F324196

General Info

Members Datasets Scaffolds Average Seq Length
213 130 213 200

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10068816|Ga0265325_100688162
Length 204
Sequence MGAPRKVKIALAAAGVFAISATAAAANWRDEASDYDINRLQLLEQWRDQALHEVQTYSDSRGDFAVLKSVMEPQGHIVPAKALIGNWRCRNMKMGGVNAFIVYPGWYPCHVSVQNGALFFQKTAGSIRTQGTLYPENGAWIYLGAASTTGEPWHTYSGRHPSLGAAATPDDQIGLLSGIGNNHMRLEIPGPVLESTYDIIELER

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
95 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
106 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
124 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
125 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
126 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
127 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
128 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
129 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 0
Rhizosphere 90.14
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000035 3300003214 Bacteria 290723
2 JGI25153J46596_10000362 3300003215 Bacteria 31305
3 Ga0070658_10006162 3300005327 Bacteria 9723
4 Ga0070683_100038521 3300005329 Bacteria 4383
5 Ga0070670_100680391 3300005331 Bacteria 924
6 Ga0070666_10069143 3300005335 Bacteria 2401
7 Ga0070666_10369594 3300005335 Bacteria 1028
8 Ga0070680_100570314 3300005336 Bacteria 971
9 Ga0068868_100038243 3300005338 Bacteria 3724
10 Ga0068868_101005757 3300005338 Unclassified 763
11 Ga0070660_100006445 3300005339 Bacteria 8137
12 Ga0070661_100199381 3300005344 Bacteria 1529
13 Ga0070671_100358924 3300005355 Bacteria 1244
14 Ga0070674_100730645 3300005356 Bacteria 849
15 Ga0070688_100026494 3300005365 Bacteria 3445
16 Ga0070659_100392760 3300005366 Bacteria 1170
17 Ga0070667_100034132 3300005367 Bacteria 4254
18 Ga0070663_100451984 3300005455 Bacteria 1059
19 Ga0070678_100008608 3300005456 Bacteria 6117
20 Ga0070678_100759735 3300005456 Bacteria 877
21 Ga0070681_10545315 3300005458 Bacteria 1073
22 Ga0070681_10611153 3300005458 Bacteria 1004
23 Ga0070681_10820099 3300005458 Bacteria 848
24 Ga0068867_100025863 3300005459 Bacteria 4210
25 Ga0070679_100004953 3300005530 Bacteria 12291
26 Ga0070684_100993346 3300005535 Bacteria 788
27 Ga0068853_100631370 3300005539 Bacteria 1018
28 Ga0070665_100000322 3300005548 Bacteria 73995
29 Ga0070665_100717863 3300005548 Bacteria 1013
30 Ga0068855_100085312 3300005563 Bacteria 3654
31 Ga0068855_100776986 3300005563 Bacteria 1019
32 Ga0068857_100304428 3300005577 Bacteria 1470
33 Ga0068864_100106888 3300005618 Bacteria 2489
34 Ga0068870_10041837 3300005840 Bacteria 2383
35 Ga0068858_100098545 3300005842 Bacteria 2725
36 Ga0068858_100163874 3300005842 Bacteria 2094
37 Ga0068858_101063030 3300005842 Unclassified 794
38 Ga0068860_100055155 3300005843 Bacteria 3777
39 Ga0068860_100065788 3300005843 Bacteria 3442
40 Ga0068862_100120335 3300005844 Bacteria 2313
41 Ga0097621_100000270 3300006237 Bacteria 35158
42 Ga0097621_100419030 3300006237 Bacteria 1201
43 Ga0068871_100004963 3300006358 Bacteria 9293
44 Ga0068871_100008068 3300006358 Bacteria 7558
45 Ga0068871_100041456 3300006358 Bacteria 3692
46 Ga0068871_100307224 3300006358 Bacteria 1393
47 Ga0068871_100570449 3300006358 Unclassified 1027
