F324031

General Info

Members Datasets Scaffolds Average Seq Length
213 125 198 862

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10000012|Ga0105239_10000012163
Length 921
Sequence MLRIYAGNDIFFGDIYAESGVDGLLQGYFYLNSCILPLGSFSLSFRKNNYLPYMKYAKLPLLLLLCAGMFNARAQNADDAKPVYDQHKIFNPLFYPEKGNEFRTAAGAPGAKYWQNHADYKLNVTLDTAKHSVTGTTLITYTNNSPDPLGFLWLQVDQNIYKEDSRGQATSPVEGGRFNNKTFTQGDEIKGVYVIKNGKAEKVDYIVTDTRMQIRLKDTLRSGGAKIQLKIDYKFDVPEYGTDRMGRVLTKNGWIYEIAQWYPRMEVYDDVTGWNVIPYMGASEFYLEYGNFDYTVTAPANLVVVGSGELLNPAEVYSPKILSRVNAARVSDKTIMIKDSVDLFSKDSYPAKATVTWHFFCKNARDVSWAASKAFIWDAARINLPSGKKAVAQSVYPIESKGMGAWSRSTEYVKACIELYSQEWFEYTYPVATNVGGVVGGMEYPGIVFCSSQSAGGALWEVTNHEFGHNWFPMIVGSNERKYAWMDEGFNTFINKVDTKVFNKGEYWEPGDEQKAAVSMFAPGADAIMNTPDVINADYLGYAAYEKPALGLKILREQILGEERFDYAFKTYIKRWAFKHPTPWDFFHTMDNVAGEDLSWFWNEWFITTLSLDQAVRSIDYVENDPSKGSLITIENLEGMALPVIASVKEENGKTGTVKLPAEIWQRGGTWTFQYKSTSKITFVTLDPDHVLPDIKPENNSMSGLSMEKGVTVNSVIKKYFDAVGGEQRLKDVNDLTLTSQGSIQGIDLIKESKFKNPGKEAVQVVIPKYNNLVFNHIIVNGDSVSVHQNNRLMDLSKGDKGAISAKYKLFPELDFGKQGYSAVLDTNYQVVNGQLAYLITVKNPDGIPVKYYYDQKTGLKVKQDVDMPNTSGVDFGDYQNIPTGIKIPFSEKTSVAGQPVEFKVKTAVVNTGVANDAFKM

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
6 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
7 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
12 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
13 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
14 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
15 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
19 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
20 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
94 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
95 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
105 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
108 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
109 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
110 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
111 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
117 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
118 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
119 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
120 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
121 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
122 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.96
Metatranscriptomes 0
Isolates 7.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.27
Nodule 0
Rhizoplane 0.47
Rhizosphere 74.18
Stem 0
Stem Tuber 0
Unclassified 14.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000042 3300001990 Bacteria 37008
2 JGI24735J21928_10000014 3300002067 Bacteria 186670
3 JGI25162J39368_1000022 3300002737 Bacteria 239510
4 rootH1_10044863 3300003316 Bacteria 10188
5 rootH2_10002871 3300003320 Bacteria 62767
6 rootH2_10008717 3300003320 Bacteria 23143
7 rootH2_10009544 3300003320 Bacteria 42409
8 rootH2_10108312 3300003320 Bacteria 9995
9 rootL2_10022046 3300003322 Bacteria 6995
10 rootL2_10051564 3300003322 Bacteria 7828
11 rootH1_10006785 3300003323 Bacteria 51850
12 Ga0055531_10000144 3300003794 Bacteria 82231
13 Ga0070658_10000047 3300005327 Bacteria 129483
14 Ga0070658_10027019 3300005327 Bacteria 4608
15 Ga0070683_100014107 3300005329 Bacteria 6978
16 Ga0070666_10010421 3300005335 Bacteria 5814
