F323915

General Info

Members Datasets Scaffolds Average Seq Length
213 138 426 203

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100012998|Ga0075428_1000129985
Length 235
Sequence MLSSPTLHVRPQAYDSNSLEYSDTNPLPVLTMKYDFLIDSYQTERLKVLSVWSEFRDDDLALRPKQDDRRGRSVHEHMVHQCMSEDTWFRTMLGIEVGPPLPQHETRLEFIRRYAEDSGRRLERLRQTDENWWEATTTFFDVGRSRAWVMTRRLNHTSHHRGQQMAMLRMLGRELHSTYGPTADTGGLPKNHAPTIYAYDSIDALLEGENRGGMKSSLRDRSALDGIDVTERPES

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
90 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
91 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
97 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
108 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
110 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
123 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
124 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
128 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 1.41
Rhizosphere 96.71
Stem 0
Stem Tuber 0
Unclassified 30.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100012998 3300006844 Bacteria 9255
2 JGI24749J21850_1005694 3300002076 Unclassified 1740
3 JGI24751J29686_10002017 3300002459 Bacteria 4131
4 Ga0058863_11309523 3300004799 Unclassified 931
5 Ga0070676_10249707 3300005328 Bacteria 1183
6 Ga0070683_100201534 3300005329 Bacteria 1890
7 Ga0070670_100008673 3300005331 Bacteria 8677
8 Ga0070666_10055158 3300005335 Bacteria 2682
9 Ga0070689_100034332 3300005340 Bacteria 3870
10 Ga0070689_100086314 3300005340 Unclassified 2468
11 Ga0070675_100013371 3300005354 Bacteria 6451
12 Ga0070675_100085397 3300005354 Bacteria 2637
13 Ga0070675_100101208 3300005354 Unclassified 2427
14 Ga0070671_100028112 3300005355 Unclassified 4630
15 Ga0070671_100106915 3300005355 Unclassified 2349
16 Ga0070674_100142268 3300005356 Bacteria 1801
17 Ga0070688_100080161 3300005365 Bacteria 2111
18 Ga0070709_10395092 3300005434 Bacteria 1031
19 Ga0070714_100007061 3300005435 Bacteria 8705
20 Ga0070713_100004296 3300005436 Bacteria 9547
21 Ga0070713_100010625 3300005436 Bacteria 6658
22 Ga0070711_100025316 3300005439 Bacteria 3881
23 Ga0070711_100171943 3300005439 Unclassified 1652
24 Ga0070705_100233879 3300005440 Bacteria 1280
25 Ga0070705_100297972 3300005440 Bacteria 1154
26 Ga0070700_100042252 3300005441 Bacteria 2798
27 Ga0070700_100050173 3300005441 Bacteria 2594
28 Ga0070700_100155488 3300005441 Bacteria 1569
29 Ga0070700_100512995 3300005441 Unclassified 924
30 Ga0070681_10049442 3300005458 Bacteria 4198
31 Ga0070681_10521006 3300005458 Bacteria 1102
32 Ga0070681_10665080 3300005458 Unclassified 957
33 Ga0070699_100041570 3300005518 Bacteria 3979
34 Ga0070679_100901151 3300005530 Unclassified 828
35 Ga0070697_100011501 3300005536 Bacteria 6918
36 Ga0070686_100077256 3300005544 Bacteria 2195
37 Ga0070695_100240680 3300005545 Bacteria 1312
38 Ga0070664_100030247 3300005564 Unclassified 4517
39 Ga0068857_100103961 3300005577 Bacteria 2550
40 Ga0068854_100813853 3300005578 Bacteria 815