48 Ga0068865_100009233 3300006881 Bacteria 6107
49 Ga0105240_10283930 3300009093 Bacteria 1900
50 Ga0105240_10403988 3300009093 Bacteria 1538
51 Ga0105240_10806916 3300009093 Bacteria 1016
52 Ga0105240_10822056 3300009093 Bacteria 1005
53 Ga0105243_11356504 3300009148 Unclassified 730
54 Ga0105241_11204561 3300009174 Bacteria 717
55 Ga0105242_10009472 3300009176 Bacteria 7463
56 Ga0105242_10280133 3300009176 Bacteria 1514
57 Ga0105242_11796736 3300009176 Bacteria 651
58 Ga0105237_10131199 3300009545 Bacteria 2500
59 Ga0105238_10040277 3300009551 Bacteria 4735
60 Ga0105238_10076893 3300009551 Bacteria 3330
61 Ga0105238_10463247 3300009551 Bacteria 1265
62 Ga0105238_10659085 3300009551 Bacteria 1057
63 Ga0105249_10887059 3300009553 Bacteria 958
64 Ga0105239_10111321 3300010375 Bacteria 3035
65 Ga0105239_10684587 3300010375 Bacteria 1172
66 Ga0105246_10035427 3300011119 Bacteria 3336
67 Ga0157370_10149873 3300013104 Bacteria 2171
68 Ga0157370_10501016 3300013104 Bacteria 1115
69 Ga0157374_10028075 3300013296 Bacteria 5082
70 Ga0157378_10290670 3300013297 Bacteria 1579
71 Ga0157378_10341366 3300013297 Bacteria 1461
72 Ga0163162_10045535 3300013306 Bacteria 4396
73 Ga0163162_10048644 3300013306 Bacteria 4249
74 Ga0157372_10336719 3300013307 Bacteria 1758
75 Ga0157375_10015905 3300013308 Bacteria 6745
76 Ga0157375_11182308 3300013308 Unclassified 897
77 Ga0163163_10000004 3300014325 Bacteria 416569
78 Ga0163163_10110194 3300014325 Bacteria 2781
79 Ga0163163_10713380 3300014325 Bacteria 1066
80 Ga0157379_10001857 3300014968 Bacteria 17483
81 Ga0157379_10106295 3300014968 Bacteria 2519
82 Ga0157379_10586751 3300014968 Bacteria 1039
83 Ga0157376_10026400 3300014969 Bacteria 4589
84 Ga0157376_10328853 3300014969 Bacteria 1456
85 Ga0157376_10375773 3300014969 Bacteria 1367
86 Ga0157376_10523329 3300014969 Bacteria 1169
87 Ga0157376_10928907 3300014969 Bacteria 889
88 Ga0163161_10134550 3300017792 Bacteria 1867
89 Ga0213876_10012219 3300021384 Bacteria 4572
90 Ga0209233_1000006 3300025261 Bacteria 1473685
91 Ga0209233_1001071 3300025261 Bacteria 11343
92 Ga0209758_1000008 3300025297 Bacteria 1215263
93 Ga0207642_10040043 3300025899 Bacteria 2042
94 Ga0207680_10194827 3300025903 Bacteria 1378
95 Ga0207680_10426962 3300025903 Bacteria 939
96 Ga0207643_10018576 3300025908 Bacteria 3806
97 Ga0207705_10009613 3300025909 Bacteria 7031
98 Ga0207707_10464839 3300025912 Bacteria 1082
99 Ga0207695_10260153 3300025913 Bacteria 1633
100 Ga0207695_10313126 3300025913 Bacteria 1460
101 Ga0207695_10408117 3300025913 Bacteria 1243
102 Ga0207695_10679137 3300025913 Bacteria 911
103 Ga0207660_10395283 3300025917 Bacteria 1113
104 Ga0207657_10011088 3300025919 Bacteria 8957
105 Ga0207649_10076602 3300025920 Bacteria 2152
106 Ga0207652_10049631 3300025921 Bacteria 3593
107 Ga0207694_10037127 3300025924 Bacteria 3740
108 Ga0207650_10068986 3300025925 Bacteria 2656
109 Ga0207687_10430146 3300025927 Bacteria 1091
110 Ga0207686_10011116 3300025934 Bacteria 4920
111 Ga0207686_10200196 3300025934 Bacteria 1430
112 Ga0207709_10863822 3300025935 Unclassified 733
113 Ga0207669_10592032 3300025937 Bacteria 900
114 Ga0207704_10006263 3300025938 Bacteria 5534
115 Ga0207711_10094711 3300025941 Bacteria 2632
