F324159

General Info

Members Datasets Scaffolds Average Seq Length
213 162 426 242

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10255166|Ga0207648_102551662
Length 232
Sequence MIQVRAATSRFHTQIGWLDSWHSFSFGDHFDPNEQGHGLLLVNNDDRVAGNTGFGTHGHRDMEIVTWVLSGQLEHQDSTGAHGVLYPGLAQRMSAGTGVRHSEMNPSSEEVHFVQMWVPPDAKGVEPSYEQRDVTADLDAGGLVPVASGQGHDGALTIHQRDAVLWVGRLKAGETVAVPDAAHAHVFVAAGDAELEDGGALGEGDAARLTAAGSPSLTAGGTGVEVLVWATS

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
91 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
92 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
93 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
94 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
95 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
96 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
100 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
139 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
148 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
159 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 1.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.92
Nodule 0
Rhizoplane 5.63
Rhizosphere 84.98
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10255166 3300026089 Bacteria 1564
2 Ga0070676_10086886 3300005328 Bacteria 1908
3 Ga0070670_100023215 3300005331 Bacteria 5339
4 Ga0070677_10009379 3300005333 Bacteria 3317
5 Ga0070666_10009435 3300005335 Bacteria 6083
6 Ga0068868_100065213 3300005338 Bacteria 2892
7 Ga0070675_100013778 3300005354 Bacteria 6364
8 Ga0070671_100003990 3300005355 Bacteria 11628
9 Ga0070674_100000343 3300005356 Bacteria 23074
10 Ga0070674_100093088 3300005356 Bacteria 2180
11 Ga0070673_100000672 3300005364 Bacteria 18824
12 Ga0070659_100363433 3300005366 Bacteria 1216
13 Ga0070667_100089598 3300005367 Bacteria 2642
14 Ga0070667_100200378 3300005367 Bacteria 1771
15 Ga0070700_100267659 3300005441 Unclassified 1233
16 Ga0070708_100015004 3300005445 Bacteria 6389
17 Ga0070708_100516928 3300005445 Bacteria 1126
18 Ga0070678_100001622 3300005456 Bacteria 12056
19 Ga0070681_10066876 3300005458 Bacteria 3563
20 Ga0068867_100096812 3300005459 Bacteria 2247
21 Ga0070706_100059160 3300005467 Bacteria 3536
22 Ga0070706_100066163 3300005467 Bacteria 3343
23 Ga0070706_100178034 3300005467 Unclassified 1985
24 Ga0070698_100062848 3300005471 Bacteria 3745
25 Ga0070698_100477878 3300005471 Unclassified 1183
26 Ga0070698_100698552 3300005471 Bacteria 956
27 Ga0070699_100251003 3300005518 Unclassified 1581
28 Ga0070697_100050776 3300005536 Bacteria 3367
29 Ga0070697_100156179 3300005536 Unclassified 1926
30 Ga0070672_100001465 3300005543 Bacteria 14644
31 Ga0070686_100554729 3300005544 Unclassified 899
32 Ga0070696_100012171 3300005546 Bacteria 5766
33 Ga0070696_100254369 3300005546 Unclassified 1330
34 Ga0070665_100061751 3300005548 Bacteria 3757
35 Ga0070665_100095150 3300005548 Bacteria 2983
36 Ga0070704_100192935 3300005549 Unclassified 1639