17 Ga0070680_100010363 3300005336 Bacteria 7184
18 Ga0070680_100045469 3300005336 Bacteria 3569
19 Ga0070660_100001792 3300005339 Bacteria 14743
20 Ga0070660_100017844 3300005339 Bacteria 5177
21 Ga0070671_100001421 3300005355 Bacteria 17898
22 Ga0070673_100001562 3300005364 Bacteria 13484
23 Ga0070659_100003474 3300005366 Bacteria 11211
24 Ga0070659_100004502 3300005366 Bacteria 9955
25 Ga0070662_100000083 3300005457 Bacteria 51358
26 Ga0070681_10021037 3300005458 Bacteria 6537
27 Ga0070679_100001254 3300005530 Bacteria 22385
28 Ga0070684_100008118 3300005535 Bacteria 8194
29 Ga0068853_100015998 3300005539 Bacteria 6169
30 Ga0068853_100061938 3300005539 Bacteria 3237
31 Ga0070665_100000041 3300005548 Bacteria 297849
32 Ga0070665_100000267 3300005548 Bacteria 85526
33 Ga0068855_100000506 3300005563 Bacteria 48223
34 Ga0068855_100000704 3300005563 Bacteria 40979
35 Ga0068855_100000748 3300005563 Bacteria 39873
36 Ga0068855_100018316 3300005563 Bacteria 8412
37 Ga0068855_100078844 3300005563 Bacteria 3821
38 Ga0068857_100006959 3300005577 Bacteria 9735
39 Ga0068856_100000015 3300005614 Bacteria 157353
40 Ga0068856_100008864 3300005614 Bacteria 9789
41 Ga0068856_100109041 3300005614 Bacteria 2764
42 Ga0068852_100001785 3300005616 Bacteria 14610
43 Ga0068860_100000208 3300005843 Bacteria 92818
44 Ga0068860_100007619 3300005843 Bacteria 10834
45 Ga0075366_10000386 3300006195 Bacteria 20464
46 Ga0097621_100000259 3300006237 Bacteria 35593
47 Ga0068871_100000824 3300006358 Bacteria 20776
48 Ga0068865_100000492 3300006881 Bacteria 22165
49 Ga0105240_10000224 3300009093 Bacteria 113175
50 Ga0105240_10000728 3300009093 Bacteria 60140
51 Ga0105240_10002232 3300009093 Bacteria 31507
52 Ga0105241_10000493 3300009174 Bacteria 29814
53 Ga0105241_10002347 3300009174 Bacteria 14220
54 Ga0105237_10000622 3300009545 Bacteria 49566
55 Ga0105237_10002801 3300009545 Bacteria 21180
56 Ga0105237_10008284 3300009545 Bacteria 11287
57 Ga0105237_10018180 3300009545 Bacteria 7277
58 Ga0105237_10023397 3300009545 Bacteria 6330
59 Ga0105237_10028338 3300009545 Bacteria 5706
60 Ga0105238_10000247 3300009551 Bacteria 60300
61 Ga0105238_10008890 3300009551 Bacteria 10053
62 Ga0105239_10000002 3300010375 Bacteria 610298
63 Ga0105239_10000012 3300010375 Bacteria 332279
64 Ga0105239_10000685 3300010375 Bacteria 48269
65 Ga0105239_10000887 3300010375 Bacteria 42411
66 Ga0105239_10001617 3300010375 Bacteria 29762
67 Ga0105239_10008895 3300010375 Bacteria 11368
68 Ga0105239_10034753 3300010375 Bacteria 5537
69 Ga0157373_10001878 3300013100 Bacteria 15937
70 Ga0157373_10003781 3300013100 Bacteria 11453
71 Ga0157371_10001086 3300013102 Bacteria 29437
72 Ga0157371_10001267 3300013102 Bacteria 26607
73 Ga0157371_10003814 3300013102 Bacteria 13473
74 Ga0157371_10003970 3300013102 Bacteria 13121
75 Ga0157371_10006969 3300013102 Bacteria 9204
76 Ga0157371_10013988 3300013102 Bacteria 6074
77 Ga0157370_10006476 3300013104 Bacteria 12911
78 Ga0157369_10020699 3300013105 Bacteria 7354
79 Ga0157369_10061497 3300013105 Bacteria 4048
80 Ga0157374_10000001 3300013296 Bacteria 1077351
81 Ga0157374_10001231 3300013296 Bacteria 21878
82 Ga0157374_10001437 3300013296 Bacteria 20134
83 Ga0163162_10000034 3300013306 Bacteria 149611
84 Ga0163162_10001520 3300013306 Bacteria 21611
