F323493

General Info

Members Datasets Scaffolds Average Seq Length
212 177 180 307

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2932431166|2932433824
Length 344
Sequence PPTEPAPRGRHATTPSATTEADPPRGGAASRSGTRGTPDAAAKAARSDRSRAEARLGWYLAGPAFVVMLAVTLYPILQAVYDSLFNYKLTAPDDRAFVGLNNYVVILTDSVWWRDLGVTLFITVVTVVIELILGFALALVMHRAIKRLRGLLRTAILVPYGIITVVSAFAWFYAFDITSGYVNHWFDWVPGVGPDLNWFAQQGTSLFVIIASEVWKTTPFISLLLLAGLAQVPGDLEEAAKVDGATAWQRFARVIVPNMKAAIMVAVLFRALDAFRIFDNVFIMTNGANGTEVLSLLAYRTSIGQLQIGMGSAISVLLFLCVVLICFIAIKLFKVDLAGARGEK

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2643221613 Oerskovia sp. Root22 Isolate Unclassified
3 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
4 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
5 2643221721 Oerskovia sp. Root918 Isolate Unclassified
6 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
7 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
8 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
9 2739367653 Kocuria sp. OV113 Isolate Unclassified
10 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
11 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
12 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
13 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
14 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
15 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
16 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
17 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
18 2857727296 Kocuria sp. R-72562 Isolate Unclassified
19 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
20 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
21 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
22 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
23 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
24 2920879853 Kocuria salina CV6 Isolate Unclassified
25 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
26 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
27 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
28 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
29 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
30 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
31 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
32 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
33 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
34 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
97 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
131 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
146 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
154 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
173 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.55
Metatranscriptomes 2.36
Isolates 15.09

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 1.89
Nodule 0
Rhizoplane 4.72
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0007423J48922_100466 3300003285 Bacteria 4610
2 Ga0058863_11779263 3300004799 Bacteria 1535
3 Ga0070683_100090851 3300005329 Bacteria 2867
4 Ga0070689_100404458 3300005340 Bacteria 1154
5 Ga0070668_100129540 3300005347 Bacteria 2024
6 Ga0070668_100269813 3300005347 Bacteria 1418
7 Ga0070674_100032853 3300005356 Bacteria 3449
8 Ga0070709_10002742 3300005434 Bacteria 9529
