F324550

General Info

Members Datasets Scaffolds Average Seq Length
213 95 208 255

Family's Representative Sequence

Representative Sequence 3300050494|nmdc:mga06z11_218313_c1|nmdc:mga06z11_218313_c1_13_882
Length 289
Sequence MPGKAASYGVMLRPPTDRRAPLAYLASERSPIIRNQLAMASWPKLLWVVRHGQSAGNVARDAAEAARLARIDIATRDMDVPLSDLGRRQARALGLWFARPAAERPEVILCSPYVRARETADIVARSAGWGKIKVRVDERLREKEFGILDRLTRYGITEKHPELAEQRGHVGKFYFRPPGGESWCDVILRLRSAMEMATREYAGRNVLIVAHQVTVNCLRYLLEQMDEAQILAIDRAGDIPNCAVTSYRAHQHEEEDVVMRLELVNFVAPLEQSGAPVTAEPDQAAAPGA

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2842711865 Duganella sp. R-73148 Isolate Unclassified
3 2857564685 Duganella sp. R-74599 Isolate Unclassified
4 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
5 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
26 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
27 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
28 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
30 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
32 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
33 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
34 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
50 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
51 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
52 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
53 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
54 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
55 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
59 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
60 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
64 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
65 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
66 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
67 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
68 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
69 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
70 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
74 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
75 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
76 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
77 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
78 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
79 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
80 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
81 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
82 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
83 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
84 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
85 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
86 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
92 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
93 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
94 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
95 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0
Rhizoplane 1.88
Rhizosphere 84.98
Stem 0
Stem Tuber 0.47
Unclassified 1.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1014708 3300002774 Bacteria 1321
2 Ga0055526_1000430 3300003771 Bacteria 33723
3 Ga0055526_1001986 3300003771 Bacteria 14103
4 Ga0055537_1000804 3300003773 Bacteria 15551
5 Ga0055537_1003245 3300003773 Bacteria 5068
6 Ga0055528_1001228 3300003790 Bacteria 16352
