F324177

General Info

Members Datasets Scaffolds Average Seq Length
213 157 426 417

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10139858|Ga0268266_101398582
Length 440
Sequence VNRRNFIGAAALGAGAMALPHELGATGPEDGRARPDGPAYEYQRGGGNLPAAIQALQPMTAGIVPITDDERKARIAKAQRLMAEQRIDAIFMEGGTSSFYFVGMRWGQSERTFGVVIPAKGAIAYVCPGFEEDRARELIKPAFGDEVRTWQEDESPFQVIGNIVKDRGINFRKIGIEERVRFFVADGIRRDTGLEVVDATPITAGCRMIKTRAEIALMQRANDVTLAAYKAALATMREGMTQDELEGNITAAFARLGFRGAISAQFGKWTALPHGSATPQKLREGDVVMIDDGVTCEGYQSDITRTVVFGKPTPRQIQVWEIEKKAQAAAFAAIKIGVPCEAVDAAARKVIVDAGFGPGYKVPGLPHRTGHGMGLDGHEWTNFVKGNKTPIAVGMCFSDEPMIAIPGEFGIRLEDDVYIGEDGPHWFTKPSVAIDKPFAD

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
91 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
101 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
102 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
119 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
125 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
129 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
130 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
154 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 1.88
Rhizosphere 92.96
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_10139858 3300028379 Bacteria 2172
2 Ga0070683_100059065 3300005329 Bacteria 3563
3 Ga0070690_100017149 3300005330 Bacteria 4350
4 Ga0068869_100214443 3300005334 Bacteria 1523
5 Ga0070660_100005935 3300005339 Bacteria 8445
6 Ga0070691_10010266 3300005341 Bacteria 4273
7 Ga0070691_10016465 3300005341 Bacteria 3395
8 Ga0070661_100131505 3300005344 Bacteria 1880
9 Ga0070668_100185190 3300005347 Bacteria 1703
10 Ga0070669_100013353 3300005353 Bacteria 5837
11 Ga0070669_100112219 3300005353 Bacteria 2070
12 Ga0070675_100011105 3300005354 Bacteria 7050
13 Ga0070674_100014243 3300005356 Bacteria 4940
14 Ga0070659_100259075 3300005366 Bacteria 1443
15 Ga0070714_100089963 3300005435 Bacteria 2688
16 Ga0070705_100002652 3300005440 Bacteria 8952
17 Ga0070700_100163762 3300005441 Bacteria 1533
18 Ga0070662_100175765 3300005457 Bacteria 1685
19 Ga0070681_10018561 3300005458 Bacteria 6953
20 Ga0070706_100251268 3300005467 Unclassified 1651
21 Ga0070698_100101646 3300005471 Bacteria 2846
22 Ga0070698_100285744 3300005471 Bacteria 1581
23 Ga0070679_100137140 3300005530 Bacteria 2428
24 Ga0070679_100177537 3300005530 Bacteria 2102
25 Ga0070686_100007325 3300005544 Bacteria 6151
26 Ga0070704_100010682 3300005549 Bacteria 5592
27 Ga0068855_100022635 3300005563 Bacteria 7530
28 Ga0068855_100114742 3300005563 Bacteria 3088
29 Ga0070664_100020105 3300005564 Bacteria 5497
30 Ga0070664_100160211 3300005564 Bacteria 1991
31 Ga0068854_100149607 3300005578 Bacteria 1799
32 Ga0070702_100013756 3300005615 Bacteria 4093
33 Ga0068864_100195427 3300005618 Bacteria 1856
34 Ga0068861_100012123 3300005719 Bacteria 6007
35 Ga0068861_100179000 3300005719 Bacteria 1763
36 Ga0068863_100008647 3300005841 Bacteria 9948
37 Ga0068858_100043149 3300005842 Bacteria 4182
38 Ga0068860_100070711 3300005843 Bacteria 3317
39 Ga0068862_100027787 3300005844 Bacteria 4764
40 Ga0068862_100054513 3300005844 Bacteria 3423
41 Ga0068862_100057532 3300005844 Bacteria 3334
42 Ga0081539_10000375 3300005985 Bacteria 97516
43 Ga0075368_10014413 3300006042 Bacteria 2919