37 Ga0070702_100057686 3300005615 Bacteria 2247
38 Ga0068859_100684059 3300005617 Bacteria 1117
39 Ga0068863_100117137 3300005841 Bacteria 2538
40 Ga0068863_100585821 3300005841 Bacteria 1103
41 Ga0068858_100008080 3300005842 Bacteria 10132
42 Ga0068858_100016505 3300005842 Bacteria 6935
43 Ga0068860_100631377 3300005843 Bacteria 1078
44 Ga0068862_100172996 3300005844 Bacteria 1934
45 Ga0081455_10572538 3300005937 Bacteria 742
46 Ga0075365_10004932 3300006038 Bacteria 7138
47 Ga0075365_10186103 3300006038 Bacteria 1452
48 Ga0075365_10197048 3300006038 Bacteria 1410
49 Ga0075363_100019917 3300006048 Bacteria 3359
50 Ga0075363_100027244 3300006048 Bacteria 2928
51 Ga0075364_10002799 3300006051 Bacteria 9808
52 Ga0070715_10213815 3300006163 Bacteria 987
53 Ga0075362_10090947 3300006177 Bacteria 1417
54 Ga0097621_100084486 3300006237 Bacteria 2646
55 Ga0068871_100025479 3300006358 Bacteria 4602
56 Ga0075433_10012591 3300006852 Bacteria 6841
57 Ga0075433_10189221 3300006852 Bacteria 1831
58 Ga0075434_100403861 3300006871 Bacteria 1387
59 Ga0075434_100459987 3300006871 Unclassified 1294
60 Ga0075429_100015774 3300006880 Bacteria 6544
61 Ga0097620_100684104 3300006931 Bacteria 1117
62 Ga0075435_100243831 3300007076 Unclassified 1529
63 Ga0075435_100271238 3300007076 Bacteria 1447
64 Ga0111539_10003085 3300009094 Bacteria 22083
65 Ga0105245_10001268 3300009098 Bacteria 22811
66 Ga0105245_10005312 3300009098 Bacteria 11318
67 Ga0105247_10055615 3300009101 Bacteria 2442
68 Ga0114129_10030819 3300009147 Bacteria 7585
69 Ga0114129_10126748 3300009147 Bacteria 3509
70 Ga0105242_10062885 3300009176 Bacteria 3056
71 Ga0105248_10660492 3300009177 Bacteria 1179
72 Ga0105249_10107254 3300009553 Bacteria 2636
73 Ga0157371_10037473 3300013102 Bacteria 3469
74 Ga0157378_10000778 3300013297 Bacteria 29641
75 Ga0157378_10423013 3300013297 Bacteria 1317
76 Ga0163162_10035041 3300013306 Bacteria 4997
77 Ga0157375_10009991 3300013308 Bacteria 8344
78 Ga0163163_10029143 3300014325 Bacteria 5309
79 Ga0157376_10000506 3300014969 Bacteria 25182
80 Ga0157376_10006230 3300014969 Bacteria 8409
81 Ga0206356_11370056 3300020070 Bacteria 1338
82 Ga0213873_10000147 3300021358 Bacteria 13339
83 Ga0207697_10028809 3300025315 Bacteria 2272
84 Ga0207680_10136572 3300025903 Bacteria 1621
85 Ga0207645_10004147 3300025907 Bacteria 10776
86 Ga0207684_10033171 3300025910 Bacteria 4392
87 Ga0207684_10058255 3300025910 Bacteria 3277
88 Ga0207684_10359234 3300025910 Unclassified 1253
89 Ga0207707_10075660 3300025912 Bacteria 2938
90 Ga0207707_10122725 3300025912 Bacteria 2272
91 Ga0207660_10189001 3300025917 Bacteria 1603
92 Ga0207649_10128024 3300025920 Bacteria 1721
93 Ga0207646_10168695 3300025922 Bacteria 1976
94 Ga0207646_10171683 3300025922 Unclassified 1958
95 Ga0207650_10021042 3300025925 Bacteria 4608
96 Ga0207659_10001826 3300025926 Bacteria 12611
97 Ga0207687_10007771 3300025927 Bacteria 7034