85 Ga0163162_10025420 3300013306 Bacteria 5851
86 Ga0157372_10000252 3300013307 Bacteria 59348
87 Ga0157372_10000317 3300013307 Bacteria 53205
88 Ga0157372_10002015 3300013307 Bacteria 22086
89 Ga0157372_10002225 3300013307 Bacteria 21049
90 Ga0157372_10109233 3300013307 Bacteria 3167
91 Ga0157375_10016384 3300013308 Bacteria 6657
92 Ga0182005_1000091 3300015265 Bacteria 67859
93 Ga0207427_100171 3300025231 Bacteria 71988
94 Ga0209437_100024 3300025233 Bacteria 592878
95 Ga0209437_100052 3300025233 Bacteria 380548
96 Ga0209258_100081 3300025242 Bacteria 254564
97 Ga0209026_1000834 3300025250 Bacteria 16276
98 Ga0209026_1006353 3300025250 Bacteria 2915
99 Ga0209148_1000202 3300025254 Bacteria 106106
100 Ga0209233_1000067 3300025261 Bacteria 380554
101 Ga0209130_1001650 3300025284 Bacteria 13651
102 Ga0207426_1000114 3300025302 Bacteria 228273
103 Ga0207426_1012464 3300025302 Bacteria 3191
104 Ga0209257_1000064 3300025304 Bacteria 356803
105 Ga0207647_10000098 3300025904 Bacteria 67170
106 Ga0207647_10014136 3300025904 Bacteria 5512
107 Ga0207645_10000185 3300025907 Bacteria 49988
108 Ga0207705_10000052 3300025909 Bacteria 168319
109 Ga0207654_10001487 3300025911 Bacteria 12386
110 Ga0207695_10000110 3300025913 Bacteria 250079
111 Ga0207695_10000189 3300025913 Bacteria 177142
112 Ga0207695_10002344 3300025913 Bacteria 28132
113 Ga0207695_10005513 3300025913 Bacteria 16753
114 Ga0207695_10036926 3300025913 Bacteria 5275
115 Ga0207671_10002229 3300025914 Bacteria 21016
116 Ga0207671_10003957 3300025914 Bacteria 14415
117 Ga0207671_10004371 3300025914 Bacteria 13550
118 Ga0207671_10005442 3300025914 Bacteria 11721
119 Ga0207671_10005873 3300025914 Bacteria 11150
120 Ga0207671_10020779 3300025914 Bacteria 4993
121 Ga0207657_10004060 3300025919 Bacteria 15540
122 Ga0207657_10025671 3300025919 Bacteria 5428
123 Ga0207657_10034131 3300025919 Bacteria 4579
124 Ga0207652_10000180 3300025921 Bacteria 66974
125 Ga0207652_10000337 3300025921 Bacteria 48786
126 Ga0207694_10020081 3300025924 Bacteria 5053
127 Ga0207644_10001351 3300025931 Bacteria 15777
128 Ga0207706_10000176 3300025933 Bacteria 70917
129 Ga0207704_10000055 3300025938 Bacteria 78858
130 Ga0207667_10000144 3300025949 Bacteria 108295
131 Ga0207667_10000375 3300025949 Bacteria 60547
132 Ga0207667_10000773 3300025949 Bacteria 41528
133 Ga0207667_10002384 3300025949 Bacteria 23511
134 Ga0207667_10002632 3300025949 Bacteria 22201
135 Ga0207667_10100429 3300025949 Bacteria 2984
136 Ga0207651_10011900 3300025960 Bacteria 4891
137 Ga0207639_10012076 3300026041 Bacteria 6007
138 Ga0207702_10002568 3300026078 Bacteria 17064
139 Ga0207674_10011947 3300026116 Bacteria 9735
140 Ga0268266_10000014 3300028379 Bacteria 644033
141 Ga0268266_10000018 3300028379 Bacteria 569141
142 Ga0268264_10000041 3300028381 Bacteria 372501
143 Ga0268264_10000950 3300028381 Bacteria 29935
144 Ga0307517_10022720 3300028786 Bacteria 7845
145 Ga0307517_10028299 3300028786 Bacteria 6689
146 Ga0307515_10005287 3300028794 Bacteria 26245
147 Ga0307515_10017194 3300028794 Bacteria 13192
148 Ga0307511_10000122 3300030521 Bacteria 70869
149 Ga0307516_10001339 3300031730 Bacteria 34211
150 Ga0307507_10002030 3300033179 Bacteria 43887
151 Ga0307510_10003612 3300033180 Bacteria 18058
152 Ga0395899_0000002 3300037312 Bacteria 1324310
153 Ga0395899_0010665 3300037312 Bacteria 7040