9 Ga0070714_100130420 3300005435 Bacteria 2246
10 Ga0070710_10029283 3300005437 Bacteria 2953
11 Ga0070711_100010812 3300005439 Bacteria 5658
12 Ga0070705_100021914 3300005440 Bacteria 3406
13 Ga0070708_100079544 3300005445 Bacteria 2966
14 Ga0070681_10006649 3300005458 Bacteria 11255
15 Ga0070698_100170985 3300005471 Bacteria 2114
16 Ga0068855_100303464 3300005563 Bacteria 1768
17 Ga0068856_100074949 3300005614 Bacteria 3351
18 Ga0068856_100142156 3300005614 Bacteria 2407
19 Ga0070702_100000198 3300005615 Bacteria 19583
20 Ga0068866_10230913 3300005718 Bacteria 1122
21 Ga0068861_100147686 3300005719 Bacteria 1926
22 Ga0068861_100203855 3300005719 Bacteria 1662
23 Ga0068860_100310917 3300005843 Bacteria 1545
24 Ga0081538_10002840 3300005981 Bacteria 16561
25 Ga0081538_10093752 3300005981 Bacteria 1540
26 Ga0070717_10005059 3300006028 Bacteria 9611
27 Ga0070717_10329178 3300006028 Bacteria 1362
28 Ga0075365_10071547 3300006038 Bacteria 2335
29 Ga0075364_10039789 3300006051 Bacteria 3048
30 Ga0070712_100004281 3300006175 Bacteria 8788
31 Ga0075428_100366170 3300006844 Bacteria 1546
32 Ga0111539_10245169 3300009094 Bacteria 2086
33 Ga0111539_10360418 3300009094 Bacteria 1692
34 Ga0105243_10034839 3300009148 Bacteria 3901
35 Ga0105243_10054327 3300009148 Bacteria 3180
36 Ga0105242_10026561 3300009176 Bacteria 4590
37 Ga0105242_10131458 3300009176 Bacteria 2161
38 Ga0105242_10159663 3300009176 Bacteria 1972
39 Ga0105237_10033639 3300009545 Bacteria 5195
40 Ga0105237_10219428 3300009545 Bacteria 1902
41 Ga0105237_10363116 3300009545 Bacteria 1452
42 Ga0105239_10044024 3300010375 Bacteria 4894
43 Ga0105246_10175447 3300011119 Bacteria 1645
44 Ga0157369_10130571 3300013105 Bacteria 2663
45 Ga0157369_10187491 3300013105 Bacteria 2175
46 Ga0157369_10228515 3300013105 Bacteria 1946
47 Ga0157378_10021370 3300013297 Bacteria 5691
48 Ga0163162_10249939 3300013306 Bacteria 1905
49 Ga0157372_10068525 3300013307 Bacteria 3989
50 Ga0157375_10072780 3300013308 Bacteria 3454
51 Ga0157375_10336022 3300013308 Bacteria 1676
52 Ga0163163_10182256 3300014325 Bacteria 2147
53 Ga0157380_10048321 3300014326 Bacteria 3351
54 Ga0163161_10050163 3300017792 Bacteria 3020
55 Ga0197907_10928540 3300020069 Bacteria 1922
56 Ga0207688_10088354 3300025901 Bacteria 1777
57 Ga0207647_10026204 3300025904 Bacteria 3817
58 Ga0207699_10007919 3300025906 Bacteria 5214
59 Ga0207707_10031993 3300025912 Bacteria 4605
60 Ga0207693_10003140 3300025915 Bacteria 14204
61 Ga0207687_10121471 3300025927 Bacteria 1954
62 Ga0207687_10291704 3300025927 Bacteria 1311
63 Ga0207700_10103772 3300025928 Bacteria 2273
64 Ga0207664_10003343 3300025929 Bacteria 10662
65 Ga0207686_10214598 3300025934 Bacteria 1386
66 Ga0207709_10018693 3300025935 Bacteria 3887
67 Ga0207669_10020522 3300025937 Bacteria 3468
68 Ga0207667_10043338 3300025949 Bacteria 4776
69 Ga0207712_10073409 3300025961 Bacteria 2467
70 Ga0207639_10471881 3300026041 Bacteria 1142
71 Ga0207678_10075592 3300026067 Bacteria 2885
72 Ga0207708_10038845 3300026075 Bacteria 3626
73 Ga0207702_10012098 3300026078 Bacteria 7178
74 Ga0207702_10025261 3300026078 Bacteria 4929
75 Ga0207648_10158836 3300026089 Bacteria 1996
76 Ga0207648_10310489 3300026089 Bacteria 1415
