F323814

General Info

Members Datasets Scaffolds Average Seq Length
213 153 426 114

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100902659|Ga0070684_1009026592
Length 111
Sequence MPRAPSPEVLQGTLDLLVLKTVAVEPMHGWGIAQLIQERSEQALAVGQGSLYPALMRLERRGWIAGSWGTTENNRRARYYRLTPLGARHLARETESWRRYIRAVELILGAT

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
136 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
137 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
140 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
141 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
148 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.82
Rhizosphere 88.26
Stem 0
Stem Tuber 0
Unclassified 33.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100902659 3300005535 Bacteria 828
2 MRS1b_contig_506258 2162886011 Unclassified 1368
3 MBSR1b_contig_1145689 2162886012 Unclassified 1365
4 JGI24738J21930_10057822 3300002075 Unclassified 794
5 Ga0065704_10523513 3300005289 Bacteria 652
6 Ga0065712_10145242 3300005290 Unclassified 1412
7 Ga0065715_10041440 3300005293 Unclassified 1159
8 Ga0065715_10195742 3300005293 Unclassified 1323
9 Ga0065707_10093837 3300005295 Bacteria 3574
10 Ga0070683_100450881 3300005329 Bacteria 1227
11 Ga0070682_101082308 3300005337 Unclassified 670
12 Ga0068868_100644442 3300005338 Bacteria 943
13 Ga0070660_100100224 3300005339 Bacteria 2294
14 Ga0070660_100151907 3300005339 Bacteria 1862
15 Ga0070689_100049525 3300005340 Bacteria 3244
16 Ga0070661_100106832 3300005344 Bacteria 2087
17 Ga0070688_100443179 3300005365 Bacteria 969
18 Ga0070659_100178063 3300005366 Unclassified 1744
19 Ga0070713_100020311 3300005436 Bacteria 5090
20 Ga0070713_100510423 3300005436 Bacteria 1135
21 Ga0070713_101166153 3300005436 Unclassified 745
22 Ga0070711_101164546 3300005439 Unclassified 666
23 Ga0070694_100524038 3300005444 Bacteria 946
24 Ga0070663_101418265 3300005455 Bacteria 615
25 Ga0070678_100141576 3300005456 Bacteria 1925
26 Ga0070678_100557534 3300005456 Unclassified 1018
27 Ga0070662_100074503 3300005457 Unclassified 2511
28 Ga0070681_10788254 3300005458 Unclassified 867
29 Ga0070681_11661338 3300005458 Bacteria 565
30 Ga0068867_100948366 3300005459 Unclassified 777
31 Ga0070698_100413837 3300005471 Unclassified 1282
32 Ga0070699_100296028 3300005518 Unclassified 1451
33 Ga0070679_101255972 3300005530 Bacteria 686
34 Ga0070684_100108446 3300005535 Bacteria 2488
35 Ga0068853_100029698 3300005539 Bacteria 4611
36 Ga0070686_101751995 3300005544 Unclassified 528
37 Ga0070696_100569577 3300005546 Bacteria 910
38 Ga0070665_100252529 3300005548 Bacteria 1764
39 Ga0070704_100906518 3300005549 Bacteria 793
40 Ga0068855_100012710 3300005563 Bacteria 10156
41 Ga0068855_100139858 3300005563 Bacteria 2761
42 Ga0068855_100983462 3300005563 Unclassified 887
43 Ga0070664_100322025 3300005564 Bacteria 1401
44 Ga0070664_100804097 3300005564 Bacteria 879
45 Ga0068856_100054478 3300005614 Bacteria 3945
46 Ga0068856_100117100 3300005614 Bacteria 2665
47 Ga0068852_100652811 3300005616 Unclassified 1060
48 Ga0068864_101072609 3300005618 Unclassified 801
49 Ga0068864_101831397 3300005618 Bacteria 612
50 Ga0068858_100442379 3300005842 Unclassified 1252
51 Ga0081455_10014032 3300005937 Bacteria 7873
52 Ga0070717_10027842 3300006028 Bacteria 4519
53 Ga0097621_100349705 3300006237 Bacteria 1314
54 Ga0068871_100834887 3300006358 Unclassified 851
55 Ga0075428_100903013 3300006844 Bacteria 937
