F324540

General Info

Members Datasets Scaffolds Average Seq Length
213 145 422 252

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0237872|Ga0501081_0237872_17_889
Length 290
Sequence LDPVVEPEQAAMDALQEVNSVIPGIYVGNQVRPESEYRQALELIEAGINDCEVGRRLGIPRGTIRDWRVGLASASGGRTKLWSGERPLPTCFRCDGGWVDEKAYTYLLGQYLGDGCLSEMPRQVYRLRIACDLKYPDIINEIASCIVVTRGAEMVGFVLCPGCVEVYSYWKHWPCLFPQHGPGRKHERLIELLPWQSEIVATHPRALVRGLIHSDGCRHINPITRRLPSGIKHYEYTRYMFTNVSTDILTIFTDALDLLEVHWTQTTARDIAVSRRDDVAFLDSFVGPKS

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
67 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
68 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
75 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
76 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
77 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
78 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
79 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
86 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
95 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
106 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
136 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
137 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
138 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
139 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
140 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
142 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
143 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
144 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
145 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 0.47
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0.94
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 9.39
Rhizosphere 85.45
Stem 0
Stem Tuber 0
Unclassified 7.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0237872 3300049743 Unclassified 1327
2 JGI25406J46586_10030302 3300003203 Bacteria 2037
3 Ga0070683_100246802 3300005329 Bacteria 1698
4 Ga0070683_100421884 3300005329 Bacteria 1273
5 Ga0070683_100514349 3300005329 Bacteria 1144
6 Ga0070680_100040735 3300005336 Bacteria 3763
7 Ga0070660_100041886 3300005339 Bacteria 3493
8 Ga0070689_100387834 3300005340 Bacteria 1178
9 Ga0070668_100122435 3300005347 Unclassified 2080
10 Ga0070668_100514753 3300005347 Bacteria 1037
11 Ga0070714_100012181 3300005435 Bacteria 6855
12 Ga0070714_100349699 3300005435 Bacteria 1388
13 Ga0070714_100510300 3300005435 Bacteria 1147
14 Ga0070714_100676562 3300005435 Bacteria 995
15 Ga0070713_100106615 3300005436 Bacteria 2436
16 Ga0070713_100519878 3300005436 Bacteria 1125
17 Ga0070711_100069805 3300005439 Bacteria 2473
18 Ga0070700_100005873 3300005441 Bacteria 6522
19 Ga0070681_10006486 3300005458 Bacteria 11387
20 Ga0070681_10414088 3300005458 Bacteria 1259
21 Ga0070706_100058089 3300005467 Bacteria 3570
22 Ga0070698_100010478 3300005471 Bacteria 9887
23 Ga0070679_100002003 3300005530 Bacteria 18279
24 Ga0070679_100068906 3300005530 Bacteria 3529