154 Ga0395900_0001549 3300037418 Bacteria 27320
155 Ga0395900_0018022 3300037418 Bacteria 7209
156 Ga0395900_0019851 3300037418 Bacteria 6851
157 Ga0395905_0000520 3300037471 Bacteria 52744
158 Ga0395905_0003309 3300037471 Bacteria 17296
159 Ga0395905_0041792 3300037471 Bacteria 4302
160 Ga0395905_0079644 3300037471 Bacteria 3071
161 Ga0395901_0003324 3300038443 Bacteria 16201
162 Ga0395901_0003411 3300038443 Bacteria 16009
163 Ga0395901_0003486 3300038443 Bacteria 15853
164 Ga0436365_1133037 3300039437 Bacteria 24803
165 Ga0495650_0000003 3300046471 Bacteria 900730
166 Ga0495585_0000085 3300046492 Bacteria 97836
167 Ga0495606_0000145 3300046507 Bacteria 122857
168 Ga0495606_0011010 3300046507 Bacteria 7428
169 Ga0495610_0001185 3300046512 Bacteria 23579
170 Ga0495648_0000729 3300046524 Bacteria 35114
171 Ga0495633_0000069 3300046558 Bacteria 135128
172 Ga0495633_0000123 3300046558 Bacteria 104682
173 Ga0495633_0023872 3300046558 Bacteria 3026
174 Ga0495668_0000003 3300046616 Bacteria 695023
175 Ga0495625_0000005 3300046660 Bacteria 596135
176 Ga0495625_0001880 3300046660 Bacteria 23825
177 Ga0495625_0030259 3300046660 Bacteria 4041
178 Ga0495661_0000511 3300046665 Bacteria 40405
179 Ga0495649_0000003 3300046694 Bacteria 880817
180 Ga0495687_000001 3300047443 Bacteria 1215582
181 Ga0495687_000672 3300047443 Bacteria 38920
182 Ga0495687_002396 3300047443 Bacteria 15120
183 Ga0495686_0000367 3300047472 Bacteria 73112
184 Ga0496121_0000011 3300048924 Bacteria 792193
185 Ga0496126_0026817 3300048929 Bacteria 5516
186 Ga0501241_001305 3300049758 Bacteria 5160
187 nmdc:mga0k408_342_c1 3300050493 Bacteria 25447
188 Ga0500644_0000035 3300053088 Bacteria 82815
189 Ga0500583_0000989 3300053092 Bacteria 8077
190 Ga0500651_0006188 3300053093 Bacteria 6879
191 Ga0500608_000736 3300053122 Bacteria 11950
192 Ga0500618_000002 3300053125 Bacteria 370822
193 Ga0500568_0017858 3300053139 Bacteria 3121
194 Ga0500577_0002129 3300053142 Bacteria 5055
195 Ga0500616_0011240 3300053153 Bacteria 5303
196 Ga0500622_0000203 3300053156 Bacteria 63042
197 Ga0500622_0001514 3300053156 Bacteria 18450
198 Ga0466962_0020802 3300061719 Bacteria 3153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028786 Ga0307517_10028299 Ga0307517_100282992 827
2 3300037312 Ga0395899_0000002 Ga0395899_0000002_1291635_1294190 827
3 3300048924 Ga0496121_0000011 Ga0496121_0000011_387808_390354 827
4 3300046558 Ga0495633_0023872 Ga0495633_0023872_508_2994 828
5 3300003322 rootL2_10022046 rootL2_100220462 833
6 3300009545 Ga0105237_10002801 Ga0105237_100028012 835
7 3300009545 Ga0105237_10023397 Ga0105237_100233973 835
8 3300010375 Ga0105239_10000685 Ga0105239_1000068539 835
9 3300025914 Ga0207671_10020779 Ga0207671_100207794 835
10 3300003320 rootH2_10008717 rootH2_100087176 837
11 3300003320 rootH2_10009544 rootH2_1000954417 837
12 3300005614 Ga0068856_100008864 Ga0068856_1000088646 838
13 3300013296 Ga0157374_10000001 Ga0157374_1000000138 839
14 3300015265 Ga0182005_1000091 Ga0182005_10000918 839
15 3300030521 Ga0307511_10000122 Ga0307511_1000012213 839
16 3300037312 Ga0395899_0010665 Ga0395899_0010665_2863_5472 839
17 3300037418 Ga0395900_0019851 Ga0395900_0019851_165_2774 839
18 3300037471 Ga0395905_0000520 Ga0395905_0000520_6620_9229 839
19 3300038443 Ga0395901_0003486 Ga0395901_0003486_3338_5947 839