116 Ga0207661_10177920 3300025944 Bacteria 1856
117 Ga0207667_10043252 3300025949 Bacteria 4781
118 Ga0207677_10224646 3300026023 Bacteria 1508
119 Ga0207639_10036660 3300026041 Bacteria 3636
120 Ga0207702_10843341 3300026078 Bacteria 907
121 Ga0207648_10018030 3300026089 Bacteria 6397
122 Ga0207676_10064994 3300026095 Bacteria 2904
123 Ga0207676_10787940 3300026095 Bacteria 927
124 Ga0207674_10126921 3300026116 Bacteria 2517
125 Ga0207674_10377205 3300026116 Bacteria 1371
126 Ga0207683_10011944 3300026121 Bacteria 7413
127 Ga0207683_10129539 3300026121 Bacteria 2269
128 Ga0207683_10213214 3300026121 Bacteria 1758
129 Ga0207698_10563338 3300026142 Bacteria 1119
130 Ga0268266_10000364 3300028379 Bacteria 70331
131 Ga0268266_10315942 3300028379 Bacteria 1461
132 Ga0268266_10704494 3300028379 Bacteria 973
133 Ga0268265_10087109 3300028380 Bacteria 2484
134 Ga0265318_10000458 3300028577 Bacteria 30487
135 Ga0307517_10401088 3300028786 Bacteria 726
136 Ga0265338_10011053 3300028800 Bacteria 10473
137 Ga0265330_10022609 3300031235 Bacteria 2861
138 Ga0265325_10068816 3300031241 Bacteria 1781
139 Ga0265329_10056384 3300031242 Bacteria 1246
140 Ga0265340_10110977 3300031247 Bacteria 1268
141 Ga0265339_10227333 3300031249 Unclassified 910
142 Ga0265331_10058688 3300031250 Bacteria 1821
143 Ga0265331_10083257 3300031250 Bacteria 1483
144 Ga0265313_10000806 3300031595 Bacteria 31638
145 Ga0265313_10016221 3300031595 Bacteria 4292
146 Ga0265313_10087794 3300031595 Bacteria 1401
147 Ga0265314_10015429 3300031711 Bacteria 6063
148 Ga0265314_10016879 3300031711 Bacteria 5751
149 Ga0265314_10027321 3300031711 Bacteria 4274
150 Ga0265314_10159345 3300031711 Bacteria 1375
151 Ga0265342_10029381 3300031712 Bacteria 3413
152 Ga0395901_0088653 3300038443 Bacteria 3236
153 Ga0436365_0544822 3300039437 Bacteria 15659
154 Ga0436363_1611301 3300039450 Unclassified 845
155 Ga0466963_0152628 3300044694 Bacteria 1605
156 Ga0466957_0256723 3300044842 Bacteria 1164
157 Ga0495583_0272113 3300046506 Unclassified 676
158 Ga0495587_0506578 3300046536 Unclassified 667
159 Ga0495673_0176199 3300047469 Unclassified 812
160 Ga0496126_0092149 3300048929 Bacteria 2663
161 Ga0501032_0129582 3300049569 Bacteria 1665
162 Ga0501033_0021388 3300049570 Bacteria 4880
163 Ga0501033_0081999 3300049570 Bacteria 2365
164 Ga0501033_0137092 3300049570 Bacteria 1770
165 Ga0501034_0069184 3300049571 Bacteria 3541
166 Ga0501037_0063449 3300049573 Bacteria 2693
167 Ga0501037_0112491 3300049573 Bacteria 1961
168 Ga0501038_0100534 3300049574 Bacteria 2409
169 Ga0501038_0188564 3300049574 Unclassified 1660
170 Ga0501038_0206561 3300049574 Bacteria 1574
171 Ga0501043_0076579 3300049579 Bacteria 2628
172 Ga0501043_0678278 3300049579 Unclassified 755
173 Ga0501046_0002445 3300049580 Bacteria 17413
174 Ga0501046_0113029 3300049580 Bacteria 2073
175 Ga0501046_0150935 3300049580 Bacteria 1753
176 Ga0501046_0218737 3300049580 Bacteria 1411
177 Ga0501047_0003552 3300049581 Bacteria 14724
178 Ga0501047_0017178 3300049581 Bacteria 6925
179 Ga0501047_0017577 3300049581 Bacteria 6852
180 Ga0501047_0023081 3300049581 Bacteria 5972
181 Ga0501047_0035334 3300049581 Bacteria 4828
182 Ga0501047_0103619 3300049581 Bacteria 2726