44 Ga0075367_10002346 3300006178 Bacteria 8615
45 Ga0075366_10020111 3300006195 Bacteria 3869
46 Ga0068871_100225301 3300006358 Bacteria 1626
47 Ga0075428_100008810 3300006844 Bacteria 11196
48 Ga0075428_100324750 3300006844 Bacteria 1653
49 Ga0075430_100028567 3300006846 Bacteria 4737
50 Ga0075430_100141573 3300006846 Bacteria 2003
51 Ga0075431_100006097 3300006847 Bacteria 11954
52 Ga0075431_100082131 3300006847 Bacteria 3327
53 Ga0075431_100123005 3300006847 Bacteria 2677
54 Ga0075434_100010859 3300006871 Bacteria 8559
55 Ga0068865_100083340 3300006881 Bacteria 2301
56 Ga0075436_100064687 3300006914 Bacteria 2528
57 Ga0105240_10011250 3300009093 Bacteria 12478
58 Ga0105240_10186889 3300009093 Bacteria 2439
59 Ga0111539_10004903 3300009094 Bacteria 17422
60 Ga0111539_10008943 3300009094 Bacteria 12680
61 Ga0111539_10037608 3300009094 Bacteria 5843
62 Ga0111539_10053601 3300009094 Bacteria 4801
63 Ga0111539_10113938 3300009094 Bacteria 3171
64 Ga0111539_10144992 3300009094 Bacteria 2780
65 Ga0111539_10181046 3300009094 Bacteria 2461
66 Ga0105247_10016027 3300009101 Bacteria 4490
67 Ga0114129_10000225 3300009147 Bacteria 62980
68 Ga0114129_10003488 3300009147 Bacteria 22115
69 Ga0114129_10005533 3300009147 Bacteria 17870
70 Ga0114129_10031038 3300009147 Bacteria 7558
71 Ga0114129_10065664 3300009147 Bacteria 5064
72 Ga0114129_10090239 3300009147 Bacteria 4248
73 Ga0105243_10002866 3300009148 Bacteria 14300
74 Ga0105243_10046620 3300009148 Bacteria 3410
75 Ga0105241_10094839 3300009174 Bacteria 2361
76 Ga0105242_10027805 3300009176 Bacteria 4496
77 Ga0105248_10013758 3300009177 Bacteria 8907
78 Ga0105248_10131424 3300009177 Bacteria 2824
79 Ga0105248_10221673 3300009177 Bacteria 2129
80 Ga0105237_10084895 3300009545 Bacteria 3156
81 Ga0105249_10255159 3300009553 Bacteria 1740
82 Ga0157369_10055717 3300013105 Bacteria 4267
83 Ga0157374_10145177 3300013296 Bacteria 2305
84 Ga0163162_10024082 3300013306 Bacteria 6008
85 Ga0163162_10154125 3300013306 Bacteria 2417
86 Ga0157372_10005471 3300013307 Bacteria 13496
87 Ga0163163_10000054 3300014325 Bacteria 126041
88 Ga0163163_10010943 3300014325 Bacteria 8197
89 Ga0157380_10007687 3300014326 Bacteria 7671
90 Ga0157380_10060244 3300014326 Bacteria 3032
91 Ga0157380_10125909 3300014326 Bacteria 2178
92 Ga0157380_10280387 3300014326 Bacteria 1524
93 Ga0207642_10044729 3300025899 Bacteria 1961
94 Ga0207699_10110753 3300025906 Bacteria 1759
95 Ga0207645_10019393 3300025907 Bacteria 4459
96 Ga0207707_10019829 3300025912 Bacteria 5870
97 Ga0207707_10041260 3300025912 Bacteria 4030
98 Ga0207695_10006196 3300025913 Bacteria 15589
99 Ga0207695_10047569 3300025913 Bacteria 4537
100 Ga0207657_10009827 3300025919 Bacteria 9584
101 Ga0207657_10203089 3300025919 Bacteria 1593
102 Ga0207652_10079673 3300025921 Bacteria 2862
103 Ga0207652_10116668 3300025921 Bacteria 2372
104 Ga0207681_10004539 3300025923 Bacteria 8548
105 Ga0207694_10058659 3300025924 Bacteria 2994
106 Ga0207650_10175833 3300025925 Bacteria 1704
107 Ga0207659_10005643 3300025926 Bacteria 7611
108 Ga0207687_10084215 3300025927 Bacteria 2304
109 Ga0207664_10146535 3300025929 Bacteria 2002
110 Ga0207690_10223167 3300025932 Bacteria 1443
111 Ga0207704_10116621 3300025938 Bacteria 1817
112 Ga0207711_10116740 3300025941 Bacteria 2380