7 Ga0055530_10000941 3300003791 Bacteria 23796
8 Ga0070680_100001358 3300005336 Bacteria 17689
9 Ga0070660_100005885 3300005339 Bacteria 8483
10 Ga0070661_100000130 3300005344 Bacteria 62986
11 Ga0070692_10010429 3300005345 Bacteria 4227
12 Ga0070668_100036691 3300005347 Bacteria 3741
13 Ga0070668_100199288 3300005347 Bacteria 1643
14 Ga0070671_100019970 3300005355 Bacteria 5458
15 Ga0070667_100133290 3300005367 Bacteria 2170
16 Ga0070678_100913100 3300005456 Bacteria 803
17 Ga0070679_100000021 3300005530 Bacteria 124652
18 Ga0075369_10003629 3300006186 Bacteria 5635
19 Ga0075366_10058046 3300006195 Bacteria 2299
20 Ga0097621_100013421 3300006237 Bacteria 6106
21 Ga0157373_10017526 3300013100 Bacteria 5216
22 Ga0163162_10081063 3300013306 Bacteria 3315
23 Ga0157375_10027204 3300013308 Bacteria 5343
24 Ga0157380_10011491 3300014326 Bacteria 6399
25 Ga0207425_1000245 3300025245 Bacteria 41275
26 Ga0207425_1021209 3300025245 Bacteria 1379
27 Ga0209565_1000015 3300025263 Bacteria 494091
28 Ga0209673_1000394 3300025273 Bacteria 78048
29 Ga0209675_1000012 3300025291 Bacteria 494061
30 Ga0209025_1010537 3300025294 Bacteria 6252
31 Ga0209564_1000011 3300025295 Bacteria 822327
32 Ga0209564_1000016 3300025295 Bacteria 613131
33 Ga0209564_1003929 3300025295 Bacteria 9500
34 Ga0209758_1004343 3300025297 Bacteria 11876
35 Ga0209050_1000240 3300025298 Bacteria 118992
36 Ga0209256_1000076 3300025299 Bacteria 234735
37 Ga0207697_10041746 3300025315 Bacteria 1884
38 Ga0207705_10275098 3300025909 Bacteria 1288
39 Ga0207660_10001149 3300025917 Bacteria 17665
40 Ga0207657_10004663 3300025919 Bacteria 14476
41 Ga0207649_10000134 3300025920 Bacteria 63335
42 Ga0207652_10000047 3300025921 Bacteria 125286
43 Ga0207668_10021456 3300025972 Bacteria 4119
44 Ga0207639_10025004 3300026041 Bacteria 4328
45 Ga0207678_10049447 3300026067 Bacteria 3634
46 Ga0207676_10502162 3300026095 Bacteria 1152
47 Ga0209983_1017659 3300027665 Bacteria 1478
48 Ga0209971_1032126 3300027682 Bacteria 1260
49 Ga0209974_10000808 3300027876 Bacteria 10720
50 Ga0209974_10017601 3300027876 Bacteria 2370
51 Ga0316180_1160932 3300030736 Bacteria 2032
52 Ga0316183_1190837 3300030742 Bacteria 3204
53 Ga0307408_100015904 3300031548 Bacteria 5015
54 Ga0307408_100031386 3300031548 Bacteria 3700
55 Ga0307408_100078118 3300031548 Bacteria 2466
56 Ga0307408_100153999 3300031548 Unclassified 1818
57 Ga0307408_100230904 3300031548 Bacteria 1515
58 Ga0307408_100268591 3300031548 Bacteria 1415
59 Ga0307408_100460514 3300031548 Bacteria 1105
60 Ga0307408_100519511 3300031548 Bacteria 1045
61 Ga0307408_100587346 3300031548 Bacteria 988
62 Ga0307405_10003628 3300031731 Bacteria 7139
63 Ga0307405_10112201 3300031731 Bacteria 1849
64 Ga0307405_10318777 3300031731 Bacteria 1186
65 Ga0307413_10010265 3300031824 Bacteria 4532
66 Ga0307413_10012459 3300031824 Bacteria 4235
67 Ga0307413_10018859 3300031824 Bacteria 3630
68 Ga0307413_10031550 3300031824 Bacteria 2992
69 Ga0307413_10070663 3300031824 Bacteria 2196
70 Ga0307413_10080391 3300031824 Bacteria 2087
71 Ga0307413_10081161 3300031824 Bacteria 2078
72 Ga0307413_10107655 3300031824 Bacteria 1858
73 Ga0307413_10161070 3300031824 Bacteria 1576
74 Ga0307413_10231341 3300031824 Bacteria 1358
75 Ga0307410_10002327 3300031852 Bacteria 9135
76 Ga0307410_10020593 3300031852 Bacteria 4038
77 Ga0307410_10095123 3300031852 Bacteria 2123
78 Ga0307410_10132553 3300031852 Bacteria 1832
79 Ga0307410_10219668 3300031852 Bacteria 1461