77 Ga0207675_100079791 3300026118 Bacteria 3067
78 Ga0207675_100148529 3300026118 Bacteria 2230
79 Ga0307408_100064187 3300031548 Bacteria 2689
80 Ga0316578_10029637 3300031728 Bacteria 3107
81 Ga0307405_10010098 3300031731 Bacteria 4873
82 Ga0307413_10033196 3300031824 Bacteria 2935
83 Ga0307413_10042223 3300031824 Bacteria 2678
84 Ga0307410_10036374 3300031852 Bacteria 3206
85 Ga0307406_10041370 3300031901 Bacteria 2871
86 Ga0307407_10046303 3300031903 Bacteria 2462
87 Ga0307412_10042639 3300031911 Bacteria 2950
88 Ga0307412_10324818 3300031911 Bacteria 1226
89 Ga0307409_100035193 3300031995 Bacteria 3666
90 Ga0307416_100084302 3300032002 Bacteria 2700
91 Ga0307416_100086491 3300032002 Bacteria 2672
92 Ga0307416_100218973 3300032002 Bacteria 1824
93 Ga0307414_10017217 3300032004 Bacteria 4416
94 Ga0307411_10081390 3300032005 Bacteria 2230
95 Ga0373933_0036002 3300035724 Bacteria 2894
96 Ga0316582_0034366 3300036647 Bacteria 3122
97 Ga0373925_0198494 3300037068 Bacteria 1595
98 Ga0395899_0246791 3300037312 Bacteria 1227
99 Ga0395898_0067918 3300037466 Bacteria 3451
100 Ga0451791_0467323 3300041451 Bacteria 1467
101 Ga0451791_1420592 3300041451 Bacteria 5853
102 Ga0451800_1426158 3300041459 Bacteria 1847
103 Ga0451853_0179873 3300041512 Bacteria 7000
104 Ga0439457_026474 3300042014 Bacteria 1284
105 Ga0466965_0083498 3300044683 Bacteria 1617
106 Ga0453684_0004928 3300044712 Bacteria 27219
107 Ga0453684_0028886 3300044712 Bacteria 7893
108 Ga0453684_0031881 3300044712 Bacteria 7391
109 Ga0453684_0035251 3300044712 Bacteria 6921
110 Ga0453684_0054566 3300044712 Bacteria 5204
111 Ga0453684_0595739 3300044712 Bacteria 1212
112 Ga0466970_0246335 3300044765 Bacteria 1001
113 Ga0466959_0078599 3300045049 Bacteria 2379
114 Ga0466958_0210931 3300045836 Bacteria 1237
115 Ga0466967_0087496 3300045976 Bacteria 2825
116 Ga0495592_0102043 3300046454 Bacteria 2043
117 Ga0495641_0073811 3300046461 Bacteria 1530
118 Ga0495664_0042869 3300046477 Bacteria 2682
119 Ga0495618_0002861 3300046514 Bacteria 10933
120 Ga0495628_0235447 3300046516 Bacteria 1371
121 Ga0495665_0063220 3300046531 Bacteria 1954
122 Ga0495640_0122444 3300046533 Bacteria 1689
123 Ga0495645_0256829 3300046543 Bacteria 1159
124 Ga0495667_0019978 3300046559 Bacteria 4517
125 Ga0495599_0113443 3300046678 Bacteria 1687
126 Ga0495623_0015808 3300046679 Bacteria 4878
127 Ga0495646_0003087 3300046680 Bacteria 10334
128 Ga0495658_0089864 3300046683 Bacteria 1817
129 Ga0495581_0155137 3300047315 Bacteria 1338
130 Ga0495674_0019379 3300047319 Bacteria 6314
131 Ga0495676_0152371 3300047321 Bacteria 1644
132 Ga0495680_0018876 3300047322 Bacteria 5840
133 Ga0495684_0020697 3300047471 Bacteria 5069
134 Ga0495593_0040464 3300047673 Bacteria 2510
135 Ga0495602_0008806 3300048088 Bacteria 10525
136 Ga0496102_0000722 3300048905 Bacteria 32596
137 Ga0496103_0013295 3300048906 Bacteria 4879
138 Ga0496104_0106542 3300048907 Bacteria 2686
139 Ga0496105_0140117 3300048908 Bacteria 1991
140 Ga0496109_0295024 3300048912 Bacteria 1529
141 Ga0496111_0163787 3300048914 Bacteria 1652
142 Ga0496114_0146408 3300048917 Bacteria 2048
143 Ga0496121_0114908 3300048924 Bacteria 2045
144 Ga0496122_0000832 3300048925 Bacteria 58580
145 Ga0496123_0000673 3300048926 Bacteria 56422
146 Ga0496124_0000370 3300048927 Bacteria 82276
