga0207428_10004671
340 Ga0207428_10005725
341 Ga0207428_10059506
342 Ga0207428_10385061
343 Ga0268265_11971055
344 Ga0268264_10354769
345 Ga0316579_10084201
346 Ga0316576_10484623
347 Ga0307407_11694053
348 Ga0307416_100535304
349 Ga0307416_100899688
350 Ga0373924_0319163
351 Ga0373937_0133132
352 Ga0373937_0164579
353 Ga0451577_0000212
354 Ga0451577_0988847
355 Ga0453683_0205103
356 Ga0453684_0016771
357 Ga0453684_0458652
358 Ga0495651_0215846
359 Ga0495662_0013010
360 Ga0495608_0040732
361 Ga0495630_0102186
362 Ga0495652_0313861
363 Ga0495640_0074574
364 Ga0495587_0104871
365 Ga0495587_0462620
366 Ga0495645_0496834
367 Ga0495634_0669573
368 Ga0495635_0080499
369 Ga0495657_0026667
370 Ga0495623_0102565
371 Ga0495646_0164530
372 Ga0495658_0224146
373 Ga0495613_0022435
374 Ga0495624_0072794
375 Ga0495600_0046181
376 Ga0495604_0031893
377 Ga0495674_0039857
378 Ga0495675_0475280
379 Ga0495684_0293895
380 Ga0501296_030102
381 Ga0501300_010411
382 Ga0501303_005718
383 Ga0501038_0666897
384 Ga0501068_0927649
385 Ga0501071_0789764
386 Ga0501072_0308948
387 Ga0501074_0563807
388 Ga0501075_0113150
389 Ga0501075_0175349
390 Ga0501077_1068814
391 Ga0501198_006942
392 Ga0501216_016881
393 Ga0501217_043595
394 Ga0501227_051404
395 Ga0501235_039329
396 Ga0501253_078259
397 Ga0501261_116471
398 Ga0501219_023014
399 Ga0501234_033036
400 Ga0501079_0049639
401 Ga0501080_0395495
402 nmdc:mga05p37_247041_c1
403 nmdc:mga05p37_25885_c1
404 nmdc:mga05p37_48719_c1
405 nmdc:mga06r32_357606_c1
406 nmdc:mga08y16_10105_c1
407 nmdc:mga08y16_2881_c1
408 nmdc:mga08y16_575139_c1
409 nmdc:mga08y16_8078_c1
410 nmdc:mga08y16_997016_c1
411 nmdc:mga0n895_202198_c1
412 nmdc:mga0n895_43813_c1
413 nmdc:mga0rr50_105547_c1
414 nmdc:mga0rr50_185493_c1
415 nmdc:mga0rr50_604023_c1
416 nmdc:mga08x19_48937_c1
417 nmdc:mga08x19_611824_c1
418 nmdc:mga0a205_13306_c1
419 nmdc:mga0a205_377848_c1
420 nmdc:mga0a205_52171_c1
421 nmdc:mga0a205_564051_c1
422 nmdc:mga0a205_57993_c1
423 Ga0495619_0068265
424 Ga0501084_0738147
425 Ga0501082_0409207
426 Ga0530510_1218766

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gup-assembly1.cif.gz_V cryo-em structure of mammalian respiratory supercomplex i1iii2iv1 0.499 8 129
5gpn-assembly1.cif.gz_Ag architecture of mammalian respirasome 0.4979 6 129
6wik-assembly1.cif.gz_A cryo-em structure of slc40/ferroportin with fab in the presence of hepcidin 0.4636 5 136
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.4262 15 135
6qc6-assembly1.cif.gz_AK ovine respiratory complex i frc open class 1 0.4254 8 130
ID Description Score Start End Superfamily
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.63 1 139 1.20.120.550
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6265 1 139 1.20.120.550
af_P9WJV3_159_359_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.5019 9 136 1.20.1640.10
af_P34711_97_455_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.487 8 136 1.20.1250.20
af_P31468_1_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.4776 4 134 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A1F2UUV1-F1-model_v4 DUF2127 domain-containing protein 0.9893 1 138 GO:0016020
AF-A0A1F2TM81-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9851 1 139 GO:0016020
AF-A0A7V9ZB71-F1-model_v4 DUF1761 domain-containing protein 0.9842 4 139 GO:0016020
AF-A0A2V9CKC1-F1-model_v4 DUF1761 domain-containing protein 0.9806 1 138 GO:0016020
AF-A0A1F2TM81-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9782 1 139 GO:0016020

Map