41 Ga0068856_100371028 3300005614 Bacteria 1450
42 Ga0068859_100009414 3300005617 Bacteria 9868
43 Ga0068859_100485022 3300005617 Bacteria 1331
44 Ga0068864_100001821 3300005618 Bacteria 17498
45 Ga0068863_100183906 3300005841 Unclassified 2007
46 Ga0068858_100200111 3300005842 Bacteria 1889
47 Ga0068860_100060361 3300005843 Bacteria 3604
48 Ga0070717_10087683 3300006028 Unclassified 2622
49 Ga0075368_10063766 3300006042 Bacteria 1479
50 Ga0075367_10219050 3300006178 Unclassified 1191
51 Ga0097621_100172761 3300006237 Bacteria 1864
52 Ga0097621_100233216 3300006237 Unclassified 1607
53 Ga0097621_100709513 3300006237 Bacteria 927
54 Ga0068871_100130072 3300006358 Unclassified 2134
55 Ga0068871_100607399 3300006358 Bacteria 995
56 Ga0075428_100002558 3300006844 Bacteria 19750
57 Ga0075430_100003971 3300006846 Bacteria 12470
58 Ga0075431_100002364 3300006847 Bacteria 18119
59 Ga0075431_100020397 3300006847 Bacteria 6772
60 Ga0075431_100057491 3300006847 Bacteria 4012
61 Ga0075434_100077683 3300006871 Unclassified 3315
62 Ga0075434_100853009 3300006871 Bacteria 926
63 Ga0075429_100011259 3300006880 Bacteria 7741
64 Ga0075429_100079228 3300006880 Bacteria 2864
65 Ga0075429_100216387 3300006880 Unclassified 1678
66 Ga0068865_100093920 3300006881 Bacteria 2182
67 Ga0075436_100055682 3300006914 Unclassified 2731
68 Ga0097620_100009415 3300006931 Bacteria 9868
69 Ga0097620_100485001 3300006931 Bacteria 1331
70 Ga0075435_100042741 3300007076 Unclassified 3626
71 Ga0075435_100115868 3300007076 Unclassified 2231
72 Ga0099795_10040026 3300007788 Bacteria 1662
73 Ga0111539_10001215 3300009094 Bacteria 34303
74 Ga0111539_10024457 3300009094 Bacteria 7410
75 Ga0105245_10004884 3300009098 Bacteria 11795
76 Ga0114129_10000532 3300009147 Bacteria 46632
77 Ga0114129_10005934 3300009147 Bacteria 17288
78 Ga0114129_10006469 3300009147 Bacteria 16615
79 Ga0114129_10030537 3300009147 Bacteria 7625
80 Ga0114129_10036733 3300009147 Bacteria 6917
81 Ga0114129_10969167 3300009147 Bacteria 1073
82 Ga0105243_10581668 3300009148 Bacteria 1075
83 Ga0105242_10320082 3300009176 Bacteria 1422
84 Ga0105242_10544325 3300009176 Bacteria 1112
85 Ga0105248_10068143 3300009177 Bacteria 3996
86 Ga0105248_11740869 3300009177 Unclassified 707
87 Ga0105249_10054755 3300009553 Bacteria 3648
88 Ga0105239_10339037 3300010375 Bacteria 1696
89 Ga0157378_10000145 3300013297 Bacteria 66719
90 Ga0157378_10220605 3300013297 Bacteria 1802
91 Ga0157372_10978300 3300013307 Unclassified 980
92 Ga0163163_10000240 3300014325 Bacteria 55940
93 Ga0163163_10269974 3300014325 Bacteria 1752
94 Ga0157376_10291095 3300014969 Bacteria 1542
95 Ga0206354_11407423 3300020081 Unclassified 1150
96 Ga0207680_10059245 3300025903 Bacteria 2325
97 Ga0207647_10082013 3300025904 Bacteria 1932
98 Ga0207645_10327416 3300025907 Unclassified 1023
99 Ga0207707_10210031 3300025912 Unclassified 1696
100 Ga0207663_10045909 3300025916 Bacteria 2689
101 Ga0207663_10133893 3300025916 Bacteria 1717