80 Ga0307410_10273402 3300031852 Bacteria 1322
81 Ga0307410_10517664 3300031852 Bacteria 984
82 Ga0307410_10562212 3300031852 Bacteria 947
83 Ga0307406_10037349 3300031901 Bacteria 2999
84 Ga0307406_10043219 3300031901 Bacteria 2817
85 Ga0307406_10050676 3300031901 Bacteria 2633
86 Ga0307406_10062212 3300031901 Bacteria 2414
87 Ga0307406_10062365 3300031901 Bacteria 2412
88 Ga0307406_10636265 3300031901 Bacteria 884
89 Ga0307407_10012383 3300031903 Bacteria 4097
90 Ga0307407_10013656 3300031903 Bacteria 3950
91 Ga0307407_10029992 3300031903 Bacteria 2928
92 Ga0307407_10122941 3300031903 Bacteria 1648
93 Ga0307407_10136288 3300031903 Bacteria 1578
94 Ga0307407_10174667 3300031903 Bacteria 1418
95 Ga0307407_10205079 3300031903 Bacteria 1324
96 Ga0307407_10256689 3300031903 Bacteria 1200
97 Ga0307407_10419360 3300031903 Bacteria 964
98 Ga0307412_10007154 3300031911 Bacteria 6335
99 Ga0307412_10010082 3300031911 Bacteria 5434
100 Ga0307412_10091943 3300031911 Bacteria 2125
101 Ga0307412_10143439 3300031911 Bacteria 1752
102 Ga0307412_10359706 3300031911 Bacteria 1171
103 Ga0307409_100016370 3300031995 Bacteria 4903
104 Ga0307409_100027692 3300031995 Bacteria 4022
105 Ga0307409_100061261 3300031995 Bacteria 2939
106 Ga0307409_100083824 3300031995 Bacteria 2586
107 Ga0307409_100100438 3300031995 Bacteria 2398
108 Ga0307409_100115599 3300031995 Bacteria 2259
109 Ga0307409_100155916 3300031995 Bacteria 1989
110 Ga0307409_100226475 3300031995 Bacteria 1691
111 Ga0307409_100247029 3300031995 Bacteria 1629
112 Ga0307409_100321709 3300031995 Bacteria 1448
113 Ga0307409_100374831 3300031995 Bacteria 1351
114 Ga0307409_100461361 3300031995 Bacteria 1228
115 Ga0307409_100536008 3300031995 Bacteria 1146
116 Ga0307409_100643111 3300031995 Bacteria 1053
117 Ga0307416_100007453 3300032002 Bacteria 6961
118 Ga0307416_100012493 3300032002 Bacteria 5722
119 Ga0307416_100014167 3300032002 Bacteria 5450
120 Ga0307416_100028811 3300032002 Bacteria 4137
121 Ga0307416_100106303 3300032002 Bacteria 2459
122 Ga0307416_100136769 3300032002 Bacteria 2218
123 Ga0307416_100149309 3300032002 Bacteria 2140
124 Ga0307416_100171330 3300032002 Unclassified 2021
125 Ga0307416_100257064 3300032002 Bacteria 1704
126 Ga0307416_100260556 3300032002 Bacteria 1694
127 Ga0307416_100281023 3300032002 Bacteria 1641
128 Ga0307416_100288637 3300032002 Bacteria 1623
129 Ga0307414_10003065 3300032004 Bacteria 8868
130 Ga0307414_10016468 3300032004 Bacteria 4494
131 Ga0307414_10021952 3300032004 Bacteria 4017
132 Ga0307414_10036216 3300032004 Bacteria 3292
133 Ga0307414_10043073 3300032004 Bacteria 3072
134 Ga0307414_10069291 3300032004 Bacteria 2535
135 Ga0307414_10103098 3300032004 Bacteria 2151
136 Ga0307414_10115852 3300032004 Bacteria 2050
137 Ga0307414_10173381 3300032004 Bacteria 1727
138 Ga0307414_10188042 3300032004 Bacteria 1668
139 Ga0307414_10284424 3300032004 Bacteria 1391
140 Ga0307414_10330735 3300032004 Bacteria 1301
141 Ga0307414_10462035 3300032004 Bacteria 1116
142 Ga0307414_10508720 3300032004 Bacteria 1067
143 Ga0307411_10003985 3300032005 Bacteria 6975
144 Ga0307411_10015231 3300032005 Bacteria 4312
145 Ga0307411_10015841 3300032005 Bacteria 4248
146 Ga0307411_10030041 3300032005 Bacteria 3327
147 Ga0307411_10038700 3300032005 Bacteria 3010
148 Ga0307411_10048899 3300032005 Bacteria 2744
149 Ga0307411_10090853 3300032005 Bacteria 2131
150 Ga0307411_10187398 3300032005 Bacteria 1576