20 3300005364 Ga0070673_100001562 Ga0070673_1000015623 840
21 3300006237 Ga0097621_100000259 Ga0097621_10000025927 840
22 3300006358 Ga0068871_100000824 Ga0068871_10000082418 840
23 3300013296 Ga0157374_10001437 Ga0157374_1000143716 840
24 3300025960 Ga0207651_10011900 Ga0207651_100119003 840
25 3300061719 Ga0466962_0020802 Ga0466962_0020802_276_2840 840
26 3300005329 Ga0070683_100014107 Ga0070683_1000141074 841
27 3300005355 Ga0070671_100001421 Ga0070671_1000014215 841
28 3300005535 Ga0070684_100008118 Ga0070684_1000081183 841
29 3300005539 Ga0068853_100061938 Ga0068853_1000619382 841
30 3300005563 Ga0068855_100000704 Ga0068855_10000070424 841
31 3300006881 Ga0068865_100000492 Ga0068865_10000049218 841
32 3300009545 Ga0105237_10028338 Ga0105237_100283383 841
33 3300025907 Ga0207645_10000185 Ga0207645_1000018540 841
34 3300025913 Ga0207695_10000110 Ga0207695_1000011084 841
35 3300025931 Ga0207644_10001351 Ga0207644_100013515 841
36 3300025938 Ga0207704_10000055 Ga0207704_100000553 841
37 3300025949 Ga0207667_10000144 Ga0207667_1000014446 841
38 3300047443 Ga0495687_002396 Ga0495687_002396_7810_10551 841
39 3300013308 Ga0157375_10016384 Ga0157375_100163842 843
40 3300005843 Ga0068860_100007619 Ga0068860_1000076197 844
41 3300009093 Ga0105240_10000728 Ga0105240_1000072828 844
42 3300009545 Ga0105237_10000622 Ga0105237_1000062228 844
43 3300009545 Ga0105237_10008284 Ga0105237_100082847 844
44 3300010375 Ga0105239_10001617 Ga0105239_1000161721 844
45 3300025914 Ga0207671_10004371 Ga0207671_100043713 844
46 3300028381 Ga0268264_10000950 Ga0268264_100009504 844
47 3300037418 Ga0395900_0001549 Ga0395900_0001549_7198_9819 846
48 3300037471 Ga0395905_0003309 Ga0395905_0003309_7514_10135 846
49 3300038443 Ga0395901_0003411 Ga0395901_0003411_3814_6435 846
50 iso_pu_bacteria 2821136567 2821142494 846
51 iso_pu_bacteria 2904467357 2904470338 846
52 3300013105 Ga0157369_10061497 Ga0157369_100614972 847
53 3300025302 Ga0207426_1012464 Ga0207426_10124642 847
54 3300005339 Ga0070660_100017844 Ga0070660_1000178443 848
55 3300005457 Ga0070662_100000083 Ga0070662_10000008345 848
56 3300005616 Ga0068852_100001785 Ga0068852_1000017856 848
57 3300009174 Ga0105241_10002347 Ga0105241_100023477 848
58 3300009551 Ga0105238_10008890 Ga0105238_100088906 848
59 3300013104 Ga0157370_10006476 Ga0157370_100064766 848
60 3300013105 Ga0157369_10020699 Ga0157369_100206995 848
61 3300013296 Ga0157374_10001231 Ga0157374_1000123114 848
62 3300013307 Ga0157372_10000317 Ga0157372_1000031728 848
63 3300025904 Ga0207647_10000098 Ga0207647_1000009840 848
64 3300025904 Ga0207647_10014136 Ga0207647_100141363 848
65 3300025913 Ga0207695_10005513 Ga0207695_1000551311 848
66 3300025919 Ga0207657_10025671 Ga0207657_100256713 848
67 3300025933 Ga0207706_10000176 Ga0207706_1000017643 848
68 3300025949 Ga0207667_10000773 Ga0207667_1000077318 848
69 3300046524 Ga0495648_0000729 Ga0495648_0000729_15873_18482 848
70 3300053092 Ga0500583_0000989 Ga0500583_0000989_2813_5422 848
71 3300053156 Ga0500622_0001514 Ga0500622_0001514_1159_3768 848
72 3300053156 Ga0500622_0000203 Ga0500622_0000203_25214_27811 849
73 3300003794 Ga0055531_10000144 Ga0055531_1000014443 850
74 3300005335 Ga0070666_10010421 Ga0070666_100104213 850
75 3300025284 Ga0209130_1001650 Ga0209130_10016509 850