25 Ga0070679_100189864 3300005530 Bacteria 2024
26 Ga0070684_100012768 3300005535 Bacteria 6746
27 Ga0070684_100086341 3300005535 Bacteria 2784
28 Ga0068855_100040807 3300005563 Bacteria 5505
29 Ga0068859_100142614 3300005617 Bacteria 2469
30 Ga0068864_100234188 3300005618 Bacteria 1699
31 Ga0068861_100018303 3300005719 Bacteria 4989
32 Ga0068858_100079790 3300005842 Bacteria 3040
33 Ga0068860_100283176 3300005843 Bacteria 1621
34 Ga0081540_1054721 3300005983 Bacteria 1948
35 Ga0081539_10001427 3300005985 Bacteria 41045
36 Ga0070717_10112826 3300006028 Bacteria 2320
37 Ga0070717_10280651 3300006028 Bacteria 1477
38 Ga0070712_100422144 3300006175 Bacteria 1105
39 Ga0075430_100232403 3300006846 Bacteria 1529
40 Ga0075431_100000088 3300006847 Bacteria 56098
41 Ga0075431_100193239 3300006847 Bacteria 2085
42 Ga0075431_100341817 3300006847 Bacteria 1506
43 Ga0075433_10246250 3300006852 Bacteria 1586
44 Ga0075436_100222197 3300006914 Bacteria 1340
45 Ga0097620_100142604 3300006931 Bacteria 2469
46 Ga0075435_100228841 3300007076 Bacteria 1579
47 Ga0105245_10041414 3300009098 Bacteria 4106
48 Ga0105245_10282880 3300009098 Bacteria 1622
49 Ga0105241_10141817 3300009174 Bacteria 1957
50 Ga0105249_10194969 3300009553 Unclassified 1979
51 Ga0105239_10542471 3300010375 Bacteria 1324
52 Ga0105246_10561059 3300011119 Bacteria 980
53 Ga0157370_10145606 3300013104 Bacteria 2206
54 Ga0157369_10029821 3300013105 Bacteria 6025
55 Ga0157369_10103712 3300013105 Bacteria 3029
56 Ga0157372_10321277 3300013307 Bacteria 1802
57 Ga0197907_10357171 3300020069 Bacteria 977
58 Ga0213875_10053767 3300021388 Bacteria 1886
59 Ga0207705_10001935 3300025909 Bacteria 16168
60 Ga0207684_10106686 3300025910 Bacteria 2396
61 Ga0207684_10545261 3300025910 Bacteria 992
62 Ga0207707_10077049 3300025912 Bacteria 2910
63 Ga0207707_10249283 3300025912 Bacteria 1543
64 Ga0207693_10024906 3300025915 Bacteria 4746
65 Ga0207663_10055042 3300025916 Bacteria 2494
66 Ga0207660_10323484 3300025917 Bacteria 1232
67 Ga0207657_10029172 3300025919 Bacteria 5026
68 Ga0207646_10311347 3300025922 Bacteria 1423
69 Ga0207700_10457844 3300025928 Bacteria 1125
70 Ga0207700_10542716 3300025928 Bacteria 1031
71 Ga0207664_10425867 3300025929 Bacteria 1183
72 Ga0207664_10454925 3300025929 Bacteria 1143
73 Ga0207644_10438932 3300025931 Bacteria 1071
74 Ga0207706_10009797 3300025933 Bacteria 8792
75 Ga0207661_10195913 3300025944 Bacteria 1774
76 Ga0207661_10258020 3300025944 Bacteria 1552
77 Ga0207661_10448207 3300025944 Bacteria 1175
78 Ga0207712_10026405 3300025961 Bacteria 3869
79 Ga0207712_10161736 3300025961 Bacteria 1741
80 Ga0207668_10036744 3300025972 Bacteria 3272
81 Ga0207639_10255090 3300026041 Bacteria 1531
82 Ga0207676_10245827 3300026095 Bacteria 1608
83 Ga0207674_10096689 3300026116 Bacteria 2938
84 Ga0268264_10832909 3300028381 Bacteria 923
85 Ga0307405_10114365 3300031731 Bacteria 1834
86 Ga0307410_10412071 3300031852 Bacteria 1094
87 Ga0307409_100269423 3300031995 Bacteria 1567
88 Ga0307416_100203055 3300032002 Bacteria 1882