102 Ga0207663_10270372 3300025916 Bacteria 1259
103 Ga0207681_10056199 3300025923 Unclassified 2684
104 Ga0207681_10619060 3300025923 Bacteria 896
105 Ga0207650_10333989 3300025925 Bacteria 1243
106 Ga0207659_10040819 3300025926 Unclassified 3248
107 Ga0207659_10225929 3300025926 Bacteria 1507
108 Ga0207659_10245974 3300025926 Bacteria 1449
109 Ga0207687_10089270 3300025927 Bacteria 2244
110 Ga0207700_10002661 3300025928 Bacteria 10291
111 Ga0207700_10172364 3300025928 Unclassified 1806
112 Ga0207664_10364771 3300025929 Bacteria 1280
113 Ga0207644_10221647 3300025931 Unclassified 1499
114 Ga0207670_10009112 3300025936 Bacteria 5640
115 Ga0207670_10677098 3300025936 Unclassified 852
116 Ga0207669_10077222 3300025937 Bacteria 2117
117 Ga0207711_10051471 3300025941 Bacteria 3527
118 Ga0207711_10388718 3300025941 Unclassified 1295
119 Ga0207689_10277659 3300025942 Bacteria 1387
120 Ga0207661_10082375 3300025944 Bacteria 2660
121 Ga0207668_10063545 3300025972 Unclassified 2605
122 Ga0207640_10749501 3300025981 Bacteria 842
123 Ga0207703_10013295 3300026035 Bacteria 6412
124 Ga0207708_10014765 3300026075 Bacteria 5845
125 Ga0207708_10037809 3300026075 Bacteria 3677
126 Ga0207641_10054263 3300026088 Bacteria 3400
127 Ga0207641_10171257 3300026088 Unclassified 1982
128 Ga0207641_10606891 3300026088 Bacteria 1072
129 Ga0207676_10022171 3300026095 Bacteria 4670
130 Ga0207676_10242471 3300026095 Unclassified 1618
131 Ga0207676_10819827 3300026095 Unclassified 909
132 Ga0207674_10095002 3300026116 Bacteria 2967
133 Ga0207683_10079432 3300026121 Unclassified 2909
134 Ga0207428_10004712 3300027907 Bacteria 12899
135 Ga0268264_10047512 3300028381 Bacteria 3569
136 Ga0268264_10597197 3300028381 Unclassified 1087
137 Ga0307408_100010475 3300031548 Bacteria 6113
138 Ga0307408_100053289 3300031548 Bacteria 2920
139 Ga0265314_10001157 3300031711 Bacteria 30503
140 Ga0307410_10269011 3300031852 Bacteria 1332
141 Ga0307406_10253973 3300031901 Unclassified 1326
142 Ga0307412_10012768 3300031911 Bacteria 4902
143 Ga0307412_10312524 3300031911 Bacteria 1247
144 Ga0307409_100005583 3300031995 Bacteria 7270
145 Ga0307409_101161113 3300031995 Bacteria 795
146 Ga0307416_100011084 3300032002 Bacteria 5992
147 Ga0373958_0013789 3300034819 Bacteria 1405
148 Ga0373934_0000086 3300035086 Bacteria 32576
149 Ga0373934_0223013 3300035086 Unclassified 778
150 Ga0373923_0125575 3300035111 Unclassified 1150
151 Ga0373941_0061550 3300035115 Unclassified 1223
152 Ga0373954_0057360 3300035118 Unclassified 1834
153 Ga0373954_0198328 3300035118 Unclassified 986
154 Ga0373956_0057485 3300035119 Bacteria 1757
155 Ga0373943_0349661 3300035170 Bacteria 847
156 Ga0373946_0412304 3300035171 Unclassified 683
157 Ga0373955_0210547 3300035172 Unclassified 1159
158 Ga0373931_0261763 3300035691 Unclassified 1055
159 Ga0373931_0521264 3300035691 Bacteria 769
160 Ga0373927_0043425 3300035695 Bacteria 2910
161 Ga0373927_0265024 3300035695 Bacteria 1130