147 Ga0496125_0000913 3300048928 Bacteria 46575
148 Ga0496126_0029673 3300048929 Bacteria 5192
149 Ga0496126_0053681 3300048929 Bacteria 3655
150 Ga0496126_0203077 3300048929 Bacteria 1672
151 Ga0496126_0555138 3300048929 Bacteria 911
152 Ga0501291_003070 3300049514 Bacteria 2057
153 Ga0501031_0008877 3300049568 Bacteria 6535
154 Ga0501031_0038087 3300049568 Bacteria 3139
155 Ga0501031_0091439 3300049568 Bacteria 1985
156 Ga0501036_0283499 3300049572 Bacteria 1386
157 Ga0501038_0031992 3300049574 Bacteria 4645
158 Ga0501038_0148980 3300049574 Bacteria 1909
159 Ga0501039_0107134 3300049575 Bacteria 2183
160 Ga0501040_0217731 3300049576 Bacteria 1358
161 Ga0501043_0035584 3300049579 Bacteria 3917
162 Ga0501046_0019605 3300049580 Bacteria 5608
163 Ga0501047_0127312 3300049581 Bacteria 2427
164 Ga0501048_0093179 3300049582 Bacteria 2125
165 Ga0501068_0106842 3300049584 Bacteria 1738
166 Ga0501071_0022591 3300049587 Bacteria 4386
167 Ga0501076_0152025 3300049592 Bacteria 1883
168 Ga0501083_0005217 3300049744 Bacteria 9194
169 Ga0501035_0013493 3300049822 Bacteria 7541
170 Ga0501044_0009532 3300049823 Bacteria 10573
171 Ga0501044_0033642 3300049823 Bacteria 5384
172 Ga0501045_0058356 3300049824 Bacteria 2826
173 nmdc:mga00v17_53718_c1 3300050491 Bacteria 2456
174 nmdc:mga0yw44_102695_c1 3300050492 Bacteria 1823
175 nmdc:mga08y16_205421_c1 3300050511 Bacteria 2041
176 Ga0495595_0001546 3300053084 Bacteria 8976
177 Ga0501084_0041466 3300054114 Bacteria 3851
178 Ga0587076_003449 3300059645 Bacteria 1886
179 Ga0587079_008129 3300059647 Bacteria 1593
180 Ga0501082_0009605 3300060353 Bacteria 8326

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_0595739 Ga0453684_0595739_174_989 250
2 3300044712 Ga0453684_0028886 Ga0453684_0028886_5563_6378 260
3 3300044712 Ga0453684_0054566 Ga0453684_0054566_2659_3513 262
4 3300049584 Ga0501068_0106842 Ga0501068_0106842_21_872 264
5 3300046516 Ga0495628_0235447 Ga0495628_0235447_531_1361 265
6 3300005718 Ga0068866_10230913 Ga0068866_102309131 266
7 3300005843 Ga0068860_100310917 Ga0068860_1003109172 266
8 3300013297 Ga0157378_10021370 Ga0157378_100213703 266
9 3300014326 Ga0157380_10048321 Ga0157380_100483212 266
10 3300025935 Ga0207709_10018693 Ga0207709_100186932 266
11 3300025937 Ga0207669_10020522 Ga0207669_100205223 266
12 3300026089 Ga0207648_10158836 Ga0207648_101588363 266
13 3300026089 Ga0207648_10310489 Ga0207648_103104892 266
14 3300046531 Ga0495665_0063220 Ga0495665_0063220_801_1736 266
15 3300048929 Ga0496126_0555138 Ga0496126_0555138_10_843 266
16 3300005347 Ga0070668_100269813 Ga0070668_1002698132 267
17 3300005719 Ga0068861_100147686 Ga0068861_1001476862 267
18 3300017792 Ga0163161_10050163 Ga0163161_100501632 267
19 3300025961 Ga0207712_10073409 Ga0207712_100734092 267
20 3300026118 Ga0207675_100079791 Ga0207675_1000797913 267
21 3300006028 Ga0070717_10329178 Ga0070717_103291782 268
22 3300037312 Ga0395899_0246791 Ga0395899_0246791_108_1073 268
23 3300037466 Ga0395898_0067918 Ga0395898_0067918_325_1290 268
24 3300048908 Ga0496105_0140117 Ga0496105_0140117_869_1804 268
25 3300044712 Ga0453684_0031881 Ga0453684_0031881_6450_7325 269
26 3300045836 Ga0466958_0210931 Ga0466958_0210931_300_1142 269
27 3300044712 Ga0453684_0004928 Ga0453684_0004928_17583_18461 270