113 Ga0207679_10011217 3300025945 Bacteria 5792
114 Ga0207679_10193834 3300025945 Bacteria 1692
115 Ga0207668_10202494 3300025972 Bacteria 1582
116 Ga0207640_10063912 3300025981 Bacteria 2448
117 Ga0207703_10020929 3300026035 Bacteria 5117
118 Ga0207708_10006627 3300026075 Bacteria 8572
119 Ga0207708_10039120 3300026075 Bacteria 3613
120 Ga0207641_10001739 3300026088 Bacteria 21027
121 Ga0207641_10147038 3300026088 Bacteria 2132
122 Ga0207676_10005316 3300026095 Bacteria 9122
123 Ga0207674_10066977 3300026116 Bacteria 3616
124 Ga0207675_100002169 3300026118 Bacteria 19503
125 Ga0207675_100003682 3300026118 Bacteria 14937
126 Ga0207675_100081612 3300026118 Bacteria 3032
127 Ga0207698_10097446 3300026142 Bacteria 2427
128 Ga0207428_10091683 3300027907 Bacteria 2359
129 Ga0268265_10024383 3300028380 Bacteria 4278
130 Ga0268265_10038994 3300028380 Bacteria 3498
131 Ga0268265_10072001 3300028380 Bacteria 2695
132 Ga0307405_10080418 3300031731 Bacteria 2128
133 Ga0307416_100139588 3300032002 Bacteria 2200
134 Ga0373948_0000728 3300034817 Bacteria 4289
135 Ga0373959_0002483 3300034820 Bacteria 2928
136 Ga0373934_0012662 3300035086 Bacteria 3183
137 Ga0373940_0033461 3300035088 Bacteria 1382
138 Ga0373951_0009352 3300035091 Bacteria 2208
139 Ga0373932_0000375 3300035112 Bacteria 13715
140 Ga0373939_0001184 3300035114 Bacteria 6375
141 Ga0373941_0006754 3300035115 Bacteria 2777
142 Ga0373956_0008522 3300035119 Bacteria 4150
143 Ga0373960_0000164 3300035121 Bacteria 11612
144 Ga0373955_0001492 3300035172 Bacteria 9959
145 Ga0373961_0002800 3300035241 Bacteria 4449
146 Ga0373962_0009187 3300035242 Unclassified 2444
147 Ga0373931_0002055 3300035691 Bacteria 8846
148 Ga0373933_0004978 3300035724 Bacteria 7245
149 Ga0373937_0000176 3300036401 Bacteria 62904
150 Ga0395899_0071997 3300037312 Bacteria 2529
151 Ga0395900_0021059 3300037418 Bacteria 6663
152 Ga0395905_0020082 3300037471 Bacteria 6330
153 Ga0395905_0147545 3300037471 Bacteria 2213
154 Ga0395901_0002308 3300038443 Bacteria 19440
155 Ga0451853_0930533 3300041512 Unclassified 1618
156 Ga0466963_0046566 3300044694 Bacteria 2860
157 Ga0451576_0001924 3300045051 Bacteria 33275
158 Ga0451576_0007621 3300045051 Bacteria 12883
159 Ga0495653_0000861 3300046463 Bacteria 23407
160 Ga0495580_0074784 3300046472 Bacteria 2364
161 Ga0495639_0037351 3300046475 Bacteria 2177
162 Ga0495594_0005936 3300046499 Bacteria 6278
163 Ga0495594_0092188 3300046499 Bacteria 1698
164 Ga0495618_0024035 3300046514 Bacteria 3773
165 Ga0495666_0002269 3300046526 Bacteria 9565
166 Ga0495640_0012700 3300046533 Bacteria 6430
167 Ga0495586_0021297 3300046535 Bacteria 3454
168 Ga0495634_0006190 3300046642 Bacteria 9116
169 Ga0495659_0047477 3300046664 Bacteria 1553
170 Ga0495588_0066769 3300046674 Bacteria 1867
171 Ga0495599_0055010 3300046678 Bacteria 2493
172 Ga0495647_0006715 3300046681 Bacteria 3828
173 Ga0495658_0020531 3300046683 Bacteria 3467
174 Ga0495680_0297970 3300047322 Bacteria 1133
175 Ga0495684_0014019 3300047471 Bacteria 6166
176 Ga0495615_0016656 3300048090 Bacteria 1589
177 Ga0496104_0044943 3300048907 Bacteria 4152
178 Ga0496104_0175526 3300048907 Bacteria 2053
179 Ga0496106_0272186 3300048909 Bacteria 1356
180 Ga0496107_0252285 3300048910 Bacteria 1313
181 Ga0501031_0048489 3300049568 Bacteria 2768