183 Ga0501047_0492026 3300049581 Bacteria 1053
184 Ga0501048_0089561 3300049582 Bacteria 2171
185 Ga0501067_0396621 3300049583 Bacteria 769
186 Ga0501073_0287068 3300049589 Bacteria 1135
187 Ga0501074_0645080 3300049590 Unclassified 748
188 Ga0501080_0129013 3300049742 Bacteria 2341
189 Ga0501080_0221622 3300049742 Bacteria 1731
190 Ga0501080_0369363 3300049742 Bacteria 1294
191 Ga0501035_0016834 3300049822 Bacteria 6740
192 Ga0501035_0063511 3300049822 Bacteria 3284
193 Ga0501035_0168114 3300049822 Bacteria 1895
194 Ga0501035_0183090 3300049822 Bacteria 1804
195 Ga0501035_0307008 3300049822 Bacteria 1335
196 Ga0501035_0566027 3300049822 Bacteria 929
197 Ga0501044_0040445 3300049823 Bacteria 4859
198 Ga0501044_0048400 3300049823 Bacteria 4392
199 Ga0501044_0062396 3300049823 Bacteria 3809
200 Ga0501044_0319510 3300049823 Bacteria 1477
201 Ga0501044_0501344 3300049823 Bacteria 1115
202 Ga0500643_000017 3300053087 Bacteria 305781
203 Ga0500594_0004098 3300053118 Bacteria 3210
204 Ga0500595_000697 3300053119 Bacteria 20075
205 Ga0500595_007101 3300053119 Bacteria 4682
206 Ga0500595_035622 3300053119 Bacteria 1637
207 Ga0500642_0040997 3300053130 Bacteria 2000
208 Ga0500559_0071371 3300053136 Bacteria 1564
209 Ga0500568_0016805 3300053139 Bacteria 3242
210 Ga0500568_0089486 3300053139 Bacteria 1162
211 Ga0500639_023769 3300053163 Bacteria 3239
212 Ga0500645_020423 3300053730 Bacteria 2054
213 Ga0501082_0141160 3300060353 Bacteria 2091

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013308 Ga0157375_11182308 Ga0157375_111823082 176
2 3300005458 Ga0070681_10611153 Ga0070681_106111532 181
3 3300009093 Ga0105240_10822056 Ga0105240_108220562 181
4 3300025913 Ga0207695_10679137 Ga0207695_106791372 181
5 3300049571 Ga0501034_0069184 Ga0501034_0069184_118_735 182
6 3300005548 Ga0070665_100717863 Ga0070665_1007178632 183
7 3300028379 Ga0268266_10704494 Ga0268266_107044942 183
8 3300028577 Ga0265318_10000458 Ga0265318_1000045826 183
9 3300031235 Ga0265330_10022609 Ga0265330_100226092 183
10 3300031242 Ga0265329_10056384 Ga0265329_100563842 183
11 3300031250 Ga0265331_10058688 Ga0265331_100586882 183
12 3300031595 Ga0265313_10016221 Ga0265313_100162213 183
13 3300031711 Ga0265314_10015429 Ga0265314_100154291 183
14 3300031712 Ga0265342_10029381 Ga0265342_100293813 183
15 3300046506 Ga0495583_0272113 Ga0495583_0272113_69_626 183
16 3300013104 Ga0157370_10501016 Ga0157370_105010162 185
17 3300049570 Ga0501033_0021388 Ga0501033_0021388_1128_1694 185
18 3300049570 Ga0501033_0081999 Ga0501033_0081999_201_767 185
19 3300049574 Ga0501038_0206561 Ga0501038_0206561_653_1219 185
20 3300049579 Ga0501043_0678278 Ga0501043_0678278_69_635 185
21 3300049581 Ga0501047_0492026 Ga0501047_0492026_185_751 185
22 3300049582 Ga0501048_0089561 Ga0501048_0089561_454_1020 185
23 3300049822 Ga0501035_0307008 Ga0501035_0307008_232_798 185
24 3300049823 Ga0501044_0319510 Ga0501044_0319510_195_761 185
25 3300031711 Ga0265314_10159345 Ga0265314_101593452 186
26 3300014968 Ga0157379_10001857 Ga0157379_100018576 187
27 3300053119 Ga0500595_000697 Ga0500595_000697_7632_8246 188
28 3300006358 Ga0068871_100041456 Ga0068871_1000414563 189
29 3300009148 Ga0105243_11356504 Ga0105243_113565041 189