28 iso_pu_bacteria 2857720070 2857720928 270
29 iso_pu_bacteria 2928090899 2928092727 270
30 3300044712 Ga0453684_0035251 Ga0453684_0035251_2185_3120 271
31 3300045976 Ga0466967_0087496 Ga0466967_0087496_202_1074 273
32 3300031824 Ga0307413_10042223 Ga0307413_100422232 274
33 3300006038 Ga0075365_10071547 Ga0075365_100715472 276
34 3300013105 Ga0157369_10228515 Ga0157369_102285152 276
35 3300041459 Ga0451800_1426158 Ga0451800_1426158_683_1627 276
36 3300041512 Ga0451853_0179873 Ga0451853_0179873_1316_2260 276
37 3300050492 nmdc:mga0yw44_102695_c1 nmdc:mga0yw44_102695_c1_205_1143 276
38 3300005347 Ga0070668_100129540 Ga0070668_1001295401 279
39 3300005356 Ga0070674_100032853 Ga0070674_1000328533 279
40 3300005440 Ga0070705_100021914 Ga0070705_1000219143 279
41 3300005615 Ga0070702_100000198 Ga0070702_10000019818 279
42 3300009148 Ga0105243_10034839 Ga0105243_100348393 279
43 3300009176 Ga0105242_10026561 Ga0105242_100265614 279
44 3300013306 Ga0163162_10249939 Ga0163162_102499392 279
45 3300013308 Ga0157375_10072780 Ga0157375_100727803 279
46 3300005458 Ga0070681_10006649 Ga0070681_1000664910 280
47 3300025912 Ga0207707_10031993 Ga0207707_100319934 280
48 3300031728 Ga0316578_10029637 Ga0316578_100296372 280
49 3300036647 Ga0316582_0034366 Ga0316582_0034366_263_1138 280
50 3300049514 Ga0501291_003070 Ga0501291_003070_466_1413 280
51 3300049574 Ga0501038_0031992 Ga0501038_0031992_79_954 280
52 3300049579 Ga0501043_0035584 Ga0501043_0035584_2256_3131 280
53 3300049582 Ga0501048_0093179 Ga0501048_0093179_328_1203 280
54 3300045049 Ga0466959_0078599 Ga0466959_0078599_285_1184 281
55 3300048905 Ga0496102_0000722 Ga0496102_0000722_16897_17862 281
56 3300048906 Ga0496103_0013295 Ga0496103_0013295_1372_2337 281
57 3300048929 Ga0496126_0203077 Ga0496126_0203077_42_1007 281
58 3300004799 Ga0058863_11779263 Ga0058863_117792632 282
59 3300046477 Ga0495664_0042869 Ga0495664_0042869_850_1818 282
60 3300013307 Ga0157372_10068525 Ga0157372_100685253 283
61 3300049823 Ga0501044_0009532 Ga0501044_0009532_4752_5729 284
62 3300048929 Ga0496126_0029673 Ga0496126_0029673_1134_2189 285
63 3300009094 Ga0111539_10360418 Ga0111539_103604181 286
64 3300009545 Ga0105237_10363116 Ga0105237_103631162 286
65 3300025927 Ga0207687_10121471 Ga0207687_101214712 286
66 3300048924 Ga0496121_0114908 Ga0496121_0114908_1119_2018 286
67 3300049568 Ga0501031_0038087 Ga0501031_0038087_1081_2037 286
68 3300049574 Ga0501038_0148980 Ga0501038_0148980_828_1784 286
69 3300049587 Ga0501071_0022591 Ga0501071_0022591_2407_3363 286
70 3300049592 Ga0501076_0152025 Ga0501076_0152025_424_1380 286
71 3300049824 Ga0501045_0058356 Ga0501045_0058356_916_1872 286
72 3300005434 Ga0070709_10002742 Ga0070709_100027422 287
73 3300005435 Ga0070714_100130420 Ga0070714_1001304202 287
74 3300005437 Ga0070710_10029283 Ga0070710_100292831 287
75 3300005439 Ga0070711_100010812 Ga0070711_1000108127 287
76 3300005981 Ga0081538_10093752 Ga0081538_100937522 287
77 3300006028 Ga0070717_10005059 Ga0070717_100050597 287
78 3300006175 Ga0070712_100004281 Ga0070712_1000042817 287
79 3300025906 Ga0207699_10007919 Ga0207699_100079192 287
80 3300025915 Ga0207693_10003140 Ga0207693_100031402 287
81 3300025928 Ga0207700_10103772 Ga0207700_101037722 287