76 3300025302 Ga0207426_1000114 Ga0207426_100011472 850
77 3300025304 Ga0209257_1000064 Ga0209257_1000064171 850
78 3300013307 Ga0157372_10002225 Ga0157372_1000222511 851
79 3300025242 Ga0209258_100081 Ga0209258_100081138 851
80 3300025254 Ga0209148_1000202 Ga0209148_100020276 851
81 3300025919 Ga0207657_10034131 Ga0207657_100341313 851
82 3300047472 Ga0495686_0000367 Ga0495686_0000367_46608_49211 851
83 3300053088 Ga0500644_0000035 Ga0500644_0000035_74730_77327 851
84 3300053142 Ga0500577_0002129 Ga0500577_0002129_2103_4700 851
85 3300053153 Ga0500616_0011240 Ga0500616_0011240_2126_4723 851
86 3300005548 Ga0070665_100000041 Ga0070665_100000041190 852
87 3300005843 Ga0068860_100000208 Ga0068860_1000002089 852
88 3300013306 Ga0163162_10001520 Ga0163162_1000152016 852
89 3300028379 Ga0268266_10000014 Ga0268266_100000145 852
90 3300028381 Ga0268264_10000041 Ga0268264_1000004176 852
91 3300047443 Ga0495687_000001 Ga0495687_000001_85697_88306 852
92 3300053139 Ga0500568_0017858 Ga0500568_0017858_54_2663 852
93 iso_pu_bacteria 2818991460 2819681636 854
94 3300003316 rootH1_10044863 rootH1_100448632 855
95 3300031730 Ga0307516_10001339 Ga0307516_1000133926 855
96 iso_pu_bacteria 2929177148 2929181526 855
97 iso_pu_bacteria 2929239360 2929243439 855
98 iso_pu_bacteria 2945977869 2945983936 855
99 iso_pu_bacteria 2946013367 2946016671 855
100 3300009093 Ga0105240_10000224 Ga0105240_1000022457 856
101 3300009093 Ga0105240_10002232 Ga0105240_100022328 856
102 3300009174 Ga0105241_10000493 Ga0105241_100004933 856
103 3300009551 Ga0105238_10000247 Ga0105238_1000024720 856
104 3300025911 Ga0207654_10001487 Ga0207654_100014873 856
105 3300025913 Ga0207695_10002344 Ga0207695_100023449 856
106 3300025914 Ga0207671_10003957 Ga0207671_1000395710 856
107 3300025924 Ga0207694_10020081 Ga0207694_100200811 856
108 3300046558 Ga0495633_0000123 Ga0495633_0000123_75786_78380 856
109 3300053093 Ga0500651_0006188 Ga0500651_0006188_3045_5639 856
110 iso_pu_bacteria 2818991442 2819576266 856
111 3300003320 rootH2_10108312 rootH2_101083125 857
112 3300025250 Ga0209026_1006353 Ga0209026_10063532 857
113 3300025913 Ga0207695_10000189 Ga0207695_10000189137 857
114 3300025914 Ga0207671_10002229 Ga0207671_1000222915 857
115 3300048929 Ga0496126_0026817 Ga0496126_0026817_1768_4446 857
116 3300049758 Ga0501241_001305 Ga0501241_001305_2212_4809 857
117 iso_pu_bacteria 2884791551 2884792376 857
118 3300025949 Ga0207667_10100429 Ga0207667_101004291 860
119 3300005327 Ga0070658_10027019 Ga0070658_100270193 861
120 3300005336 Ga0070680_100045469 Ga0070680_1000454692 861
121 3300005339 Ga0070660_100001792 Ga0070660_1000017926 861
122 3300005366 Ga0070659_100004502 Ga0070659_1000045024 861
123 3300005530 Ga0070679_100001254 Ga0070679_10000125410 861
124 3300005614 Ga0068856_100109041 Ga0068856_1001090411 861
125 3300013100 Ga0157373_10003781 Ga0157373_100037817 861
126 3300013102 Ga0157371_10001086 Ga0157371_1000108619 861
127 3300013102 Ga0157371_10001267 Ga0157371_1000126711 861
128 3300013102 Ga0157371_10003970 Ga0157371_100039703 861
129 3300013102 Ga0157371_10006969 Ga0157371_100069694 861
130 3300013102 Ga0157371_10013988 Ga0157371_100139882 861
131 3300013307 Ga0157372_10109233 Ga0157372_101092331 861
132 3300025919 Ga0207657_10004060 Ga0207657_100040609 861
133 3300025921 Ga0207652_10000180 Ga0207652_1000018049 861