89 Ga0307415_100321547 3300032126 Bacteria 1290
90 Ga0373956_0027910 3300035119 Bacteria 2454
91 Ga0373924_0013238 3300035410 Bacteria 3097
92 Ga0373925_0000010 3300037068 Bacteria 229059
93 Ga0373925_0066630 3300037068 Bacteria 2714
94 Ga0373925_0368625 3300037068 Bacteria 1168
95 Ga0373925_0529402 3300037068 Bacteria 968
96 Ga0395900_0026020 3300037418 Bacteria 5991
97 Ga0395905_0370667 3300037471 Bacteria 1325
98 Ga0436364_0890681 3300037853 Bacteria 1699
99 Ga0436364_1092251 3300037853 Bacteria 3335
100 Ga0395901_0005418 3300038443 Bacteria 12912
101 Ga0395901_0006340 3300038443 Bacteria 11982
102 Ga0436362_0068107 3300039453 Bacteria 1776
103 Ga0466966_0108737 3300044684 Bacteria 1710
104 Ga0466961_0016232 3300044693 Bacteria 4782
105 Ga0466961_0169618 3300044693 Bacteria 1358
106 Ga0466960_0034877 3300044901 Bacteria 2347
107 Ga0466959_0008323 3300045049 Bacteria 7326
108 Ga0466959_0058038 3300045049 Bacteria 2820
109 Ga0466959_0322000 3300045049 Bacteria 1057
110 Ga0466958_0192704 3300045836 Bacteria 1296
111 Ga0495603_0124764 3300046455 Bacteria 1500
112 Ga0495629_0023315 3300046459 Bacteria 4411
113 Ga0495653_0159770 3300046463 Bacteria 1565
114 Ga0495582_0044994 3300046473 Bacteria 2431
115 Ga0495640_0119128 3300046533 Bacteria 1718
116 Ga0495586_0015966 3300046535 Bacteria 3995
117 Ga0495586_0061354 3300046535 Bacteria 2046
118 Ga0495587_0147065 3300046536 Bacteria 1343
119 Ga0495645_0485234 3300046543 Bacteria 775
120 Ga0495634_0018070 3300046642 Bacteria 5024
121 Ga0495634_0025427 3300046642 Bacteria 4142
122 Ga0495635_0188621 3300046663 Bacteria 1400
123 Ga0495635_0379949 3300046663 Bacteria 940
124 Ga0495657_0206612 3300046675 Bacteria 1195
125 Ga0495599_0002873 3300046678 Bacteria 10033
126 Ga0495599_0058172 3300046678 Bacteria 2418
127 Ga0495613_0007908 3300046689 Bacteria 7909
128 Ga0495613_0169130 3300046689 Bacteria 1552
129 Ga0495674_0119704 3300047319 Bacteria 2225
130 Ga0495676_0037684 3300047321 Bacteria 4021
131 Ga0495680_0053490 3300047322 Bacteria 3141
132 Ga0495684_0192123 3300047471 Bacteria 1509
133 Ga0495602_0081856 3300048088 Bacteria 2712
134 Ga0496100_0050003 3300048903 Bacteria 2706
135 Ga0496101_0309783 3300048904 Bacteria 1238
136 Ga0496102_0167594 3300048905 Bacteria 2067
137 Ga0496103_0130254 3300048906 Bacteria 1606
138 Ga0496104_0000009 3300048907 Bacteria 488055
139 Ga0496104_1029251 3300048907 Bacteria 727
140 Ga0496105_0000007 3300048908 Bacteria 339658
141 Ga0496106_0024266 3300048909 Bacteria 4506
142 Ga0496106_0655955 3300048909 Bacteria 838
143 Ga0496108_0081565 3300048911 Bacteria 2741
144 Ga0496108_0569565 3300048911 Bacteria 987
145 Ga0496109_0025615 3300048912 Bacteria 5257
146 Ga0496109_0178784 3300048912 Bacteria 1992
147 Ga0496109_0209876 3300048912 Bacteria 1831
148 Ga0496110_0065028 3300048913 Bacteria 3224
149 Ga0496111_0028786 3300048914 Unclassified 3939
150 Ga0496111_0031496 3300048914 Bacteria 3778
151 Ga0496112_0085265 3300048915 Bacteria 3125
152 Ga0496113_0159553 3300048916 Bacteria 1782