162 Ga0373947_0043063 3300035725 Unclassified 2696
163 Ga0373947_0204176 3300035725 Bacteria 1294
164 Ga0373937_0017018 3300036401 Bacteria 6467
165 Ga0373937_1023168 3300036401 Unclassified 775
166 Ga0373925_0097825 3300037068 Unclassified 2251
167 Ga0373925_0788530 3300037068 Unclassified 783
168 Ga0439464_0017061 3300042439 Bacteria 1965
169 Ga0451577_0401220 3300042876 Bacteria 1244
170 Ga0451577_0790006 3300042876 Bacteria 858
171 Ga0451576_0008327 3300045051 Bacteria 12189
172 Ga0451576_0020474 3300045051 Bacteria 7203
173 Ga0451576_0069724 3300045051 Bacteria 3659
174 Ga0451576_1142934 3300045051 Unclassified 814
175 Ga0495580_0118728 3300046472 Bacteria 1836
176 Ga0495582_0007341 3300046473 Bacteria 6107
177 Ga0495635_0357064 3300046663 Unclassified 974
178 Ga0495659_0041161 3300046664 Unclassified 1649
179 Ga0495659_0045190 3300046664 Bacteria 1586
180 Ga0495588_0338314 3300046674 Bacteria 791
181 Ga0495670_0031207 3300046691 Bacteria 2648
182 Ga0496101_0230026 3300048904 Bacteria 1441
183 Ga0496106_0279359 3300048909 Bacteria 1338
184 Ga0496110_0048068 3300048913 Bacteria 3739
185 Ga0501292_010980 3300049515 Unclassified 1364
186 Ga0501299_000683 3300049522 Bacteria 4056
187 Ga0501042_0651990 3300049578 Unclassified 765
188 Ga0501067_0145548 3300049583 Unclassified 1320
189 Ga0501068_0439613 3300049584 Bacteria 843
190 Ga0501235_025393 3300049669 Unclassified 1325
191 nmdc:mga0k408_242450_c1 3300050493 Bacteria 1076
192 nmdc:mga0k408_47735_c1 3300050493 Bacteria 2475
193 nmdc:mga05p37_1165_c1 3300050507 Bacteria 30287
194 nmdc:mga05p37_164328_c1 3300050507 Unclassified 2710
195 nmdc:mga05p37_20601_c1 3300050507 Bacteria 5746
196 nmdc:mga05p37_24354_c1 3300050507 Bacteria 7355
197 nmdc:mga05p37_4890_c1 3300050507 Bacteria 15684
198 nmdc:mga09592_128754_c1 3300050508 Unclassified 2177
199 nmdc:mga09592_151312_c1 3300050508 Unclassified 2002
200 nmdc:mga09592_30503_c1 3300050508 Bacteria 4487
201 nmdc:mga0qj67_6253_c1 3300050509 Bacteria 8738
202 nmdc:mga06r32_42894_c1 3300050510 Bacteria 4304
203 nmdc:mga06r32_83234_c1 3300050510 Bacteria 3118
204 nmdc:mga08y16_139097_c1 3300050511 Bacteria 2524
205 nmdc:mga08y16_717_c1 3300050511 Bacteria 31525
206 nmdc:mga0n895_242782_c1 3300050512 Unclassified 1828
207 nmdc:mga0n895_691346_c1 3300050512 Bacteria 1017
208 nmdc:mga0rr50_366076_c1 3300050513 Bacteria 1214
209 nmdc:mga0rr50_76980_c1 3300050513 Unclassified 2562
210 nmdc:mga08x19_56528_c1 3300050514 Unclassified 2533
211 nmdc:mga0a205_728805_c1 3300050515 Unclassified 841
212 Ga0495619_0205406 3300053085 Bacteria 1364
213 Ga0495619_0491735 3300053085 Unclassified 844
214 Ga0075428_100012998
215 JGI24749J21850_1005694
216 JGI24751J29686_10002017
217 Ga0058863_11309523
218 Ga0070676_10249707
219 Ga0070683_100201534
220 Ga0070670_100008673
221 Ga0070666_10055158
222 Ga0070689_100034332
223 Ga0070689_100086314
224 Ga0070675_100013371
225 Ga0070675_100085397
226 Ga0070675_100101208
227 Ga0070671_100028112
228 Ga0070671_100106915
229 Ga0070674_100142268