134 3300025921 Ga0207652_10000337 Ga0207652_1000033714 861
135 3300037418 Ga0395900_0018022 Ga0395900_0018022_3107_5704 861
136 3300037471 Ga0395905_0041792 Ga0395905_0041792_590_3187 861
137 3300037471 Ga0395905_0079644 Ga0395905_0079644_287_2884 861
138 3300038443 Ga0395901_0003324 Ga0395901_0003324_5896_8493 861
139 3300005327 Ga0070658_10000047 Ga0070658_1000004791 863
140 3300005563 Ga0068855_100078844 Ga0068855_1000788442 863
141 3300025909 Ga0207705_10000052 Ga0207705_1000005292 863
142 iso_pu_bacteria 2599185184 2599477708 863
143 iso_pu_bacteria 2910245624 2910249918 863
144 iso_pu_bacteria 2919437846 2919441663 863
145 iso_pu_bacteria 2928078545 2928079624 863
146 iso_pu_bacteria 2928147474 2928147900 863
147 iso_pu_bacteria 2932082852 2932086752 863
148 3300039437 Ga0436365_1133037 Ga0436365_1133037_1521_4172 864
149 3300005366 Ga0070659_100003474 Ga0070659_1000034747 865
150 3300005577 Ga0068857_100006959 Ga0068857_1000069594 865
151 3300010375 Ga0105239_10000002 Ga0105239_10000002248 865
152 3300013100 Ga0157373_10001878 Ga0157373_100018789 865
153 3300013102 Ga0157371_10003814 Ga0157371_100038146 865
154 3300013307 Ga0157372_10000252 Ga0157372_1000025239 865
155 3300026116 Ga0207674_10011947 Ga0207674_100119474 865
156 3300003320 rootH2_10002871 rootH2_1000287163 866
157 3300005336 Ga0070680_100010363 Ga0070680_1000103634 866
158 3300005458 Ga0070681_10021037 Ga0070681_100210372 866
159 3300005539 Ga0068853_100015998 Ga0068853_1000159981 866
160 3300005548 Ga0070665_100000267 Ga0070665_10000026774 866
161 3300005614 Ga0068856_100000015 Ga0068856_10000001513 866
162 3300013306 Ga0163162_10000034 Ga0163162_10000034118 866
163 3300025250 Ga0209026_1000834 Ga0209026_100083412 866
164 3300025949 Ga0207667_10002384 Ga0207667_100023847 866
165 3300026041 Ga0207639_10012076 Ga0207639_100120764 866
166 3300026078 Ga0207702_10002568 Ga0207702_1000256813 866
167 3300028379 Ga0268266_10000018 Ga0268266_10000018478 866
168 3300046665 Ga0495661_0000511 Ga0495661_0000511_9740_12340 866
169 3300001990 JGI24737J22298_10000042 JGI24737J22298_1000004225 867
170 3300002067 JGI24735J21928_10000014 JGI24735J21928_1000001457 867
171 3300002737 JGI25162J39368_1000022 JGI25162J39368_1000022189 867
172 3300003322 rootL2_10051564 rootL2_100515642 867
173 3300003323 rootH1_10006785 rootH1_100067854 867
174 3300005563 Ga0068855_100000506 Ga0068855_10000050644 867
175 3300005563 Ga0068855_100000748 Ga0068855_10000074821 867
176 3300005563 Ga0068855_100018316 Ga0068855_1000183162 867
177 3300006195 Ga0075366_10000386 Ga0075366_100003866 867
178 3300009545 Ga0105237_10018180 Ga0105237_100181805 867
179 3300010375 Ga0105239_10000012 Ga0105239_10000012163 867
180 3300010375 Ga0105239_10000887 Ga0105239_100008875 867
181 3300010375 Ga0105239_10008895 Ga0105239_100088959 867
182 3300010375 Ga0105239_10034753 Ga0105239_100347532 867
183 3300013306 Ga0163162_10025420 Ga0163162_100254204 867
184 3300013307 Ga0157372_10002015 Ga0157372_1000201516 867
185 3300025231 Ga0207427_100171 Ga0207427_10017112 867
186 3300025233 Ga0209437_100024 Ga0209437_100024503 867
187 3300025233 Ga0209437_100052 Ga0209437_10005293 867
188 3300025261 Ga0209233_1000067 Ga0209233_100006793 867
189 3300025913 Ga0207695_10036926 Ga0207695_100369264 867
190 3300025914 Ga0207671_10005442 Ga0207671_100054422 867