151 Ga0307411_10371309 3300032005 Bacteria 1173
152 Ga0307411_10521708 3300032005 Bacteria 1008
153 Ga0307411_10546403 3300032005 Bacteria 987
154 Ga0307415_100003133 3300032126 Bacteria 8376
155 Ga0307415_100022155 3300032126 Bacteria 3917
156 Ga0307415_100034655 3300032126 Bacteria 3289
157 Ga0307415_100047266 3300032126 Bacteria 2896
158 Ga0307415_100047605 3300032126 Bacteria 2887
159 Ga0307415_100063948 3300032126 Bacteria 2559
160 Ga0307415_100146447 3300032126 Bacteria 1811
161 Ga0307415_100249203 3300032126 Bacteria 1442
162 Ga0307415_100608173 3300032126 Bacteria 974
163 Ga0307415_100610014 3300032126 Bacteria 972
164 Ga0307415_100673229 3300032126 Bacteria 930
165 Ga0373939_0004485 3300035114 Bacteria 3306
166 Ga0439465_0024771 3300041413 Bacteria 1892
167 Ga0439465_0091028 3300041413 Bacteria 1044
168 Ga0439445_0000846 3300042004 Bacteria 6471
169 Ga0439449_0068837 3300042007 Bacteria 1305
170 Ga0439464_0005723 3300042439 Bacteria 3223
171 Ga0495650_0000135 3300046471 Bacteria 172251
172 Ga0495650_0000521 3300046471 Bacteria 56415
173 Ga0495584_0035938 3300046491 Bacteria 2503
174 Ga0495607_0000522 3300046501 Bacteria 37808
175 Ga0495606_0000001 3300046507 Bacteria 592123
176 Ga0495606_0000224 3300046507 Bacteria 100442
177 Ga0495606_0005710 3300046507 Bacteria 11774
178 Ga0495610_0003856 3300046512 Bacteria 11397
179 Ga0495610_0025585 3300046512 Bacteria 3164
180 Ga0495643_0176762 3300046522 Bacteria 1040
181 Ga0495609_0000163 3300046538 Bacteria 69578
182 Ga0495597_0011449 3300046542 Bacteria 4300
183 Ga0495622_0000055 3300046557 Bacteria 102577
184 Ga0495633_0000244 3300046558 Bacteria 65398
185 Ga0495668_0000120 3300046616 Bacteria 117076
186 Ga0495668_0000241 3300046616 Bacteria 78040
187 Ga0495668_0006872 3300046616 Bacteria 7376
188 Ga0495668_0031992 3300046616 Bacteria 2962
189 Ga0495625_0009607 3300046660 Bacteria 8071
190 Ga0495625_0032331 3300046660 Bacteria 3881
191 Ga0495659_0002554 3300046664 Bacteria 5871
192 Ga0495661_0057832 3300046665 Bacteria 2313
193 Ga0495669_0001176 3300046684 Bacteria 10872
194 Ga0495649_0014124 3300046694 Bacteria 4585
195 Ga0495660_0005381 3300046810 Bacteria 7667
196 Ga0495672_0000171 3300047320 Bacteria 94653
197 Ga0495687_030440 3300047443 Bacteria 2484
198 Ga0495686_0005890 3300047472 Bacteria 9552
199 Ga0496107_0009300 3300048910 Bacteria 6813
200 Ga0496109_0042041 3300048912 Bacteria 4140
201 Ga0496109_0682544 3300048912 Bacteria 964
202 Ga0496114_0034203 3300048917 Bacteria 4191
203 Ga0496124_0073541 3300048927 Bacteria 2828
204 Ga0495678_028102 3300049459 Bacteria 2378
205 Ga0495678_087662 3300049459 Bacteria 1103
206 Ga0501267_004810 3300049764 Bacteria 1265
207 nmdc:mga06z11_218313_c1 3300050494 Bacteria 1113
208 nmdc:mga0sz30_26502_c1 3300050516 Bacteria 2376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025909 Ga0207705_10275098 Ga0207705_102750982 219
2 3300032004 Ga0307414_10508720 Ga0307414_105087202 222
3 3300049764 Ga0501267_004810 Ga0501267_004810_379_1110 237
4 3300005345 Ga0070692_10010429 Ga0070692_100104293 240
5 3300041413 Ga0439465_0091028 Ga0439465_0091028_202_966 246
6 iso_pu_bacteria 2885427238 2885427287 246
7 iso_pu_bacteria 2896429255 2896429280 246
8 3300005347 Ga0070668_100199288 Ga0070668_1001992882 247
9 3300005355 Ga0070671_100019970 Ga0070671_1000199702 247
10 3300005367 Ga0070667_100133290 Ga0070667_1001332902 247
11 3300005456 Ga0070678_100913100 Ga0070678_1009131001 247