56 Ga0075430_100196402 3300006846 Bacteria 1676
57 Ga0075436_100925064 3300006914 Bacteria 653
58 Ga0105240_10002914 3300009093 Bacteria 27000
59 Ga0111539_10000832 3300009094 Bacteria 40096
60 Ga0111539_11567136 3300009094 Bacteria 764
61 Ga0114129_11312999 3300009147 Unclassified 896
62 Ga0114129_12270326 3300009147 Unclassified 652
63 Ga0105243_12051786 3300009148 Unclassified 607
64 Ga0105243_13003890 3300009148 Unclassified 512
65 Ga0105248_11346562 3300009177 Unclassified 808
66 Ga0105237_11311822 3300009545 Unclassified 730
67 Ga0105238_10325025 3300009551 Bacteria 1524
68 Ga0105238_12476299 3300009551 Unclassified 555
69 Ga0105249_11449065 3300009553 Unclassified 759
70 Ga0157373_10298227 3300013100 Bacteria 1144
71 Ga0157373_10840693 3300013100 Unclassified 679
72 Ga0157371_11396764 3300013102 Bacteria 544
73 Ga0157369_10012448 3300013105 Bacteria 9655
74 Ga0157369_10108599 3300013105 Bacteria 2951
75 Ga0157369_10534691 3300013105 Unclassified 1212
76 Ga0157374_10082403 3300013296 Bacteria 3054
77 Ga0157374_10526156 3300013296 Bacteria 1189
78 Ga0157374_10584491 3300013296 Unclassified 1126
79 Ga0157372_10056497 3300013307 Bacteria 4385
80 Ga0157372_11436286 3300013307 Unclassified 795
81 Ga0157372_11915594 3300013307 Unclassified 681
82 Ga0157372_12342345 3300013307 Unclassified 613
83 Ga0163163_12485443 3300014325 Bacteria 576
84 Ga0157376_10286443 3300014969 Bacteria 1554
85 Ga0213873_10264650 3300021358 Unclassified 548
86 Ga0213874_10422367 3300021377 Unclassified 522
87 Ga0213876_10095033 3300021384 Bacteria 1579
88 Ga0213876_10186936 3300021384 Bacteria 1102
89 Ga0213875_10007064 3300021388 Bacteria 5837
90 Ga0213875_10088988 3300021388 Unclassified 1440
91 Ga0213875_10132594 3300021388 Bacteria 1165
92 Ga0213875_10397331 3300021388 Unclassified 657
93 Ga0207688_10916291 3300025901 Unclassified 555
94 Ga0207707_11062231 3300025912 Unclassified 662
95 Ga0207695_10027417 3300025913 Bacteria 6344
96 Ga0207671_11229034 3300025914 Unclassified 585
97 Ga0207693_11130894 3300025915 Unclassified 594
98 Ga0207657_10118285 3300025919 Bacteria 2181
99 Ga0207694_10659238 3300025924 Unclassified 882
100 Ga0207700_10011134 3300025928 Bacteria 5721
101 Ga0207700_10506298 3300025928 Bacteria 1069
102 Ga0207690_10079625 3300025932 Bacteria 2284
103 Ga0207690_10137852 3300025932 Unclassified 1794
104 Ga0207706_10122564 3300025933 Unclassified 2287
105 Ga0207670_10185748 3300025936 Bacteria 1569
106 Ga0207669_10345070 3300025937 Bacteria 1148
107 Ga0207704_10638638 3300025938 Bacteria 876
108 Ga0207661_10441631 3300025944 Bacteria 1184
109 Ga0207679_10296569 3300025945 Bacteria 1392
110 Ga0207667_10012828 3300025949 Bacteria 9629
111 Ga0207667_10858856 3300025949 Unclassified 901
112 Ga0207667_11387385 3300025949 Unclassified 676
113 Ga0207667_11794952 3300025949 Unclassified 578
114 Ga0207640_10886665 3300025981 Bacteria 778
115 Ga0207639_10020366 3300026041 Bacteria 4748
116 Ga0207702_10032190 3300026078 Bacteria 4375
117 Ga0207702_10039306 3300026078 Bacteria 3963
118 Ga0207676_11364894 3300026095 Unclassified 704
119 Ga0207683_10189717 3300026121 Bacteria 1866
120 Ga0207698_10648381 3300026142 Unclassified 1046
121 Ga0209999_1040617 3300027543 Bacteria 871
122 Ga0207428_10007247 3300027907 Bacteria 10139
123 Ga0265338_10792998 3300028800 Bacteria 649
124 Ga0265770_1027954 3300030878 Bacteria 930
125 Ga0265325_10088816 3300031241 Bacteria 1527
126 Ga0265340_10147838 3300031247 Bacteria 1072