30 3300025935 Ga0207709_10863822 Ga0207709_108638222 189
31 3300046536 Ga0495587_0506578 Ga0495587_0506578_35_616 189
32 3300053119 Ga0500595_007101 Ga0500595_007101_3947_4528 189
33 3300049569 Ga0501032_0129582 Ga0501032_0129582_854_1486 190
34 3300005563 Ga0068855_100776986 Ga0068855_1007769862 191
35 3300005577 Ga0068857_100304428 Ga0068857_1003044281 191
36 3300009093 Ga0105240_10806916 Ga0105240_108069162 191
37 3300009553 Ga0105249_10887059 Ga0105249_108870592 191
38 3300013307 Ga0157372_10336719 Ga0157372_103367192 191
39 3300026041 Ga0207639_10036660 Ga0207639_100366603 191
40 3300026116 Ga0207674_10126921 Ga0207674_101269211 191
41 3300026142 Ga0207698_10563338 Ga0207698_105633382 191
42 3300060353 Ga0501082_0141160 Ga0501082_0141160_935_1543 192
43 3300005842 Ga0068858_100163874 Ga0068858_1001638742 194
44 3300013297 Ga0157378_10290670 Ga0157378_102906702 195
45 3300025261 Ga0209233_1001071 Ga0209233_100107114 195
46 3300028786 Ga0307517_10401088 Ga0307517_104010881 195
47 3300053130 Ga0500642_0040997 Ga0500642_0040997_1086_1697 195
48 3300005331 Ga0070670_100680391 Ga0070670_1006803912 196
49 3300005335 Ga0070666_10369594 Ga0070666_103695942 196
50 3300005338 Ga0068868_101005757 Ga0068868_1010057571 196
51 3300005355 Ga0070671_100358924 Ga0070671_1003589242 196
52 3300005356 Ga0070674_100730645 Ga0070674_1007306451 196
53 3300005456 Ga0070678_100008608 Ga0070678_1000086083 196
54 3300005459 Ga0068867_100025863 Ga0068867_1000258633 196
55 3300005618 Ga0068864_100106888 Ga0068864_1001068883 196
56 3300005840 Ga0068870_10041837 Ga0068870_100418372 196
57 3300005843 Ga0068860_100055155 Ga0068860_1000551553 196
58 3300006237 Ga0097621_100419030 Ga0097621_1004190302 196
59 3300006358 Ga0068871_100008068 Ga0068871_1000080685 196
60 3300006358 Ga0068871_100307224 Ga0068871_1003072242 196
61 3300006881 Ga0068865_100009233 Ga0068865_1000092333 196
62 3300009176 Ga0105242_10009472 Ga0105242_100094727 196
63 3300009551 Ga0105238_10040277 Ga0105238_100402772 196
64 3300011119 Ga0105246_10035427 Ga0105246_100354272 196
65 3300013296 Ga0157374_10028075 Ga0157374_100280754 196
66 3300013297 Ga0157378_10341366 Ga0157378_103413663 196
67 3300013306 Ga0163162_10045535 Ga0163162_100455354 196
68 3300013308 Ga0157375_10015905 Ga0157375_100159055 196
69 3300014325 Ga0163163_10110194 Ga0163163_101101943 196
70 3300014969 Ga0157376_10026400 Ga0157376_100264004 196
71 3300017792 Ga0163161_10134550 Ga0163161_101345502 196
72 3300025899 Ga0207642_10040043 Ga0207642_100400433 196
73 3300025903 Ga0207680_10426962 Ga0207680_104269622 196
74 3300025908 Ga0207643_10018576 Ga0207643_100185762 196
75 3300025925 Ga0207650_10068986 Ga0207650_100689861 196
76 3300025934 Ga0207686_10011116 Ga0207686_100111166 196
77 3300025937 Ga0207669_10592032 Ga0207669_105920322 196
78 3300025938 Ga0207704_10006263 Ga0207704_100062636 196
79 3300026089 Ga0207648_10018030 Ga0207648_100180303 196
80 3300026095 Ga0207676_10064994 Ga0207676_100649941 196
81 3300026121 Ga0207683_10011944 Ga0207683_100119447 196
82 3300026121 Ga0207683_10213214 Ga0207683_102132141 196
83 3300047469 Ga0495673_0176199 Ga0495673_0176199_47_649 196
84 3300005563 Ga0068855_100085312 Ga0068855_1000853122 197