12 3300006186 Ga0075369_10003629 Ga0075369_100036294 247
13 3300006237 Ga0097621_100013421 Ga0097621_1000134214 247
14 3300013306 Ga0163162_10081063 Ga0163162_100810632 247
15 3300013308 Ga0157375_10027204 Ga0157375_100272042 247
16 3300025315 Ga0207697_10041746 Ga0207697_100417462 247
17 3300026041 Ga0207639_10025004 Ga0207639_100250042 247
18 3300026095 Ga0207676_10502162 Ga0207676_105021622 247
19 3300027665 Ga0209983_1017659 Ga0209983_10176591 247
20 3300027682 Ga0209971_1032126 Ga0209971_10321262 247
21 3300027876 Ga0209974_10000808 Ga0209974_100008085 247
22 3300030736 Ga0316180_1160932 Ga0316180_11609322 247
23 3300030742 Ga0316183_1190837 Ga0316183_11908372 247
24 3300031548 Ga0307408_100015904 Ga0307408_1000159045 247
25 3300031731 Ga0307405_10112201 Ga0307405_101122012 247
26 3300031731 Ga0307405_10318777 Ga0307405_103187772 247
27 3300031824 Ga0307413_10012459 Ga0307413_100124593 247
28 3300031824 Ga0307413_10031550 Ga0307413_100315502 247
29 3300031824 Ga0307413_10107655 Ga0307413_101076552 247
30 3300031824 Ga0307413_10231341 Ga0307413_102313412 247
31 3300031852 Ga0307410_10132553 Ga0307410_101325531 247
32 3300031901 Ga0307406_10062365 Ga0307406_100623653 247
33 3300031903 Ga0307407_10012383 Ga0307407_100123833 247
34 3300031903 Ga0307407_10136288 Ga0307407_101362882 247
35 3300031903 Ga0307407_10205079 Ga0307407_102050791 247
36 3300031903 Ga0307407_10419360 Ga0307407_104193601 247
37 3300031911 Ga0307412_10010082 Ga0307412_100100822 247
38 3300031995 Ga0307409_100061261 Ga0307409_1000612613 247
39 3300031995 Ga0307409_100155916 Ga0307409_1001559162 247
40 3300031995 Ga0307409_100374831 Ga0307409_1003748312 247
41 3300031995 Ga0307409_100643111 Ga0307409_1006431111 247
42 3300032002 Ga0307416_100007453 Ga0307416_1000074538 247
43 3300032002 Ga0307416_100136769 Ga0307416_1001367692 247
44 3300032004 Ga0307414_10003065 Ga0307414_100030652 247
45 3300032004 Ga0307414_10188042 Ga0307414_101880422 247
46 3300032004 Ga0307414_10284424 Ga0307414_102844242 247
47 3300032005 Ga0307411_10090853 Ga0307411_100908531 247
48 3300032005 Ga0307411_10187398 Ga0307411_101873982 247
49 3300032126 Ga0307415_100047605 Ga0307415_1000476053 247
50 3300032126 Ga0307415_100249203 Ga0307415_1002492032 247
51 3300032126 Ga0307415_100608173 Ga0307415_1006081732 247
52 3300032126 Ga0307415_100610014 Ga0307415_1006100141 247
53 3300032126 Ga0307415_100673229 Ga0307415_1006732291 247
54 3300041413 Ga0439465_0024771 Ga0439465_0024771_347_1186 247
55 3300042007 Ga0439449_0068837 Ga0439449_0068837_27_788 247
56 3300048910 Ga0496107_0009300 Ga0496107_0009300_5807_6568 247
57 3300048912 Ga0496109_0042041 Ga0496109_0042041_3364_4125 247
58 3300048917 Ga0496114_0034203 Ga0496114_0034203_180_941 247
59 3300050516 nmdc:mga0sz30_26502_c1 nmdc:mga0sz30_26502_c1_1536_2291 247
60 3300005336 Ga0070680_100001358 Ga0070680_10000135817 248
61 3300005339 Ga0070660_100005885 Ga0070660_10000588511 248
62 3300005344 Ga0070661_100000130 Ga0070661_10000013032 248
63 3300005347 Ga0070668_100036691 Ga0070668_1000366912 248
64 3300005530 Ga0070679_100000021 Ga0070679_10000002142 248
65 3300006195 Ga0075366_10058046 Ga0075366_100580463 248
66 3300013100 Ga0157373_10017526 Ga0157373_100175262 248
67 3300014326 Ga0157380_10011491 Ga0157380_100114913 248
68 3300025917 Ga0207660_10001149 Ga0207660_1000114916 248
69 3300025919 Ga0207657_10004663 Ga0207657_1000466310 248
70 3300025920 Ga0207649_10000134 Ga0207649_1000013419 248