127 Ga0265316_10296628 3300031344 Bacteria 1178
128 Ga0265316_10798060 3300031344 Bacteria 662
129 Ga0307408_100560491 3300031548 Bacteria 1009
130 Ga0307408_100639397 3300031548 Bacteria 950
131 Ga0307405_10255492 3300031731 Bacteria 1306
132 Ga0307405_10972954 3300031731 Bacteria 722
133 Ga0307410_10109507 3300031852 Bacteria 1996
134 Ga0307406_10034017 3300031901 Unclassified 3124
135 Ga0307406_10214693 3300031901 Bacteria 1426
136 Ga0307407_10036632 3300031903 Bacteria 2705
137 Ga0307407_11090151 3300031903 Unclassified 620
138 Ga0307407_11526009 3300031903 Bacteria 529
139 Ga0307412_10021766 3300031911 Bacteria 3921
140 Ga0307409_100124733 3300031995 Bacteria 2188
141 Ga0307409_100348806 3300031995 Bacteria 1396
142 Ga0307409_100374198 3300031995 Bacteria 1352
143 Ga0307416_100017850 3300032002 Bacteria 4979
144 Ga0307416_101232103 3300032002 Unclassified 854
145 Ga0307416_101373677 3300032002 Bacteria 812
146 Ga0307411_10224949 3300032005 Unclassified 1458
147 Ga0307415_100039912 3300032126 Bacteria 3106
148 Ga0373953_0125313 3300035117 Bacteria 1093
149 Ga0373955_0674434 3300035172 Unclassified 634
150 Ga0373924_0408852 3300035410 Unclassified 607
151 Ga0373935_0050600 3300035692 Unclassified 2637
152 Ga0373947_0035614 3300035725 Unclassified 2948
153 Ga0373937_0634874 3300036401 Bacteria 1013
154 Ga0436364_0477942 3300037853 Unclassified 1725
155 Ga0436364_0732864 3300037853 Bacteria 772
156 Ga0436364_0839814 3300037853 Bacteria 7229
157 Ga0436364_0973442 3300037853 Bacteria 1367
158 Ga0436364_0982673 3300037853 Bacteria 1052
159 Ga0436364_1370388 3300037853 Unclassified 910
160 Ga0436364_1424769 3300037853 Bacteria 18371
161 Ga0436365_0128350 3300039437 Unclassified 1690
162 Ga0436365_0542915 3300039437 Bacteria 29518
163 Ga0436365_0913468 3300039437 Bacteria 1810
164 Ga0436365_1095498 3300039437 Bacteria 2937
165 Ga0436363_1616760 3300039450 Bacteria 692
166 Ga0436362_1013579 3300039453 Bacteria 5822
167 Ga0439460_0258908 3300042461 Bacteria 603
168 Ga0451577_0914799 3300042876 Bacteria 790
169 Ga0451576_0992762 3300045051 Unclassified 880
170 Ga0466958_0218135 3300045836 Bacteria 1217
171 Ga0495580_0199783 3300046472 Bacteria 1378
172 Ga0495580_0385171 3300046472 Bacteria 947
173 Ga0495580_0793524 3300046472 Unclassified 614
174 Ga0495665_0355878 3300046531 Unclassified 745
175 Ga0495656_0814894 3300046615 Unclassified 505
176 Ga0495647_0082916 3300046681 Bacteria 1303
177 Ga0496105_1321994 3300048908 Bacteria 525
178 Ga0496109_0428986 3300048912 Bacteria 1249
179 Ga0496112_0021698 3300048915 Bacteria 6109
180 Ga0496113_0264998 3300048916 Bacteria 1373
181 Ga0496115_0008868 3300048918 Bacteria 7455
182 Ga0496115_0948447 3300048918 Unclassified 661
183 Ga0501036_0574611 3300049572 Bacteria 936
184 Ga0501038_0173138 3300049574 Bacteria 1746
185 Ga0501040_0144085 3300049576 Bacteria 1679
186 Ga0501040_1094474 3300049576 Bacteria 578
187 Ga0501046_0777329 3300049580 Bacteria 672
188 Ga0501047_0050288 3300049581 Unclassified 4025
189 Ga0501067_0078800 3300049583 Bacteria 1826
190 Ga0501069_0074496 3300049585 Bacteria 1905
191 Ga0501071_0654897 3300049587 Bacteria 808
192 Ga0501076_0109222 3300049592 Bacteria 2235
193 Ga0501227_180095 3300049665 Bacteria 594
194 Ga0501257_097057 3300049686 Bacteria 771
195 Ga0501079_0249809 3300049741 Bacteria 1386
196 Ga0501081_0189147 3300049743 Unclassified 1490
197 Ga0501265_016562 3300049762 Bacteria 957