153 Ga0496113_0463831 3300048916 Unclassified 1018
154 Ga0496126_0034831 3300048929 Bacteria 4724
155 Ga0496126_0079050 3300048929 Bacteria 2913
156 Ga0501031_0055336 3300049568 Bacteria 2585
157 Ga0501031_0128130 3300049568 Bacteria 1658
158 Ga0501031_0329785 3300049568 Unclassified 988
159 Ga0501036_0003139 3300049572 Bacteria 13179
160 Ga0501036_0154155 3300049572 Bacteria 1938
161 Ga0501038_0008981 3300049574 Bacteria 9171
162 Ga0501039_0007028 3300049575 Bacteria 8568
163 Ga0501039_0076668 3300049575 Bacteria 2599
164 Ga0501039_0218073 3300049575 Unclassified 1500
165 Ga0501040_0005159 3300049576 Bacteria 8450
166 Ga0501040_0018107 3300049576 Unclassified 4678
167 Ga0501041_0060605 3300049577 Bacteria 2316
168 Ga0501041_0115071 3300049577 Unclassified 1670
169 Ga0501042_0189836 3300049578 Bacteria 1482
170 Ga0501042_0380258 3300049578 Unclassified 1022
171 Ga0501046_0141665 3300049580 Bacteria 1819
172 Ga0501069_0069526 3300049585 Bacteria 1971
173 Ga0501071_0027537 3300049587 Unclassified 3999
174 Ga0501072_0000649 3300049588 Bacteria 25023
175 Ga0501072_0118675 3300049588 Bacteria 2108
176 Ga0501074_0074354 3300049590 Bacteria 2440
177 Ga0501075_0059356 3300049591 Bacteria 2881
178 Ga0501075_0089971 3300049591 Unclassified 2328
179 Ga0501075_0134523 3300049591 Bacteria 1883
180 Ga0501076_0043622 3300049592 Bacteria 3535
181 Ga0501077_0001509 3300049593 Bacteria 14036
182 Ga0501079_0139455 3300049741 Bacteria 1888
183 Ga0501079_0159384 3300049741 Bacteria 1759
184 Ga0501080_0517208 3300049742 Bacteria 1065
185 Ga0501081_0013574 3300049743 Bacteria 5358
186 Ga0501081_0094274 3300049743 Unclassified 2109
187 Ga0501045_0002618 3300049824 Bacteria 12255
188 Ga0501045_0071873 3300049824 Bacteria 2547
189 nmdc:mga00v17_157602_c1 3300050491 Bacteria 1460
190 nmdc:mga0qj67_329368_c1 3300050509 Bacteria 1236
191 nmdc:mga0qj67_87445_c1 3300050509 Bacteria 2501
192 nmdc:mga06r32_1652_c1 3300050510 Bacteria 20136
193 nmdc:mga06r32_509808_c1 3300050510 Bacteria 1179
194 nmdc:mga0rr50_13449_c1 3300050513 Bacteria 5328
195 nmdc:mga0sz30_12914_c1 3300050516 Bacteria 3259
196 Ga0495601_0221871 3300053077 Bacteria 1235
197 Ga0495619_0487967 3300053085 Unclassified 848
198 Ga0500643_006984 3300053087 Bacteria 4632
199 Ga0500616_0000398 3300053153 Bacteria 59666
200 Ga0501084_0002302 3300054114 Bacteria 15350
201 Ga0501084_0029948 3300054114 Unclassified 4553
202 Ga0501084_0039007 3300054114 Unclassified 3973
203 Ga0501082_0022265 3300060353 Bacteria 5461
204 Ga0501082_0063870 3300060353 Unclassified 3170
205 Ga0501082_0333462 3300060353 Bacteria 1322
206 Ga0530510_0002915 3300061734 Bacteria 11731
207 Ga0530510_0266071 3300061734 Bacteria 1279
208 2515850921 2515154155 Bacteria 7985436
209 2816425457 2816332119 Bacteria 8120218
210 2984579856 2984576629 Bacteria 4248407
211 2990257462 2990256926 Bacteria 4252839
212 Ga0501081_0237872
213 JGI25406J46586_10030302
214 Ga0070683_100246802
215 Ga0070683_100421884
216 Ga0070683_100514349
217 Ga0070680_100040735
218 Ga0070660_100041886