191 3300025914 Ga0207671_10005873 Ga0207671_100058735 867
192 3300025949 Ga0207667_10000375 Ga0207667_1000037543 867
193 3300025949 Ga0207667_10002632 Ga0207667_1000263214 867
194 3300028786 Ga0307517_10022720 Ga0307517_100227205 867
195 3300028794 Ga0307515_10005287 Ga0307515_100052875 867
196 3300028794 Ga0307515_10017194 Ga0307515_100171944 867
197 3300033179 Ga0307507_10002030 Ga0307507_1000203028 867
198 3300033180 Ga0307510_10003612 Ga0307510_100036124 867
199 3300046471 Ga0495650_0000003 Ga0495650_0000003_125615_128218 867
200 3300046492 Ga0495585_0000085 Ga0495585_0000085_27635_30238 867
201 3300046507 Ga0495606_0000145 Ga0495606_0000145_72668_75271 867
202 3300046507 Ga0495606_0011010 Ga0495606_0011010_119_2722 867
203 3300046512 Ga0495610_0001185 Ga0495610_0001185_18777_21380 867
204 3300046558 Ga0495633_0000069 Ga0495633_0000069_127950_130553 867
205 3300046616 Ga0495668_0000003 Ga0495668_0000003_687837_690467 867
206 3300046660 Ga0495625_0000005 Ga0495625_0000005_242625_245228 867
207 3300046660 Ga0495625_0001880 Ga0495625_0001880_14730_17333 867
208 3300046660 Ga0495625_0030259 Ga0495625_0030259_1090_3693 867
209 3300046694 Ga0495649_0000003 Ga0495649_0000003_242647_245250 867
210 3300047443 Ga0495687_000672 Ga0495687_000672_5904_8507 867
211 3300050493 nmdc:mga0k408_342_c1 nmdc:mga0k408_342_c1_9907_12510 867
212 3300053122 Ga0500608_000736 Ga0500608_000736_6807_9425 867
213 3300053125 Ga0500618_000002 Ga0500618_000002_108736_111339 867

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01433

Peptidase_M1

Peptidase family M1 domain

409

605

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mj6-assembly1.cif.gz_A ligand-induced conformational change of insulin-regulated aminopeptidase: insights on catalytic mechanism and active site plasticity. 0.7737 63 638
3se6-assembly2.cif.gz_B crystal structure of the human endoplasmic reticulum aminopeptidase 2 0.762 62 641
7zyf-assembly1.cif.gz_A insulin regulated aminopeptidase (irap) in complex with a nanomolar alpha hydroxy beta amino acid based inhibitor. 0.7599 63 638
1z5h-assembly1.cif.gz_A crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum 0.7595 61 638
4p8q-assembly1.cif.gz_A crystal structure of human insulin regulated aminopeptidase with alanine in active site 0.7501 62 638
ID Description Score Start End Superfamily
af_G5EGH4_402_652_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8008 328 543 1.10.390.10
af_Q22531_292_547_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8005 326 540 1.10.390.10
2dq6A03 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7991 408 553 1.10.390.10
af_Q9UKU6_341_596_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7985 328 552 1.10.390.10
af_Q9VFX0_332_577_1.10.390.10 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7973 343 553 1.10.390.10
ID Description Score Start End GO Terms
AF-A0A6M1Q885-F1-model_v4 deleted 0.9665 572 652
AF-A0A519W4N5-F1-model_v4 M1 family peptidase 0.9645 254 651 GO:0008237
GO:0008270
AF-A0A848QDG2-F1-model_v4 deleted 0.9638 460 650
AF-A0A4Q5R014-F1-model_v4 M1 family peptidase 0.9636 135 650 GO:0008237
GO:0008270
AF-A0A4V1SUQ0-F1-model_v4 M1 family peptidase 0.9636 184 532 GO:0008237
GO:0008270

Feature Viewer

pLDDT pTM Quality
86.55 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map