71 3300025921 Ga0207652_10000047 Ga0207652_1000004742 248
72 3300025972 Ga0207668_10021456 Ga0207668_100214563 248
73 3300026067 Ga0207678_10049447 Ga0207678_100494471 248
74 3300031548 Ga0307408_100031386 Ga0307408_1000313863 248
75 3300031548 Ga0307408_100078118 Ga0307408_1000781183 248
76 3300031548 Ga0307408_100153999 Ga0307408_1001539992 248
77 3300031548 Ga0307408_100230904 Ga0307408_1002309042 248
78 3300031548 Ga0307408_100268591 Ga0307408_1002685912 248
79 3300031548 Ga0307408_100460514 Ga0307408_1004605142 248
80 3300031548 Ga0307408_100519511 Ga0307408_1005195112 248
81 3300031548 Ga0307408_100587346 Ga0307408_1005873462 248
82 3300031731 Ga0307405_10003628 Ga0307405_100036285 248
83 3300031824 Ga0307413_10010265 Ga0307413_100102653 248
84 3300031824 Ga0307413_10018859 Ga0307413_100188593 248
85 3300031824 Ga0307413_10070663 Ga0307413_100706632 248
86 3300031824 Ga0307413_10080391 Ga0307413_100803912 248
87 3300031824 Ga0307413_10081161 Ga0307413_100811613 248
88 3300031824 Ga0307413_10161070 Ga0307413_101610702 248
89 3300031852 Ga0307410_10002327 Ga0307410_100023274 248
90 3300031852 Ga0307410_10020593 Ga0307410_100205932 248
91 3300031852 Ga0307410_10095123 Ga0307410_100951232 248
92 3300031852 Ga0307410_10219668 Ga0307410_102196682 248
93 3300031852 Ga0307410_10273402 Ga0307410_102734022 248
94 3300031852 Ga0307410_10517664 Ga0307410_105176641 248
95 3300031852 Ga0307410_10562212 Ga0307410_105622121 248
96 3300031901 Ga0307406_10037349 Ga0307406_100373492 248
97 3300031901 Ga0307406_10043219 Ga0307406_100432191 248
98 3300031901 Ga0307406_10050676 Ga0307406_100506762 248
99 3300031901 Ga0307406_10062212 Ga0307406_100622121 248
100 3300031901 Ga0307406_10636265 Ga0307406_106362651 248
101 3300031903 Ga0307407_10013656 Ga0307407_100136566 248
102 3300031903 Ga0307407_10029992 Ga0307407_100299921 248
103 3300031903 Ga0307407_10122941 Ga0307407_101229412 248
104 3300031903 Ga0307407_10174667 Ga0307407_101746672 248
105 3300031903 Ga0307407_10256689 Ga0307407_102566892 248
106 3300031911 Ga0307412_10007154 Ga0307412_100071542 248
107 3300031911 Ga0307412_10091943 Ga0307412_100919432 248
108 3300031911 Ga0307412_10143439 Ga0307412_101434392 248
109 3300031911 Ga0307412_10359706 Ga0307412_103597061 248
110 3300031995 Ga0307409_100016370 Ga0307409_1000163703 248
111 3300031995 Ga0307409_100027692 Ga0307409_1000276923 248
112 3300031995 Ga0307409_100083824 Ga0307409_1000838242 248
113 3300031995 Ga0307409_100100438 Ga0307409_1001004382 248
114 3300031995 Ga0307409_100115599 Ga0307409_1001155992 248
115 3300031995 Ga0307409_100226475 Ga0307409_1002264752 248
116 3300031995 Ga0307409_100247029 Ga0307409_1002470292 248
117 3300031995 Ga0307409_100321709 Ga0307409_1003217092 248
118 3300031995 Ga0307409_100461361 Ga0307409_1004613611 248
119 3300031995 Ga0307409_100536008 Ga0307409_1005360082 248
120 3300032002 Ga0307416_100014167 Ga0307416_1000141675 248
121 3300032002 Ga0307416_100028811 Ga0307416_1000288112 248
122 3300032002 Ga0307416_100106303 Ga0307416_1001063033 248
123 3300032002 Ga0307416_100149309 Ga0307416_1001493091 248
124 3300032002 Ga0307416_100171330 Ga0307416_1001713302 248
125 3300032002 Ga0307416_100257064 Ga0307416_1002570642 248
126 3300032002 Ga0307416_100260556 Ga0307416_1002605561 248
127 3300032002 Ga0307416_100281023 Ga0307416_1002810232 248
128 3300032002 Ga0307416_100288637 Ga0307416_1002886372 248