98 Ga0207687_10590618 3300025927 Bacteria 935
99 Ga0207644_10010305 3300025931 Bacteria 6160
100 Ga0207686_10120107 3300025934 Bacteria 1787
101 Ga0207669_10107836 3300025937 Bacteria 1858
102 Ga0207665_10053903 3300025939 Bacteria 2711
103 Ga0207691_10000019 3300025940 Bacteria 133680
104 Ga0207661_10414731 3300025944 Bacteria 1223
105 Ga0207651_10000353 3300025960 Bacteria 19411
106 Ga0207668_10463261 3300025972 Unclassified 1084
107 Ga0207640_10097042 3300025981 Bacteria 2056
108 Ga0207658_10116506 3300025986 Bacteria 2122
109 Ga0207677_10009733 3300026023 Bacteria 5413
110 Ga0207703_10024097 3300026035 Bacteria 4787
111 Ga0207708_10333356 3300026075 Unclassified 1241
112 Ga0207641_10040026 3300026088 Bacteria 3921
113 Ga0207648_10124431 3300026089 Bacteria 2268
114 Ga0207683_10001394 3300026121 Bacteria 21812
115 Ga0207428_10146279 3300027907 Bacteria 1801
116 Ga0268266_10111303 3300028379 Bacteria 2426
117 Ga0268265_10043717 3300028380 Bacteria 3332
118 Ga0316575_10203899 3300031665 Bacteria 824
119 Ga0316579_10102478 3300031691 Bacteria 1371
120 Ga0316576_10001869 3300031727 Bacteria 11708
121 Ga0316576_10009528 3300031727 Bacteria 6272
122 Ga0316576_10069889 3300031727 Bacteria 2589
123 Ga0316576_10108174 3300031727 Bacteria 2083
124 Ga0316578_10018751 3300031728 Bacteria 3798
125 Ga0316578_10080586 3300031728 Bacteria 1936
126 Ga0316580_10073530 3300032139 Bacteria 1046
127 Ga0373928_0039021 3300035084 Bacteria 1083
128 Ga0316574_0013630 3300035398 Bacteria 4678
129 Ga0316574_0038980 3300035398 Bacteria 2919
130 Ga0316574_0051280 3300035398 Bacteria 2571
131 Ga0316574_0174927 3300035398 Bacteria 1382
132 Ga0373931_0000005 3300035691 Bacteria 480485
133 Ga0316582_0101069 3300036647 Bacteria 1910
134 Ga0316584_0028461 3300036712 Bacteria 4122
135 Ga0316584_0037710 3300036712 Bacteria 3593
136 Ga0316584_0233459 3300036712 Bacteria 1348
137 Ga0436360_0813987 3300039438 Bacteria 4526
138 Ga0436360_1037760 3300039438 Bacteria 1007
139 Ga0436362_0183366 3300039453 Bacteria 2441
140 Ga0451837_1725399 3300041494 Bacteria 1291
141 Ga0451577_0893043 3300042876 Bacteria 800
142 Ga0466966_0137781 3300044684 Bacteria 1492
143 Ga0453684_0547825 3300044712 Bacteria 1275
144 Ga0466960_0012486 3300044901 Bacteria 3586
145 Ga0466960_0239593 3300044901 Bacteria 1004
146 Ga0466959_0111279 3300045049 Bacteria 1954
147 Ga0495608_0079105 3300046511 Bacteria 2138
148 Ga0495599_0384138 3300046678 Bacteria 838
149 Ga0496101_0248368 3300048904 Unclassified 1386
150 Ga0496104_0123468 3300048907 Bacteria 2486
151 Ga0496106_0017895 3300048909 Bacteria 5241
152 Ga0496108_0023666 3300048911 Bacteria 5054
153 Ga0496108_0131780 3300048911 Bacteria 2149
154 Ga0496109_0021008 3300048912 Bacteria 5772
155 Ga0496110_0001723 3300048913 Bacteria 16106
156 Ga0496112_0201744 3300048915 Bacteria 1948
157 Ga0496114_0346794 3300048917 Bacteria 1313
158 Ga0496114_0397517 3300048917 Bacteria 1220
159 Ga0496114_0503684 3300048917 Bacteria 1071