182 Ga0501038_0043485 3300049574 Bacteria 3906
183 Ga0501039_0185672 3300049575 Unclassified 1635
184 Ga0501041_0026528 3300049577 Bacteria 3486
185 Ga0501046_0009428 3300049580 Bacteria 8437
186 Ga0501073_0000596 3300049589 Bacteria 25474
187 Ga0501076_0043716 3300049592 Bacteria 3531
188 Ga0501077_0031904 3300049593 Bacteria 3352
189 Ga0501079_0041965 3300049741 Bacteria 3533
190 nmdc:mga00v17_164358_c1 3300050491 Bacteria 1430
191 nmdc:mga0k408_61613_c1 3300050493 Bacteria 2181
192 nmdc:mga06z11_43379_c1 3300050494 Bacteria 2262
193 nmdc:mga04h51_6587_c1 3300050495 Bacteria 3019
194 nmdc:mga05p37_123_c1 3300050507 Bacteria 69992
195 nmdc:mga05p37_1280_c1 3300050507 Bacteria 29233
196 nmdc:mga05p37_20989_c1 3300050507 Bacteria 7906
197 nmdc:mga05p37_81726_c1 3300050507 Bacteria 3980
198 nmdc:mga05p37_94576_c1 3300050507 Bacteria 3682
199 nmdc:mga09592_165349_c1 3300050508 Bacteria 1912
200 nmdc:mga0qj67_24240_c1 3300050509 Bacteria 4676
201 nmdc:mga06r32_66987_c1 3300050510 Bacteria 3466
202 nmdc:mga06r32_75539_c1 3300050510 Bacteria 3270
203 nmdc:mga08y16_101492_c1 3300050511 Bacteria 2995
204 nmdc:mga08y16_26232_c1 3300050511 Bacteria 6144
205 nmdc:mga08y16_8985_c1 3300050511 Bacteria 10496
206 nmdc:mga0n895_50507_c1 3300050512 Bacteria 4077
207 Ga0495619_0041237 3300053085 Unclassified 3019
208 Ga0500641_0003239 3300053096 Bacteria 5754
209 Ga0500556_0003481 3300053104 Bacteria 4623
210 Ga0501084_0023644 3300054114 Bacteria 5125
211 Ga0501082_0083260 3300060353 Bacteria 2760
212 Ga0501082_0432965 3300060353 Bacteria 1149
213 2882458378 2882456835 Bacteria 6863978
214 Ga0268266_10139858
215 Ga0070683_100059065
216 Ga0070690_100017149
217 Ga0068869_100214443
218 Ga0070660_100005935
219 Ga0070691_10010266
220 Ga0070691_10016465
221 Ga0070661_100131505
222 Ga0070668_100185190
223 Ga0070669_100013353
224 Ga0070669_100112219
225 Ga0070675_100011105
226 Ga0070674_100014243
227 Ga0070659_100259075
228 Ga0070714_100089963
229 Ga0070705_100002652
230 Ga0070700_100163762
231 Ga0070662_100175765
232 Ga0070681_10018561
233 Ga0070706_100251268
234 Ga0070698_100101646
235 Ga0070698_100285744
236 Ga0070679_100137140
237 Ga0070679_100177537
238 Ga0070686_100007325
239 Ga0070704_100010682
240 Ga0068855_100022635
241 Ga0068855_100114742
242 Ga0070664_100020105
243 Ga0070664_100160211
244 Ga0068854_100149607
245 Ga0070702_100013756
246 Ga0068864_100195427
247 Ga0068861_100012123
248 Ga0068861_100179000
249 Ga0068863_100008647
250 Ga0068858_100043149
251 Ga0068860_100070711
252 Ga0068862_100027787
253 Ga0068862_100054513
254 Ga0068862_100057532
255 Ga0081539_10000375
256 Ga0075368_10014413
257 Ga0075367_10002346
258 Ga0075366_10020111
259 Ga0068871_100225301
260 Ga0075428_100008810
261 Ga0075428_100324750
262 Ga0075430_100028567
263 Ga0075430_100141573
264 Ga0075431_100006097
265 Ga0075431_100082131
266 Ga0075431_100123005
267 Ga0075434_100010859
268 Ga0068865_100083340
269 Ga0075436_100064687
270 Ga0105240_10011250
271 Ga0105240_10186889
272 Ga0111539_10004903
273 Ga0111539_10008943
274 Ga0111539_10037608
275 Ga0111539_10053601
276 Ga0111539_10113938
277 Ga0111539_10144992
278 Ga0111539_10181046
279 Ga0105247_10016027
280 Ga0114129_10000225
281 Ga0114129_10003488
282 Ga0114129_10005533
283 Ga0114129_10031038
284 Ga0114129_10065664