230 Ga0070688_100080161
231 Ga0070709_10395092
232 Ga0070714_100007061
233 Ga0070713_100004296
234 Ga0070713_100010625
235 Ga0070711_100025316
236 Ga0070711_100171943
237 Ga0070705_100233879
238 Ga0070705_100297972
239 Ga0070700_100042252
240 Ga0070700_100050173
241 Ga0070700_100155488
242 Ga0070700_100512995
243 Ga0070681_10049442
244 Ga0070681_10521006
245 Ga0070681_10665080
246 Ga0070699_100041570
247 Ga0070679_100901151
248 Ga0070697_100011501
249 Ga0070686_100077256
250 Ga0070695_100240680
251 Ga0070664_100030247
252 Ga0068857_100103961
253 Ga0068854_100813853
254 Ga0068856_100371028
255 Ga0068859_100009414
256 Ga0068859_100485022
257 Ga0068864_100001821
258 Ga0068863_100183906
259 Ga0068858_100200111
260 Ga0068860_100060361
261 Ga0070717_10087683
262 Ga0075368_10063766
263 Ga0075367_10219050
264 Ga0097621_100172761
265 Ga0097621_100233216
266 Ga0097621_100709513
267 Ga0068871_100130072
268 Ga0068871_100607399
269 Ga0075428_100002558
270 Ga0075430_100003971
271 Ga0075431_100002364
272 Ga0075431_100020397
273 Ga0075431_100057491
274 Ga0075434_100077683
275 Ga0075434_100853009
276 Ga0075429_100011259
277 Ga0075429_100079228
278 Ga0075429_100216387
279 Ga0068865_100093920
280 Ga0075436_100055682
281 Ga0097620_100009415
282 Ga0097620_100485001
283 Ga0075435_100042741
284 Ga0075435_100115868
285 Ga0099795_10040026
286 Ga0111539_10001215
287 Ga0111539_10024457
288 Ga0105245_10004884
289 Ga0114129_10000532
290 Ga0114129_10005934
291 Ga0114129_10006469
292 Ga0114129_10030537
293 Ga0114129_10036733
294 Ga0114129_10969167
295 Ga0105243_10581668
296 Ga0105242_10320082
297 Ga0105242_10544325
298 Ga0105248_10068143
299 Ga0105248_11740869
300 Ga0105249_10054755
301 Ga0105239_10339037
302 Ga0157378_10000145
303 Ga0157378_10220605
304 Ga0157372_10978300
305 Ga0163163_10000240
306 Ga0163163_10269974
307 Ga0157376_10291095
308 Ga0206354_11407423
309 Ga0207680_10059245
310 Ga0207647_10082013
311 Ga0207645_10327416
312 Ga0207707_10210031
313 Ga0207663_10045909
314 Ga0207663_10133893
315 Ga0207663_10270372
316 Ga0207681_10056199
317 Ga0207681_10619060
318 Ga0207650_10333989
319 Ga0207659_10040819
320 Ga0207659_10225929
321 Ga0207659_10245974
322 Ga0207687_10089270
323 Ga0207700_10002661
324 Ga0207700_10172364
325 Ga0207664_10364771
326 Ga0207644_10221647
327 Ga0207670_10009112
328 Ga0207670_10677098
329 Ga0207669_10077222
330 Ga0207711_10051471
331 Ga0207711_10388718
332 Ga0207689_10277659
333 Ga0207661_10082375
334 Ga0207668_10063545
335 Ga0207640_10749501
336 Ga0207703_10013295
337 Ga0207708_10014765
338 Ga0207708_10037809
339 Ga0207641_10054263
340 Ga0207641_10171257
341 Ga0207641_10606891
342 Ga0207676_10022171
343 Ga0207676_10242471
344 Ga0207676_10819827
345 Ga0207674_10095002
346 Ga0207683_10079432
347 Ga0207428_10004712
348 Ga0268264_10047512
349 Ga0268264_10597197
350 Ga0307408_100010475
351 Ga0307408_100053289
352 Ga0265314_10001157
353 Ga0307410_10269011
354 Ga0307406_10253973
355 Ga0307412_10012768
356 Ga0307412_10312524