160 Ga0496115_0210572 3300048918 Bacteria 1606
161 Ga0501306_029930 3300049127 Bacteria 804
162 Ga0501311_033567 3300049527 Bacteria 752
163 Ga0501033_0112401 3300049570 Bacteria 1981
164 Ga0501034_0003139 3300049571 Bacteria 19020
165 Ga0501036_0001589 3300049572 Bacteria 17579
166 Ga0501037_0010820 3300049573 Bacteria 6704
167 Ga0501038_0053959 3300049574 Bacteria 3458
168 Ga0501039_0001696 3300049575 Bacteria 16241
169 Ga0501040_0001803 3300049576 Bacteria 13753
170 Ga0501041_0011501 3300049577 Bacteria 5232
171 Ga0501042_0000413 3300049578 Bacteria 21639
172 Ga0501043_0039052 3300049579 Bacteria 3731
173 Ga0501043_0251944 3300049579 Bacteria 1360
174 Ga0501046_0057598 3300049580 Bacteria 3048
175 Ga0501047_0289536 3300049581 Bacteria 1482
176 Ga0501048_0000499 3300049582 Bacteria 27464
177 Ga0501071_0000145 3300049587 Bacteria 29421
178 Ga0501072_0000364 3300049588 Bacteria 32284
179 Ga0501074_0001115 3300049590 Bacteria 17527
180 Ga0501075_0001635 3300049591 Bacteria 14714
181 Ga0501077_0000431 3300049593 Bacteria 25421
182 Ga0501079_0003386 3300049741 Bacteria 11704
183 Ga0501080_0000690 3300049742 Bacteria 27043
184 Ga0501081_0203210 3300049743 Bacteria 1437
185 Ga0501083_0044869 3300049744 Bacteria 2992
186 Ga0501035_0008580 3300049822 Bacteria 9513
187 Ga0501044_0001231 3300049823 Bacteria 30416
188 Ga0501045_0101151 3300049824 Bacteria 2133
189 nmdc:mga03683_26299_c1 3300050489 Bacteria 1876
190 nmdc:mga03683_26547_c1 3300050489 Bacteria 2285
191 nmdc:mga03n38_67234_c1 3300050490 Bacteria 1649
192 nmdc:mga00v17_87346_c1 3300050491 Bacteria 1955
193 nmdc:mga0yw44_236131_c1 3300050492 Bacteria 1214
194 nmdc:mga0yw44_2660_c1 3300050492 Bacteria 7699
195 nmdc:mga0yw44_312203_c1 3300050492 Bacteria 1055
196 nmdc:mga0yw44_4936_c1 3300050492 Bacteria 6212
197 nmdc:mga0yw44_7791_c1 3300050492 Bacteria 5295
198 nmdc:mga05p37_548668_c1 3300050507 Bacteria 1316
199 nmdc:mga05p37_61361_c1 3300050507 Bacteria 4628
200 nmdc:mga09592_75560_c1 3300050508 Bacteria 2864
201 nmdc:mga08y16_17916_c1 3300050511 Bacteria 7461
202 nmdc:mga0n895_128446_c1 3300050512 Bacteria 2559
203 nmdc:mga0n895_57670_c1 3300050512 Bacteria 3828
204 nmdc:mga0rr50_344273_c1 3300050513 Bacteria 1253
205 nmdc:mga0a205_225183_c1 3300050515 Bacteria 1760
206 nmdc:mga0a205_5993_c1 3300050515 Bacteria 10957
207 Ga0495619_0085152 3300053085 Bacteria 2134
208 Ga0500566_0001534 3300053094 Bacteria 13561
209 Ga0500604_0006747 3300053151 Bacteria 3039
210 Ga0500616_0000794 3300053153 Bacteria 36195
211 Ga0501084_0007731 3300054114 Bacteria 8849
212 Ga0501082_0001989 3300060353 Bacteria 17967
213 Ga0530510_0010365 3300061734 Bacteria 6534
214 Ga0207648_10255166
215 Ga0070676_10086886
216 Ga0070670_100023215
217 Ga0070677_10009379
218 Ga0070666_10009435
219 Ga0068868_100065213
220 Ga0070675_100013778
221 Ga0070671_100003990
222 Ga0070674_100000343
223 Ga0070674_100093088
224 Ga0070673_100000672
225 Ga0070659_100363433