285 Ga0114129_10090239
286 Ga0105243_10002866
287 Ga0105243_10046620
288 Ga0105241_10094839
289 Ga0105242_10027805
290 Ga0105248_10013758
291 Ga0105248_10131424
292 Ga0105248_10221673
293 Ga0105237_10084895
294 Ga0105249_10255159
295 Ga0157369_10055717
296 Ga0157374_10145177
297 Ga0163162_10024082
298 Ga0163162_10154125
299 Ga0157372_10005471
300 Ga0163163_10000054
301 Ga0163163_10010943
302 Ga0157380_10007687
303 Ga0157380_10060244
304 Ga0157380_10125909
305 Ga0157380_10280387
306 Ga0207642_10044729
307 Ga0207699_10110753
308 Ga0207645_10019393
309 Ga0207707_10019829
310 Ga0207707_10041260
311 Ga0207695_10006196
312 Ga0207695_10047569
313 Ga0207657_10009827
314 Ga0207657_10203089
315 Ga0207652_10079673
316 Ga0207652_10116668
317 Ga0207681_10004539
318 Ga0207694_10058659
319 Ga0207650_10175833
320 Ga0207659_10005643
321 Ga0207687_10084215
322 Ga0207664_10146535
323 Ga0207690_10223167
324 Ga0207704_10116621
325 Ga0207711_10116740
326 Ga0207679_10011217
327 Ga0207679_10193834
328 Ga0207668_10202494
329 Ga0207640_10063912
330 Ga0207703_10020929
331 Ga0207708_10006627
332 Ga0207708_10039120
333 Ga0207641_10001739
334 Ga0207641_10147038
335 Ga0207676_10005316
336 Ga0207674_10066977
337 Ga0207675_100002169
338 Ga0207675_100003682
339 Ga0207675_100081612
340 Ga0207698_10097446
341 Ga0207428_10091683
342 Ga0268265_10024383
343 Ga0268265_10038994
344 Ga0268265_10072001
345 Ga0307405_10080418
346 Ga0307416_100139588
347 Ga0373948_0000728
348 Ga0373959_0002483
349 Ga0373934_0012662
350 Ga0373940_0033461
351 Ga0373951_0009352
352 Ga0373932_0000375
353 Ga0373939_0001184
354 Ga0373941_0006754
355 Ga0373956_0008522
356 Ga0373960_0000164
357 Ga0373955_0001492
358 Ga0373961_0002800
359 Ga0373962_0009187
360 Ga0373931_0002055
361 Ga0373933_0004978
362 Ga0373937_0000176
363 Ga0395899_0071997
364 Ga0395900_0021059
365 Ga0395905_0020082
366 Ga0395905_0147545
367 Ga0395901_0002308
368 Ga0451853_0930533
369 Ga0466963_0046566
370 Ga0451576_0001924
371 Ga0451576_0007621
372 Ga0495653_0000861
373 Ga0495580_0074784
374 Ga0495639_0037351
375 Ga0495594_0005936
376 Ga0495594_0092188
377 Ga0495618_0024035
378 Ga0495666_0002269
379 Ga0495640_0012700
380 Ga0495586_0021297
381 Ga0495634_0006190
382 Ga0495659_0047477
383 Ga0495588_0066769
384 Ga0495599_0055010
385 Ga0495647_0006715
386 Ga0495658_0020531
387 Ga0495680_0297970
388 Ga0495684_0014019
389 Ga0495615_0016656
390 Ga0496104_0044943
391 Ga0496104_0175526
392 Ga0496106_0272186
393 Ga0496107_0252285
394 Ga0501031_0048489
395 Ga0501038_0043485
396 Ga0501039_0185672
397 Ga0501041_0026528
398 Ga0501046_0009428
399 Ga0501073_0000596
400 Ga0501076_0043716
401 Ga0501077_0031904
402 Ga0501079_0041965
403 nmdc:mga00v17_164358_c1
404 nmdc:mga0k408_61613_c1
405 nmdc:mga06z11_43379_c1
406 nmdc:mga04h51_6587_c1
407 nmdc:mga05p37_123_c1
408 nmdc:mga05p37_1280_c1
409 nmdc:mga05p37_20989_c1
410 nmdc:mga05p37_81726_c1
411 nmdc:mga05p37_94576_c1
412 nmdc:mga09592_165349_c1
413 nmdc:mga0qj67_24240_c1
414 nmdc:mga06r32_66987_c1
415 nmdc:mga06r32_75539_c1
416 nmdc:mga08y16_101492_c1
417 nmdc:mga08y16_26232_c1
418 nmdc:mga08y16_8985_c1
419 nmdc:mga0n895_50507_c1
420 Ga0495619_0041237
421 Ga0500641_0003239
422 Ga0500556_0003481
423 Ga0501084_0023644
424 Ga0501082_0083260
425 Ga0501082_0432965
426 2882458378