219 Ga0070689_100387834
220 Ga0070668_100122435
221 Ga0070668_100514753
222 Ga0070714_100012181
223 Ga0070714_100349699
224 Ga0070714_100510300
225 Ga0070714_100676562
226 Ga0070713_100106615
227 Ga0070713_100519878
228 Ga0070711_100069805
229 Ga0070700_100005873
230 Ga0070681_10006486
231 Ga0070681_10414088
232 Ga0070706_100058089
233 Ga0070698_100010478
234 Ga0070679_100002003
235 Ga0070679_100068906
236 Ga0070679_100189864
237 Ga0070684_100012768
238 Ga0070684_100086341
239 Ga0068855_100040807
240 Ga0068859_100142614
241 Ga0068864_100234188
242 Ga0068861_100018303
243 Ga0068858_100079790
244 Ga0068860_100283176
245 Ga0081540_1054721
246 Ga0081539_10001427
247 Ga0070717_10112826
248 Ga0070717_10280651
249 Ga0070712_100422144
250 Ga0075430_100232403
251 Ga0075431_100000088
252 Ga0075431_100193239
253 Ga0075431_100341817
254 Ga0075433_10246250
255 Ga0075436_100222197
256 Ga0097620_100142604
257 Ga0075435_100228841
258 Ga0105245_10041414
259 Ga0105245_10282880
260 Ga0105241_10141817
261 Ga0105249_10194969
262 Ga0105239_10542471
263 Ga0105246_10561059
264 Ga0157370_10145606
265 Ga0157369_10029821
266 Ga0157369_10103712
267 Ga0157372_10321277
268 Ga0197907_10357171
269 Ga0213875_10053767
270 Ga0207705_10001935
271 Ga0207684_10106686
272 Ga0207684_10545261
273 Ga0207707_10077049
274 Ga0207707_10249283
275 Ga0207693_10024906
276 Ga0207663_10055042
277 Ga0207660_10323484
278 Ga0207657_10029172
279 Ga0207646_10311347
280 Ga0207700_10457844
281 Ga0207700_10542716
282 Ga0207664_10425867
283 Ga0207664_10454925
284 Ga0207644_10438932
285 Ga0207706_10009797
286 Ga0207661_10195913
287 Ga0207661_10258020
288 Ga0207661_10448207
289 Ga0207712_10026405
290 Ga0207712_10161736
291 Ga0207668_10036744
292 Ga0207639_10255090
293 Ga0207676_10245827
294 Ga0207674_10096689
295 Ga0268264_10832909
296 Ga0307405_10114365
297 Ga0307410_10412071
298 Ga0307409_100269423
299 Ga0307416_100203055
300 Ga0307415_100321547
301 Ga0373956_0027910
302 Ga0373924_0013238
303 Ga0373925_0000010
304 Ga0373925_0066630
305 Ga0373925_0368625
306 Ga0373925_0529402
307 Ga0395900_0026020
308 Ga0395905_0370667
309 Ga0436364_0890681
310 Ga0436364_1092251
311 Ga0395901_0005418
312 Ga0395901_0006340
313 Ga0436362_0068107
314 Ga0466966_0108737
315 Ga0466961_0016232
316 Ga0466961_0169618
317 Ga0466960_0034877
318 Ga0466959_0008323
319 Ga0466959_0058038
320 Ga0466959_0322000
321 Ga0466958_0192704
322 Ga0495603_0124764
323 Ga0495629_0023315
324 Ga0495653_0159770
325 Ga0495582_0044994
326 Ga0495640_0119128
327 Ga0495586_0015966
328 Ga0495586_0061354
329 Ga0495587_0147065
330 Ga0495645_0485234
331 Ga0495634_0018070
332 Ga0495634_0025427
333 Ga0495635_0188621
334 Ga0495635_0379949
335 Ga0495657_0206612
336 Ga0495599_0002873
337 Ga0495599_0058172
338 Ga0495613_0007908
339 Ga0495613_0169130
340 Ga0495674_0119704
341 Ga0495676_0037684
342 Ga0495680_0053490
343 Ga0495684_0192123
344 Ga0495602_0081856
345 Ga0496100_0050003
346 Ga0496101_0309783
347 Ga0496102_0167594
348 Ga0496103_0130254
349 Ga0496104_0000009
350 Ga0496104_1029251