85 3300010375 Ga0105239_10684587 Ga0105239_106845872 197
86 3300013104 Ga0157370_10149873 Ga0157370_101498732 197
87 3300014969 Ga0157376_10375773 Ga0157376_103757732 197
88 3300049581 Ga0501047_0003552 Ga0501047_0003552_3684_4292 197
89 3300049581 Ga0501047_0035334 Ga0501047_0035334_1923_2534 197
90 3300049590 Ga0501074_0645080 Ga0501074_0645080_134_736 197
91 3300049742 Ga0501080_0129013 Ga0501080_0129013_207_818 197
92 3300049822 Ga0501035_0016834 Ga0501035_0016834_4373_4981 197
93 3300049823 Ga0501044_0040445 Ga0501044_0040445_308_919 197
94 3300005327 Ga0070658_10006162 Ga0070658_1000616212 198
95 3300005329 Ga0070683_100038521 Ga0070683_1000385213 198
96 3300005335 Ga0070666_10069143 Ga0070666_100691433 198
97 3300005336 Ga0070680_100570314 Ga0070680_1005703142 198
98 3300005338 Ga0068868_100038243 Ga0068868_1000382434 198
99 3300005339 Ga0070660_100006445 Ga0070660_1000064457 198
100 3300005344 Ga0070661_100199381 Ga0070661_1001993812 198
101 3300005365 Ga0070688_100026494 Ga0070688_1000264943 198
102 3300005366 Ga0070659_100392760 Ga0070659_1003927602 198
103 3300005367 Ga0070667_100034132 Ga0070667_1000341323 198
104 3300005455 Ga0070663_100451984 Ga0070663_1004519841 198
105 3300005458 Ga0070681_10545315 Ga0070681_105453152 198
106 3300005458 Ga0070681_10820099 Ga0070681_108200991 198
107 3300005530 Ga0070679_100004953 Ga0070679_1000049539 198
108 3300005535 Ga0070684_100993346 Ga0070684_1009933462 198
109 3300005539 Ga0068853_100631370 Ga0068853_1006313701 198
110 3300005548 Ga0070665_100000322 Ga0070665_1000003227 198
111 3300005842 Ga0068858_100098545 Ga0068858_1000985452 198
112 3300005843 Ga0068860_100065788 Ga0068860_1000657882 198
113 3300005844 Ga0068862_100120335 Ga0068862_1001203352 198
114 3300009093 Ga0105240_10283930 Ga0105240_102839302 198
115 3300009093 Ga0105240_10403988 Ga0105240_104039882 198
116 3300009545 Ga0105237_10131199 Ga0105237_101311993 198
117 3300009551 Ga0105238_10076893 Ga0105238_100768934 198
118 3300009551 Ga0105238_10463247 Ga0105238_104632472 198
119 3300010375 Ga0105239_10111321 Ga0105239_101113213 198
120 3300014325 Ga0163163_10713380 Ga0163163_107133802 198
121 3300014968 Ga0157379_10106295 Ga0157379_101062953 198
122 3300014969 Ga0157376_10928907 Ga0157376_109289072 198
123 3300021384 Ga0213876_10012219 Ga0213876_100122193 198
124 3300025903 Ga0207680_10194827 Ga0207680_101948272 198
125 3300025909 Ga0207705_10009613 Ga0207705_100096135 198
126 3300025912 Ga0207707_10464839 Ga0207707_104648392 198
127 3300025913 Ga0207695_10260153 Ga0207695_102601532 198
128 3300025913 Ga0207695_10313126 Ga0207695_103131262 198
129 3300025913 Ga0207695_10408117 Ga0207695_104081172 198
130 3300025917 Ga0207660_10395283 Ga0207660_103952832 198
131 3300025919 Ga0207657_10011088 Ga0207657_100110887 198
132 3300025920 Ga0207649_10076602 Ga0207649_100766022 198
133 3300025921 Ga0207652_10049631 Ga0207652_100496313 198
134 3300025924 Ga0207694_10037127 Ga0207694_100371275 198
135 3300025927 Ga0207687_10430146 Ga0207687_104301462 198
136 3300025941 Ga0207711_10094711 Ga0207711_100947112 198
137 3300025944 Ga0207661_10177920 Ga0207661_101779203 198
138 3300025949 Ga0207667_10043252 Ga0207667_100432522 198
139 3300026023 Ga0207677_10224646 Ga0207677_102246461 198