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

216

421

0.94

PF01321

Creatinase_N

Creatinase/Prolidase N-terminal domain

74

209

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.9496 1 357
5fcf-assembly1.cif.gz_A crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9481 1 357
5fch-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and zn bound 0.9456 1 357
5fcf-assembly1.cif.gz_B crystal structure of xaa-pro dipeptidase from xanthomonas campestris, phosphate and mn bound 0.9442 1 357
5cde-assembly1.cif.gz_B r372a mutant of xaa-pro dipeptidase from xanthomonas campestris 0.9419 1 357
ID Description Score Start End Superfamily
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9464 126 357 3.90.230.10
5fchB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9425 126 357 3.90.230.10
2howB02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9407 126 347 3.90.230.10
4r60B01 Alpha Beta;3-Layer(aba) Sandwich;Creatine Amidinohydrolase; Chain A, domain 1;Creatinase/prolidase N-terminal domain 0.9386 1 125 3.40.350.10
1wy2A02 Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily 0.9368 127 347 3.90.230.10
ID Description Score Start End GO Terms
AF-A0A3D3CTI2-F1-model_v4 Peptidase M24 domain-containing protein 0.973 126 357
AF-A0A2V9VCZ8-F1-model_v4 Aminopeptidase P family protein 0.9704 83 359 GO:0004177
AF-A0A1Q8BKA0-F1-model_v4 Peptidase M24 domain-containing protein 0.9695 158 358
AF-A0A4R2IC66-F1-model_v4 Xaa-Pro dipeptidase 0.9681 1 354
AF-A0A7W5MKD8-F1-model_v4 Xaa-Pro aminopeptidase 0.9668 1 355 GO:0004177

Map