226 Ga0070667_100089598
227 Ga0070667_100200378
228 Ga0070700_100267659
229 Ga0070708_100015004
230 Ga0070708_100516928
231 Ga0070678_100001622
232 Ga0070681_10066876
233 Ga0068867_100096812
234 Ga0070706_100059160
235 Ga0070706_100066163
236 Ga0070706_100178034
237 Ga0070698_100062848
238 Ga0070698_100477878
239 Ga0070698_100698552
240 Ga0070699_100251003
241 Ga0070697_100050776
242 Ga0070697_100156179
243 Ga0070672_100001465
244 Ga0070686_100554729
245 Ga0070696_100012171
246 Ga0070696_100254369
247 Ga0070665_100061751
248 Ga0070665_100095150
249 Ga0070704_100192935
250 Ga0070702_100057686
251 Ga0068859_100684059
252 Ga0068863_100117137
253 Ga0068863_100585821
254 Ga0068858_100008080
255 Ga0068858_100016505
256 Ga0068860_100631377
257 Ga0068862_100172996
258 Ga0081455_10572538
259 Ga0075365_10004932
260 Ga0075365_10186103
261 Ga0075365_10197048
262 Ga0075363_100019917
263 Ga0075363_100027244
264 Ga0075364_10002799
265 Ga0070715_10213815
266 Ga0075362_10090947
267 Ga0097621_100084486
268 Ga0068871_100025479
269 Ga0075433_10012591
270 Ga0075433_10189221
271 Ga0075434_100403861
272 Ga0075434_100459987
273 Ga0075429_100015774
274 Ga0097620_100684104
275 Ga0075435_100243831
276 Ga0075435_100271238
277 Ga0111539_10003085
278 Ga0105245_10001268
279 Ga0105245_10005312
280 Ga0105247_10055615
281 Ga0114129_10030819
282 Ga0114129_10126748
283 Ga0105242_10062885
284 Ga0105248_10660492
285 Ga0105249_10107254
286 Ga0157371_10037473
287 Ga0157378_10000778
288 Ga0157378_10423013
289 Ga0163162_10035041
290 Ga0157375_10009991
291 Ga0163163_10029143
292 Ga0157376_10000506
293 Ga0157376_10006230
294 Ga0206356_11370056
295 Ga0213873_10000147
296 Ga0207697_10028809
297 Ga0207680_10136572
298 Ga0207645_10004147
299 Ga0207684_10033171
300 Ga0207684_10058255
301 Ga0207684_10359234
302 Ga0207707_10075660
303 Ga0207707_10122725
304 Ga0207660_10189001
305 Ga0207649_10128024
306 Ga0207646_10168695
307 Ga0207646_10171683
308 Ga0207650_10021042
309 Ga0207659_10001826
310 Ga0207687_10007771
311 Ga0207687_10590618
312 Ga0207644_10010305
313 Ga0207686_10120107
314 Ga0207669_10107836
315 Ga0207665_10053903
316 Ga0207691_10000019
317 Ga0207661_10414731
318 Ga0207651_10000353
319 Ga0207668_10463261
320 Ga0207640_10097042
321 Ga0207658_10116506
322 Ga0207677_10009733
323 Ga0207703_10024097
324 Ga0207708_10333356
325 Ga0207641_10040026
326 Ga0207648_10124431
327 Ga0207683_10001394
328 Ga0207428_10146279
329 Ga0268266_10111303
330 Ga0268265_10043717
331 Ga0316575_10203899
332 Ga0316579_10102478
333 Ga0316576_10001869
334 Ga0316576_10009528
335 Ga0316576_10069889
336 Ga0316576_10108174
337 Ga0316578_10018751
338 Ga0316578_10080586
339 Ga0316580_10073530
340 Ga0373928_0039021
341 Ga0316574_0013630
342 Ga0316574_0038980
343 Ga0316574_0051280
344 Ga0316574_0174927
345 Ga0373931_0000005
346 Ga0316582_0101069
347 Ga0316584_0028461
348 Ga0316584_0037710
349 Ga0316584_0233459
350 Ga0436360_0813987
351 Ga0436360_1037760