198 Ga0501266_031122 3300049763 Bacteria 762
199 Ga0501035_0132090 3300049822 Bacteria 2176
200 Ga0501044_0005476 3300049823 Bacteria 14102
201 Ga0501045_0842870 3300049824 Bacteria 674
202 Ga0501045_0931473 3300049824 Bacteria 638
203 nmdc:mga05p37_1263972_c1 3300050507 Unclassified 756
204 nmdc:mga0qj67_290703_c1 3300050509 Bacteria 1324
205 nmdc:mga06r32_21456_c1 3300050510 Bacteria 5961
206 nmdc:mga08y16_229976_c1 3300050511 Bacteria 1918
207 nmdc:mga08y16_726_c1 3300050511 Bacteria 31230
208 Ga0495601_0098836 3300053077 Bacteria 1884
209 Ga0495619_0042782 3300053085 Bacteria 2968
210 Ga0501084_0776294 3300054114 Bacteria 807
211 Ga0501084_1653585 3300054114 Unclassified 535
212 Ga0501082_0051429 3300060353 Bacteria 3551
213 Ga0530510_0265421 3300061734 Bacteria 1281
214 Ga0070684_100902659
215 MRS1b_contig_506258
216 MBSR1b_contig_1145689
217 JGI24738J21930_10057822
218 Ga0065704_10523513
219 Ga0065712_10145242
220 Ga0065715_10041440
221 Ga0065715_10195742
222 Ga0065707_10093837
223 Ga0070683_100450881
224 Ga0070682_101082308
225 Ga0068868_100644442
226 Ga0070660_100100224
227 Ga0070660_100151907
228 Ga0070689_100049525
229 Ga0070661_100106832
230 Ga0070688_100443179
231 Ga0070659_100178063
232 Ga0070713_100020311
233 Ga0070713_100510423
234 Ga0070713_101166153
235 Ga0070711_101164546
236 Ga0070694_100524038
237 Ga0070663_101418265
238 Ga0070678_100141576
239 Ga0070678_100557534
240 Ga0070662_100074503
241 Ga0070681_10788254
242 Ga0070681_11661338
243 Ga0068867_100948366
244 Ga0070698_100413837
245 Ga0070699_100296028
246 Ga0070679_101255972
247 Ga0070684_100108446
248 Ga0068853_100029698
249 Ga0070686_101751995
250 Ga0070696_100569577
251 Ga0070665_100252529
252 Ga0070704_100906518
253 Ga0068855_100012710
254 Ga0068855_100139858
255 Ga0068855_100983462
256 Ga0070664_100322025
257 Ga0070664_100804097
258 Ga0068856_100054478
259 Ga0068856_100117100
260 Ga0068852_100652811
261 Ga0068864_101072609
262 Ga0068864_101831397
263 Ga0068858_100442379
264 Ga0081455_10014032
265 Ga0070717_10027842
266 Ga0097621_100349705
267 Ga0068871_100834887
268 Ga0075428_100903013
269 Ga0075430_100196402
270 Ga0075436_100925064
271 Ga0105240_10002914
272 Ga0111539_10000832
273 Ga0111539_11567136
274 Ga0114129_11312999
275 Ga0114129_12270326
276 Ga0105243_12051786
277 Ga0105243_13003890
278 Ga0105248_11346562
279 Ga0105237_11311822
280 Ga0105238_10325025
281 Ga0105238_12476299
282 Ga0105249_11449065
283 Ga0157373_10298227
284 Ga0157373_10840693
285 Ga0157371_11396764
286 Ga0157369_10012448
287 Ga0157369_10108599
288 Ga0157369_10534691
289 Ga0157374_10082403
290 Ga0157374_10526156
291 Ga0157374_10584491
292 Ga0157372_10056497
293 Ga0157372_11436286
294 Ga0157372_11915594
295 Ga0157372_12342345
296 Ga0163163_12485443
297 Ga0157376_10286443
298 Ga0213873_10264650
299 Ga0213874_10422367
300 Ga0213876_10095033
301 Ga0213876_10186936
302 Ga0213875_10007064
303 Ga0213875_10088988
304 Ga0213875_10132594
305 Ga0213875_10397331
306 Ga0207688_10916291
307 Ga0207707_11062231
308 Ga0207695_10027417
309 Ga0207671_11229034
310 Ga0207693_11130894
311 Ga0207657_10118285
312 Ga0207694_10659238
313 Ga0207700_10011134
314 Ga0207700_10506298
315 Ga0207690_10079625
316 Ga0207690_10137852
317 Ga0207706_10122564
318 Ga0207670_10185748
319 Ga0207669_10345070
320 Ga0207704_10638638
321 Ga0207661_10441631
322 Ga0207679_10296569
323 Ga0207667_10012828
324 Ga0207667_10858856
325 Ga0207667_11387385
326 Ga0207667_11794952