140 3300026078 Ga0207702_10843341 Ga0207702_108433411 198
141 3300026095 Ga0207676_10787940 Ga0207676_107879402 198
142 3300026121 Ga0207683_10129539 Ga0207683_101295391 198
143 3300028379 Ga0268266_10000364 Ga0268266_1000036443 198
144 3300028380 Ga0268265_10087109 Ga0268265_100871092 198
145 3300028800 Ga0265338_10011053 Ga0265338_100110537 198
146 3300031247 Ga0265340_10110977 Ga0265340_101109772 198
147 3300031250 Ga0265331_10083257 Ga0265331_100832572 198
148 3300031595 Ga0265313_10087794 Ga0265313_100877942 198
149 3300031711 Ga0265314_10027321 Ga0265314_100273213 198
150 3300038443 Ga0395901_0088653 Ga0395901_0088653_2497_3168 198
151 3300039437 Ga0436365_0544822 Ga0436365_0544822_13366_13980 198
152 3300044694 Ga0466963_0152628 Ga0466963_0152628_869_1504 198
153 3300044842 Ga0466957_0256723 Ga0466957_0256723_353_1000 198
154 3300049573 Ga0501037_0063449 Ga0501037_0063449_756_1367 198
155 3300049574 Ga0501038_0188564 Ga0501038_0188564_760_1377 198
156 3300049580 Ga0501046_0002445 Ga0501046_0002445_3701_4318 198
157 3300049580 Ga0501046_0218737 Ga0501046_0218737_10_621 198
158 3300049581 Ga0501047_0017178 Ga0501047_0017178_5607_6224 198
159 3300049581 Ga0501047_0017577 Ga0501047_0017577_318_929 198
160 3300049583 Ga0501067_0396621 Ga0501067_0396621_64_675 198
161 3300049589 Ga0501073_0287068 Ga0501073_0287068_451_1122 198
162 3300049742 Ga0501080_0221622 Ga0501080_0221622_533_1150 198
163 3300049822 Ga0501035_0063511 Ga0501035_0063511_574_1191 198
164 3300049822 Ga0501035_0566027 Ga0501035_0566027_270_881 198
165 3300049823 Ga0501044_0048400 Ga0501044_0048400_2849_3466 198
166 3300049823 Ga0501044_0501344 Ga0501044_0501344_273_890 198
167 3300053087 Ga0500643_000017 Ga0500643_000017_106251_106850 198
168 3300053139 Ga0500568_0016805 Ga0500568_0016805_2355_2954 198
169 3300053730 Ga0500645_020423 Ga0500645_020423_97_696 198
170 3300003215 JGI25153J46596_10000362 JGI25153J46596_1000036214 199
171 3300005456 Ga0070678_100759735 Ga0070678_1007597352 199
172 3300005842 Ga0068858_101063030 Ga0068858_1010630302 199
173 3300006237 Ga0097621_100000270 Ga0097621_10000027029 199
174 3300006358 Ga0068871_100004963 Ga0068871_1000049635 199
175 3300006358 Ga0068871_100570449 Ga0068871_1005704492 199
176 3300009174 Ga0105241_11204561 Ga0105241_112045611 199
177 3300009176 Ga0105242_10280133 Ga0105242_102801332 199
178 3300009176 Ga0105242_11796736 Ga0105242_117967361 199
179 3300009551 Ga0105238_10659085 Ga0105238_106590852 199
180 3300013306 Ga0163162_10048644 Ga0163162_100486443 199
181 3300014325 Ga0163163_10000004 Ga0163163_1000000416 199
182 3300014968 Ga0157379_10586751 Ga0157379_105867512 199
183 3300014969 Ga0157376_10328853 Ga0157376_103288532 199
184 3300014969 Ga0157376_10523329 Ga0157376_105233292 199
185 3300025297 Ga0209758_1000008 Ga0209758_1000008458 199
186 3300025934 Ga0207686_10200196 Ga0207686_102001962 199
187 3300026116 Ga0207674_10377205 Ga0207674_103772051 199
188 3300028379 Ga0268266_10315942 Ga0268266_103159422 199
189 3300031241 Ga0265325_10068816 Ga0265325_100688162 199
190 3300031249 Ga0265339_10227333 Ga0265339_102273331 199
191 3300031595 Ga0265313_10000806 Ga0265313_1000080610 199
192 3300031711 Ga0265314_10016879 Ga0265314_100168796 199