352 Ga0436362_0183366
353 Ga0451837_1725399
354 Ga0451577_0893043
355 Ga0466966_0137781
356 Ga0453684_0547825
357 Ga0466960_0012486
358 Ga0466960_0239593
359 Ga0466959_0111279
360 Ga0495608_0079105
361 Ga0495599_0384138
362 Ga0496101_0248368
363 Ga0496104_0123468
364 Ga0496106_0017895
365 Ga0496108_0023666
366 Ga0496108_0131780
367 Ga0496109_0021008
368 Ga0496110_0001723
369 Ga0496112_0201744
370 Ga0496114_0346794
371 Ga0496114_0397517
372 Ga0496114_0503684
373 Ga0496115_0210572
374 Ga0501306_029930
375 Ga0501311_033567
376 Ga0501033_0112401
377 Ga0501034_0003139
378 Ga0501036_0001589
379 Ga0501037_0010820
380 Ga0501038_0053959
381 Ga0501039_0001696
382 Ga0501040_0001803
383 Ga0501041_0011501
384 Ga0501042_0000413
385 Ga0501043_0039052
386 Ga0501043_0251944
387 Ga0501046_0057598
388 Ga0501047_0289536
389 Ga0501048_0000499
390 Ga0501071_0000145
391 Ga0501072_0000364
392 Ga0501074_0001115
393 Ga0501075_0001635
394 Ga0501077_0000431
395 Ga0501079_0003386
396 Ga0501080_0000690
397 Ga0501081_0203210
398 Ga0501083_0044869
399 Ga0501035_0008580
400 Ga0501044_0001231
401 Ga0501045_0101151
402 nmdc:mga03683_26299_c1
403 nmdc:mga03683_26547_c1
404 nmdc:mga03n38_67234_c1
405 nmdc:mga00v17_87346_c1
406 nmdc:mga0yw44_236131_c1
407 nmdc:mga0yw44_2660_c1
408 nmdc:mga0yw44_312203_c1
409 nmdc:mga0yw44_4936_c1
410 nmdc:mga0yw44_7791_c1
411 nmdc:mga05p37_548668_c1
412 nmdc:mga05p37_61361_c1
413 nmdc:mga09592_75560_c1
414 nmdc:mga08y16_17916_c1
415 nmdc:mga0n895_128446_c1
416 nmdc:mga0n895_57670_c1
417 nmdc:mga0rr50_344273_c1
418 nmdc:mga0a205_225183_c1
419 nmdc:mga0a205_5993_c1
420 Ga0495619_0085152
421 Ga0500566_0001534
422 Ga0500604_0006747
423 Ga0500616_0000794
424 Ga0501084_0007731
425 Ga0501082_0001989
426 Ga0530510_0010365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02678

Pirin

Pirin

3

118

0.93

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

145

229

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.929 13 251
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9251 13 251
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9211 13 247
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9134 13 247
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.8658 176 244
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9952 25 144 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.987 25 144 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.964 23 144 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9364 52 132 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9329 23 144 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W0R1M7-F1-model_v4 Pirin family protein 0.9881 13 186 GO:0046872
AF-A0A6I3WLK8-F1-model_v4 Pirin family protein 0.9878 13 246 GO:0046872
AF-A0A359LRR0-F1-model_v4 Quercetin 2,3-dioxygenase 0.987 54 141 GO:0051213
AF-A0A6N7BAE4-F1-model_v4 Pirin N-terminal domain-containing protein 0.9863 15 146
AF-A0A069D1C9-F1-model_v4 Pirin 0.9848 17 151

Map