129 3300032004 Ga0307414_10016468 Ga0307414_100164683 248
130 3300032004 Ga0307414_10021952 Ga0307414_100219523 248
131 3300032004 Ga0307414_10036216 Ga0307414_100362162 248
132 3300032004 Ga0307414_10043073 Ga0307414_100430733 248
133 3300032004 Ga0307414_10069291 Ga0307414_100692913 248
134 3300032004 Ga0307414_10103098 Ga0307414_101030981 248
135 3300032004 Ga0307414_10115852 Ga0307414_101158522 248
136 3300032004 Ga0307414_10173381 Ga0307414_101733811 248
137 3300032004 Ga0307414_10330735 Ga0307414_103307351 248
138 3300032004 Ga0307414_10462035 Ga0307414_104620352 248
139 3300032005 Ga0307411_10003985 Ga0307411_100039853 248
140 3300032005 Ga0307411_10015231 Ga0307411_100152315 248
141 3300032005 Ga0307411_10015841 Ga0307411_100158415 248
142 3300032005 Ga0307411_10030041 Ga0307411_100300413 248
143 3300032005 Ga0307411_10038700 Ga0307411_100387003 248
144 3300032005 Ga0307411_10048899 Ga0307411_100488992 248
145 3300032005 Ga0307411_10371309 Ga0307411_103713092 248
146 3300032005 Ga0307411_10521708 Ga0307411_105217081 248
147 3300032005 Ga0307411_10546403 Ga0307411_105464031 248
148 3300032126 Ga0307415_100003133 Ga0307415_1000031334 248
149 3300032126 Ga0307415_100022155 Ga0307415_1000221553 248
150 3300032126 Ga0307415_100034655 Ga0307415_1000346552 248
151 3300032126 Ga0307415_100047266 Ga0307415_1000472662 248
152 3300032126 Ga0307415_100063948 Ga0307415_1000639483 248
153 3300042004 Ga0439445_0000846 Ga0439445_0000846_4507_5277 248
154 3300042439 Ga0439464_0005723 Ga0439464_0005723_1116_1886 248
155 3300046616 Ga0495668_0031992 Ga0495668_0031992_1857_2627 248
156 3300048912 Ga0496109_0682544 Ga0496109_0682544_181_951 248
157 3300050494 nmdc:mga06z11_218313_c1 nmdc:mga06z11_218313_c1_13_882 248
158 3300027876 Ga0209974_10017601 Ga0209974_100176012 249
159 iso_pu_bacteria 2857564685 2857568495 249
160 iso_pu_bacteria 2643221554 2643791347 250
161 iso_pu_bacteria 2842711865 2842712684 250
162 3300032126 Ga0307415_100146447 Ga0307415_1001464472 253
163 3300046507 Ga0495606_0000224 Ga0495606_0000224_96259_97023 253
164 3300002774 JGI25150J39212_1014708 JGI25150J39212_10147082 254
165 3300003771 Ga0055526_1000430 Ga0055526_100043018 254
166 3300003771 Ga0055526_1001986 Ga0055526_10019863 254
167 3300003773 Ga0055537_1000804 Ga0055537_10008049 254
168 3300003773 Ga0055537_1003245 Ga0055537_10032453 254
169 3300003790 Ga0055528_1001228 Ga0055528_10012288 254
170 3300003791 Ga0055530_10000941 Ga0055530_1000094113 254
171 3300025245 Ga0207425_1000245 Ga0207425_100024528 254
172 3300025245 Ga0207425_1021209 Ga0207425_10212092 254
173 3300025263 Ga0209565_1000015 Ga0209565_100001562 254
174 3300025273 Ga0209673_1000394 Ga0209673_100039462 254
175 3300025291 Ga0209675_1000012 Ga0209675_1000012420 254
176 3300025294 Ga0209025_1010537 Ga0209025_10105376 254
177 3300025295 Ga0209564_1000011 Ga0209564_1000011285 254
178 3300025295 Ga0209564_1000016 Ga0209564_1000016533 254
179 3300025295 Ga0209564_1003929 Ga0209564_100392911 254
180 3300025297 Ga0209758_1004343 Ga0209758_10043437 254
181 3300025298 Ga0209050_1000240 Ga0209050_100024063 254
182 3300025299 Ga0209256_1000076 Ga0209256_100007623 254
183 3300032002 Ga0307416_100012493 Ga0307416_1000124935 254
184 3300035114 Ga0373939_0004485 Ga0373939_0004485_533_1297 254
185 3300046471 Ga0495650_0000135 Ga0495650_0000135_117883_118680 254
186 3300046471 Ga0495650_0000521 Ga0495650_0000521_22396_23160 254
187 3300046491 Ga0495584_0035938 Ga0495584_0035938_32_796 254