357 Ga0307409_100005583
358 Ga0307409_101161113
359 Ga0307416_100011084
360 Ga0373958_0013789
361 Ga0373934_0000086
362 Ga0373934_0223013
363 Ga0373923_0125575
364 Ga0373941_0061550
365 Ga0373954_0057360
366 Ga0373954_0198328
367 Ga0373956_0057485
368 Ga0373943_0349661
369 Ga0373946_0412304
370 Ga0373955_0210547
371 Ga0373931_0261763
372 Ga0373931_0521264
373 Ga0373927_0043425
374 Ga0373927_0265024
375 Ga0373947_0043063
376 Ga0373947_0204176
377 Ga0373937_0017018
378 Ga0373937_1023168
379 Ga0373925_0097825
380 Ga0373925_0788530
381 Ga0439464_0017061
382 Ga0451577_0401220
383 Ga0451577_0790006
384 Ga0451576_0008327
385 Ga0451576_0020474
386 Ga0451576_0069724
387 Ga0451576_1142934
388 Ga0495580_0118728
389 Ga0495582_0007341
390 Ga0495635_0357064
391 Ga0495659_0041161
392 Ga0495659_0045190
393 Ga0495588_0338314
394 Ga0495670_0031207
395 Ga0496101_0230026
396 Ga0496106_0279359
397 Ga0496110_0048068
398 Ga0501292_010980
399 Ga0501299_000683
400 Ga0501042_0651990
401 Ga0501067_0145548
402 Ga0501068_0439613
403 Ga0501235_025393
404 nmdc:mga0k408_242450_c1
405 nmdc:mga0k408_47735_c1
406 nmdc:mga05p37_1165_c1
407 nmdc:mga05p37_164328_c1
408 nmdc:mga05p37_20601_c1
409 nmdc:mga05p37_24354_c1
410 nmdc:mga05p37_4890_c1
411 nmdc:mga09592_128754_c1
412 nmdc:mga09592_151312_c1
413 nmdc:mga09592_30503_c1
414 nmdc:mga0qj67_6253_c1
415 nmdc:mga06r32_42894_c1
416 nmdc:mga06r32_83234_c1
417 nmdc:mga08y16_139097_c1
418 nmdc:mga08y16_717_c1
419 nmdc:mga0n895_242782_c1
420 nmdc:mga0n895_691346_c1
421 nmdc:mga0rr50_366076_c1
422 nmdc:mga0rr50_76980_c1
423 nmdc:mga08x19_56528_c1
424 nmdc:mga0a205_728805_c1
425 Ga0495619_0205406
426 Ga0495619_0491735

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05163

DinB

DinB family

31

187

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8742 4 147
3dka-assembly1.cif.gz_A crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.831 6 144
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.8309 4 147
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8211 6 149
3dka-assembly1.cif.gz_B crystal structure of a dinb-like protein (yjoa, bsu12410) from bacillus subtilis at 2.30 a resolution 0.7974 6 150
ID Description Score Start End Superfamily
af_O53773_242_434_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8273 6 136 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8165 6 140 1.20.120.450
3di5A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8142 4 147 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7883 6 140 1.20.120.450
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7793 4 143 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7C2PFA7-F1-model_v4 Damage-inducible protein DinB 1.001 1 127
AF-A0A2V9Z685-F1-model_v4 Damage-inducible protein DinB 0.9922 1 151
AF-A0A7X4AL90-F1-model_v4 Damage-inducible protein DinB 0.9884 3 112
AF-A0A2V9Z685-F1-model_v4 Damage-inducible protein DinB 0.9857 1 151
AF-A0A7C2PFA7-F1-model_v4 Damage-inducible protein DinB 0.9854 1 127

Map