327 Ga0207640_10886665
328 Ga0207639_10020366
329 Ga0207702_10032190
330 Ga0207702_10039306
331 Ga0207676_11364894
332 Ga0207683_10189717
333 Ga0207698_10648381
334 Ga0209999_1040617
335 Ga0207428_10007247
336 Ga0265338_10792998
337 Ga0265770_1027954
338 Ga0265325_10088816
339 Ga0265340_10147838
340 Ga0265316_10296628
341 Ga0265316_10798060
342 Ga0307408_100560491
343 Ga0307408_100639397
344 Ga0307405_10255492
345 Ga0307405_10972954
346 Ga0307410_10109507
347 Ga0307406_10034017
348 Ga0307406_10214693
349 Ga0307407_10036632
350 Ga0307407_11090151
351 Ga0307407_11526009
352 Ga0307412_10021766
353 Ga0307409_100124733
354 Ga0307409_100348806
355 Ga0307409_100374198
356 Ga0307416_100017850
357 Ga0307416_101232103
358 Ga0307416_101373677
359 Ga0307411_10224949
360 Ga0307415_100039912
361 Ga0373953_0125313
362 Ga0373955_0674434
363 Ga0373924_0408852
364 Ga0373935_0050600
365 Ga0373947_0035614
366 Ga0373937_0634874
367 Ga0436364_0477942
368 Ga0436364_0732864
369 Ga0436364_0839814
370 Ga0436364_0973442
371 Ga0436364_0982673
372 Ga0436364_1370388
373 Ga0436364_1424769
374 Ga0436365_0128350
375 Ga0436365_0542915
376 Ga0436365_0913468
377 Ga0436365_1095498
378 Ga0436363_1616760
379 Ga0436362_1013579
380 Ga0439460_0258908
381 Ga0451577_0914799
382 Ga0451576_0992762
383 Ga0466958_0218135
384 Ga0495580_0199783
385 Ga0495580_0385171
386 Ga0495580_0793524
387 Ga0495665_0355878
388 Ga0495656_0814894
389 Ga0495647_0082916
390 Ga0496105_1321994
391 Ga0496109_0428986
392 Ga0496112_0021698
393 Ga0496113_0264998
394 Ga0496115_0008868
395 Ga0496115_0948447
396 Ga0501036_0574611
397 Ga0501038_0173138
398 Ga0501040_0144085
399 Ga0501040_1094474
400 Ga0501046_0777329
401 Ga0501047_0050288
402 Ga0501067_0078800
403 Ga0501069_0074496
404 Ga0501071_0654897
405 Ga0501076_0109222
406 Ga0501227_180095
407 Ga0501257_097057
408 Ga0501079_0249809
409 Ga0501081_0189147
410 Ga0501265_016562
411 Ga0501266_031122
412 Ga0501035_0132090
413 Ga0501044_0005476
414 Ga0501045_0842870
415 Ga0501045_0931473
416 nmdc:mga05p37_1263972_c1
417 nmdc:mga0qj67_290703_c1
418 nmdc:mga06r32_21456_c1
419 nmdc:mga08y16_229976_c1
420 nmdc:mga08y16_726_c1
421 Ga0495601_0098836
422 Ga0495619_0042782
423 Ga0501084_0776294
424 Ga0501084_1653585
425 Ga0501082_0051429
426 Ga0530510_0265421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

18

92

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9523 10 106
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9403 8 109
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9259 9 105
6abq-assembly1.cif.gz_B crystal structure of transcription factor from listeria monocytogenes 0.9214 8 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9156 9 105
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9185 9 100 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9156 9 105 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9079 10 82 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9054 10 81 1.10.10.10
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.896 9 106 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8Z6R2-F1-model_v4 PadR family transcriptional regulator 0.9914 2 113
AF-A0A2V9R0R6-F1-model_v4 PadR family transcriptional regulator 0.9848 16 107
AF-A0A2V8CZR8-F1-model_v4 PadR family transcriptional regulator 0.9819 16 108
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.9818 9 107
AF-A0A2V9PZ38-F1-model_v4 PadR family transcriptional regulator 0.9812 2 113

Map