193 3300039450 Ga0436363_1611301 Ga0436363_1611301_67_669 199
194 3300048929 Ga0496126_0092149 Ga0496126_0092149_1318_1932 199
195 3300049580 Ga0501046_0113029 Ga0501046_0113029_121_735 199
196 3300049581 Ga0501047_0023081 Ga0501047_0023081_1784_2398 199
197 3300049822 Ga0501035_0183090 Ga0501035_0183090_799_1413 199
198 3300053118 Ga0500594_0004098 Ga0500594_0004098_19_633 199
199 3300053119 Ga0500595_035622 Ga0500595_035622_990_1592 199
200 3300053136 Ga0500559_0071371 Ga0500559_0071371_360_962 199
201 3300053139 Ga0500568_0089486 Ga0500568_0089486_276_890 199
202 3300053163 Ga0500639_023769 Ga0500639_023769_296_898 199
203 3300049570 Ga0501033_0137092 Ga0501033_0137092_1066_1704 205
204 3300049573 Ga0501037_0112491 Ga0501037_0112491_1026_1664 205
205 3300049574 Ga0501038_0100534 Ga0501038_0100534_520_1158 205
206 3300049579 Ga0501043_0076579 Ga0501043_0076579_1262_1900 205
207 3300049580 Ga0501046_0150935 Ga0501046_0150935_1026_1664 205
208 3300049581 Ga0501047_0103619 Ga0501047_0103619_1983_2621 205
209 3300049742 Ga0501080_0369363 Ga0501080_0369363_111_749 205
210 3300049822 Ga0501035_0168114 Ga0501035_0168114_441_1079 205
211 3300049823 Ga0501044_0062396 Ga0501044_0062396_1794_2432 205
212 3300003214 JGI25165J46597_1000035 JGI25165J46597_10000357 214
213 3300025261 Ga0209233_1000006 Ga0209233_1000006502 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16233

DUF4893

Domain of unknown function (DUF4893)

28

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n34-assembly1.cif.gz_A structure of yersinia aleksiciae cap15 cyclic dinucleotide receptor, crystal form 1 0.7046 88 214
7n35-assembly2.cif.gz_A structure of yersinia aleksiciae cap15 cyclic dinucleotide receptor, crystal form 2 0.6773 88 214
7n34-assembly1.cif.gz_A structure of yersinia aleksiciae cap15 cyclic dinucleotide receptor, crystal form 1 0.6708 88 214
7n35-assembly2.cif.gz_B structure of yersinia aleksiciae cap15 cyclic dinucleotide receptor, crystal form 2 0.658 88 214
7n35-assembly2.cif.gz_A structure of yersinia aleksiciae cap15 cyclic dinucleotide receptor, crystal form 2 0.6549 88 214
ID Description Score Start End Superfamily
af_P40157_234_334_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6229 96 154 1.20.140.150
af_Q54BB2_1_127_2.40.128.30 Mainly Beta;Beta Barrel;Lipocalin;Avidin-like 0.6179 85 213 2.40.128.30
af_P9WJA5_1_125_3.30.2310.20 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.6121 122 163 3.30.2310.20
1jmzA02 Mainly Beta;Beta Barrel;Lipocalin;Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 0.5971 89 214 2.40.128.120
af_P77154_664_736_2.60.420.10 Mainly Beta;Sandwich;Maltose phosphorylase, domain 3;Maltose phosphorylase, domain 3 0.5963 120 159 2.60.420.10
ID Description Score Start End GO Terms
AF-A0A7V9MWS6-F1-model_v4 DUF4893 domain-containing protein 0.9672 34 214
AF-A0A2A4S4D3-F1-model_v4 deleted 0.923 40 214
AF-A0A327JG29-F1-model_v4 DUF4893 domain-containing protein 0.9192 40 214
AF-A0A3B0USD6-F1-model_v4 DUF4893 domain-containing protein 0.915 46 214
AF-A0A7V9MWS6-F1-model_v4 DUF4893 domain-containing protein 0.9127 34 214

Feature Viewer

pLDDT pTM Quality
82.63 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map