188 3300046501 Ga0495607_0000522 Ga0495607_0000522_32444_33208 254
189 3300046507 Ga0495606_0000001 Ga0495606_0000001_542914_543678 254
190 3300046507 Ga0495606_0005710 Ga0495606_0005710_8912_9676 254
191 3300046512 Ga0495610_0003856 Ga0495610_0003856_1810_2574 254
192 3300046512 Ga0495610_0025585 Ga0495610_0025585_1589_2353 254
193 3300046522 Ga0495643_0176762 Ga0495643_0176762_87_851 254
194 3300046538 Ga0495609_0000163 Ga0495609_0000163_19748_20512 254
195 3300046542 Ga0495597_0011449 Ga0495597_0011449_2059_2823 254
196 3300046557 Ga0495622_0000055 Ga0495622_0000055_99266_100030 254
197 3300046558 Ga0495633_0000244 Ga0495633_0000244_62782_63546 254
198 3300046616 Ga0495668_0000120 Ga0495668_0000120_39155_39931 254
199 3300046616 Ga0495668_0000241 Ga0495668_0000241_52435_53199 254
200 3300046616 Ga0495668_0006872 Ga0495668_0006872_2147_2911 254
201 3300046660 Ga0495625_0009607 Ga0495625_0009607_2024_2788 254
202 3300046660 Ga0495625_0032331 Ga0495625_0032331_1564_2328 254
203 3300046664 Ga0495659_0002554 Ga0495659_0002554_1178_1942 254
204 3300046665 Ga0495661_0057832 Ga0495661_0057832_1441_2205 254
205 3300046684 Ga0495669_0001176 Ga0495669_0001176_8772_9536 254
206 3300046694 Ga0495649_0014124 Ga0495649_0014124_2516_3280 254
207 3300046810 Ga0495660_0005381 Ga0495660_0005381_6644_7456 254
208 3300047320 Ga0495672_0000171 Ga0495672_0000171_75172_75984 254
209 3300047443 Ga0495687_030440 Ga0495687_030440_320_1084 254
210 3300047472 Ga0495686_0005890 Ga0495686_0005890_2124_2888 254
211 3300048927 Ga0496124_0073541 Ga0496124_0073541_1980_2744 254
212 3300049459 Ga0495678_028102 Ga0495678_028102_228_1004 254
213 3300049459 Ga0495678_087662 Ga0495678_087662_131_943 254

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

46

261

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ij5-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase from <i>hydrogenobacter thermophilus</i> tk-6 0.8574 8 232
6e4b-assembly2.cif.gz_C the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8504 6 232
6e4b-assembly2.cif.gz_D the crystal structure of a putative alpha-ribazole-5'-p phosphatase from escherichia coli str. k-12 substr. mg1655 0.8434 8 232
1ebb-assembly1.cif.gz_A bacillus stearothermophilus yhfr 0.8359 8 226
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.8352 8 230
ID Description Score Start End Superfamily
af_A0A368UGZ2_77_264_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8712 9 231 3.40.50.1240
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8569 9 209 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8543 8 228 3.40.50.1240
af_F4KI56_14_225_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8467 1 232 3.40.50.1240
af_Q86HD1_259_461_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8451 9 209 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A354IUG5-F1-model_v4 Histidine phosphatase family protein 0.9707 1 239 GO:0005737
GO:0016791
AF-A0A354IUG5-F1-model_v4 Histidine phosphatase family protein 0.9667 1 239 GO:0005737
GO:0016791
AF-A0A7V9DWP0-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9644 1 213 GO:0006096
GO:0016868
AF-A0A848DCR3-F1-model_v4 Histidine phosphatase family protein 0.9614 1 232 GO:0005737
GO:0016791
AF-A0A2V7H7X5-F1-model_v4 Histidine phosphatase family protein 0.9613 3 176 GO:0003824

Feature Viewer

pLDDT pTM Quality
88.78 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map