351 Ga0496105_0000007
352 Ga0496106_0024266
353 Ga0496106_0655955
354 Ga0496108_0081565
355 Ga0496108_0569565
356 Ga0496109_0025615
357 Ga0496109_0178784
358 Ga0496109_0209876
359 Ga0496110_0065028
360 Ga0496111_0028786
361 Ga0496111_0031496
362 Ga0496112_0085265
363 Ga0496113_0159553
364 Ga0496113_0463831
365 Ga0496126_0034831
366 Ga0496126_0079050
367 Ga0501031_0055336
368 Ga0501031_0128130
369 Ga0501031_0329785
370 Ga0501036_0003139
371 Ga0501036_0154155
372 Ga0501038_0008981
373 Ga0501039_0007028
374 Ga0501039_0076668
375 Ga0501039_0218073
376 Ga0501040_0005159
377 Ga0501040_0018107
378 Ga0501041_0060605
379 Ga0501041_0115071
380 Ga0501042_0189836
381 Ga0501042_0380258
382 Ga0501046_0141665
383 Ga0501069_0069526
384 Ga0501071_0027537
385 Ga0501072_0000649
386 Ga0501072_0118675
387 Ga0501074_0074354
388 Ga0501075_0059356
389 Ga0501075_0089971
390 Ga0501075_0134523
391 Ga0501076_0043622
392 Ga0501077_0001509
393 Ga0501079_0139455
394 Ga0501079_0159384
395 Ga0501080_0517208
396 Ga0501081_0013574
397 Ga0501081_0094274
398 Ga0501045_0002618
399 Ga0501045_0071873
400 nmdc:mga00v17_157602_c1
401 nmdc:mga0qj67_329368_c1
402 nmdc:mga0qj67_87445_c1
403 nmdc:mga06r32_1652_c1
404 nmdc:mga06r32_509808_c1
405 nmdc:mga0rr50_13449_c1
406 nmdc:mga0sz30_12914_c1
407 Ga0495601_0221871
408 Ga0495619_0487967
409 Ga0500643_006984
410 Ga0500616_0000398
411 Ga0501084_0002302
412 Ga0501084_0029948
413 Ga0501084_0039007
414 Ga0501082_0022265
415 Ga0501082_0063870
416 Ga0501082_0333462
417 Ga0530510_0002915
418 Ga0530510_0266071
419 2515850921
420 2816425457
421 2984579856
422 2990257462

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r0q-assembly1.cif.gz_E crystal structure of a serine recombinase- dna regulatory complex 0.9526 4 40
1tc3-assembly1.cif.gz_C transposase tc3a1-65 from caenorhabditis elegans 0.8982 1 42
2r0q-assembly1.cif.gz_F crystal structure of a serine recombinase- dna regulatory complex 0.8129 4 43
5lkq-assembly1.cif.gz_B protease domain of rada 0.7571 185 204
1tc3-assembly1.cif.gz_C transposase tc3a1-65 from caenorhabditis elegans 0.7391 1 42
ID Description Score Start End Superfamily
1u78A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9223 1 39 1.10.10.60
1tc3C00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8982 1 42 1.10.10.60
af_P24610_34_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8439 1 42 1.10.10.10
af_Q20551_91_164_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8273 1 40 1.10.10.10
af_Q06710_1_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8258 1 40 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Y5P1B2-F1-model_v4 DOD-type homing endonuclease domain-containing protein 0.9672 67 251 GO:0004519
AF-A0A7W0H3K8-F1-model_v4 Homing endonuclease LAGLIDADG domain-containing protein 0.9639 76 251
AF-A0A537WJ24-F1-model_v4 Helix-turn-helix domain-containing protein 0.9607 81 248
AF-A0A2V6YFS9-F1-model_v4 DOD-type homing endonuclease domain-containing protein 0.9599 71 251
AF-G4I9Q5-F1-model_v4 deleted 0.9599 92 251

Map