82 3300025929 Ga0207664_10003343 Ga0207664_1000334311 287
83 3300031548 Ga0307408_100064187 Ga0307408_1000641873 287
84 3300031731 Ga0307405_10010098 Ga0307405_100100982 287
85 3300031824 Ga0307413_10033196 Ga0307413_100331962 287
86 3300031901 Ga0307406_10041370 Ga0307406_100413702 287
87 3300031903 Ga0307407_10046303 Ga0307407_100463032 287
88 3300031911 Ga0307412_10042639 Ga0307412_100426393 287
89 3300031995 Ga0307409_100035193 Ga0307409_1000351933 287
90 3300032002 Ga0307416_100086491 Ga0307416_1000864912 287
91 3300032004 Ga0307414_10017217 Ga0307414_100172172 287
92 3300035724 Ga0373933_0036002 Ga0373933_0036002_461_1396 287
93 3300037068 Ga0373925_0198494 Ga0373925_0198494_390_1325 287
94 3300046454 Ga0495592_0102043 Ga0495592_0102043_1081_2016 287
95 3300046514 Ga0495618_0002861 Ga0495618_0002861_8471_9406 287
96 3300046533 Ga0495640_0122444 Ga0495640_0122444_181_1116 287
97 3300046543 Ga0495645_0256829 Ga0495645_0256829_157_1092 287
98 3300046559 Ga0495667_0019978 Ga0495667_0019978_340_1275 287
99 3300046678 Ga0495599_0113443 Ga0495599_0113443_86_1021 287
100 3300046679 Ga0495623_0015808 Ga0495623_0015808_3676_4611 287
101 3300046680 Ga0495646_0003087 Ga0495646_0003087_4873_5808 287
102 3300047315 Ga0495581_0155137 Ga0495581_0155137_362_1297 287
103 3300047319 Ga0495674_0019379 Ga0495674_0019379_3791_4726 287
104 3300047322 Ga0495680_0018876 Ga0495680_0018876_2919_3854 287
105 3300047471 Ga0495684_0020697 Ga0495684_0020697_645_1580 287
106 3300047673 Ga0495593_0040464 Ga0495593_0040464_1317_2252 287
107 3300048088 Ga0495602_0008806 Ga0495602_0008806_7143_8078 287
108 3300048907 Ga0496104_0106542 Ga0496104_0106542_792_1727 287
109 3300048912 Ga0496109_0295024 Ga0496109_0295024_417_1352 287
110 3300053084 Ga0495595_0001546 Ga0495595_0001546_3477_4412 287
111 3300005329 Ga0070683_100090851 Ga0070683_1000908513 288
112 3300005471 Ga0070698_100170985 Ga0070698_1001709851 288
113 iso_pu_bacteria 2675903059 2676482232 288
114 3300005340 Ga0070689_100404458 Ga0070689_1004044581 289
115 3300005719 Ga0068861_100203855 Ga0068861_1002038552 289
116 3300006844 Ga0075428_100366170 Ga0075428_1003661702 289
117 3300009094 Ga0111539_10245169 Ga0111539_102451692 289
118 3300026075 Ga0207708_10038845 Ga0207708_100388454 289
119 3300026118 Ga0207675_100148529 Ga0207675_1001485292 289
120 3300031911 Ga0307412_10324818 Ga0307412_103248182 289
121 3300049568 Ga0501031_0091439 Ga0501031_0091439_467_1411 289
122 3300049572 Ga0501036_0283499 Ga0501036_0283499_340_1284 289
123 3300049575 Ga0501039_0107134 Ga0501039_0107134_441_1385 289
124 3300049576 Ga0501040_0217731 Ga0501040_0217731_74_1018 289
125 3300049581 Ga0501047_0127312 Ga0501047_0127312_127_1053 289
126 3300050511 nmdc:mga08y16_205421_c1 nmdc:mga08y16_205421_c1_66_995 289
127 iso_pu_bacteria 2893684298 2893685387 289
128 3300009148 Ga0105243_10054327 Ga0105243_100543272 290
129 3300005445 Ga0070708_100079544 Ga0070708_1000795443 291
130 3300005981 Ga0081538_10002840 Ga0081538_1000284011 291
131 3300032002 Ga0307416_100084302 Ga0307416_1000843023 291
132 3300042014 Ga0439457_026474 Ga0439457_026474_15_953 291
133 iso_pu_bacteria 2857710386 2857711138 291
134 3300009176 Ga0105242_10131458 Ga0105242_101314582 292
135 3300009176 Ga0105242_10159663 Ga0105242_101596633 292
136 3300011119 Ga0105246_10175447 Ga0105246_101754472 292
137 3300013105 Ga0157369_10187491 Ga0157369_101874913 292
138 3300014325 Ga0163163_10182256 Ga0163163_101822562 292
139 3300025901 Ga0207688_10088354 Ga0207688_100883542 292
140 3300025927 Ga0207687_10291704 Ga0207687_102917042 292
141 3300025934 Ga0207686_10214598 Ga0207686_102145982 292
142 3300041451 Ga0451791_1420592 Ga0451791_1420592_2888_3883 292
143 3300046461 Ga0495641_0073811 Ga0495641_0073811_453_1403 292
144 3300046683 Ga0495658_0089864 Ga0495658_0089864_100_1050 292
145 3300047321 Ga0495676_0152371 Ga0495676_0152371_680_1630 292
146 3300048917 Ga0496114_0146408 Ga0496114_0146408_74_1024 292
147 iso_pu_bacteria 2728369276 2729907089 292
148 3300044765 Ga0466970_0246335 Ga0466970_0246335_38_982 293
149 3300048929 Ga0496126_0053681 Ga0496126_0053681_36_1007 293
150 iso_pu_bacteria 2839986021 2839988161 293
151 iso_pu_bacteria 3001889506 3001890635 293
152 3300005563 Ga0068855_100303464 Ga0068855_1003034642 294
153 iso_pu_bacteria 2784132109 2784471506 294
154 3300005614 Ga0068856_100074949 Ga0068856_1000749492 295
155 3300009545 Ga0105237_10033639 Ga0105237_100336393 295
156 3300020069 Ga0197907_10928540 Ga0197907_109285403 295
157 3300025904 Ga0207647_10026204 Ga0207647_100262044 295
158 3300025949 Ga0207667_10043338 Ga0207667_100433382 295
159 3300026041 Ga0207639_10471881 Ga0207639_104718812 295
160 3300026078 Ga0207702_10012098 Ga0207702_100120985 295
161 3300048925 Ga0496122_0000832 Ga0496122_0000832_33285_34244 295
162 3300048926 Ga0496123_0000673 Ga0496123_0000673_39806_40765 295
163 3300048927 Ga0496124_0000370 Ga0496124_0000370_71238_72197 295
164 3300059645 Ga0587076_003449 Ga0587076_003449_767_1735 295
165 3300059647 Ga0587079_008129 Ga0587079_008129_536_1504 295
166 iso_pu_bacteria 2884994152 2884994393 295
167 iso_pu_bacteria 2920879853 2920881602 295
168 iso_pu_bacteria 2984580707 2984583724 295
169 3300031852 Ga0307410_10036374 Ga0307410_100363743 296
170 3300032005 Ga0307411_10081390 Ga0307411_100813902 296
171 3300044683 Ga0466965_0083498 Ga0466965_0083498_181_1131 296
172 iso_pu_bacteria 2537561592 2537899786 296
173 iso_pu_bacteria 2643221613 2644084699 296
174 iso_pu_bacteria 2643221690 2644505075 296
175 iso_pu_bacteria 2643221694 2644527401 296
176 iso_pu_bacteria 2643221721 2644667311 296
177 iso_pu_bacteria 2643221722 2644667534 296
178 iso_pu_bacteria 2857479173 2857480966 296
179 iso_pu_bacteria 2857632687 2857634500 296
180 iso_pu_bacteria 2870801768 2870803271 296
181 iso_pu_bacteria 2870804320 2870805313 296
182 iso_pu_bacteria 2932431166 2932433824 296
183 3300006051 Ga0075364_10039789 Ga0075364_100397892 297
184 3300050491 nmdc:mga00v17_53718_c1 nmdc:mga00v17_53718_c1_1174_2157 297
185 iso_pu_bacteria 2974294766 2974296280 297
186 iso_pu_bacteria 2974324384 2974327486 297
187 3300049568 Ga0501031_0008877 Ga0501031_0008877_3318_4280 298
188 3300049580 Ga0501046_0019605 Ga0501046_0019605_3066_4028 298
189 3300049744 Ga0501083_0005217 Ga0501083_0005217_7365_8327 298
190 3300049822 Ga0501035_0013493 Ga0501035_0013493_4583_5545 298
191 3300049823 Ga0501044_0033642 Ga0501044_0033642_2188_3150 298
192 3300054114 Ga0501084_0041466 Ga0501084_0041466_1402_2364 298
193 3300060353 Ga0501082_0009605 Ga0501082_0009605_2216_3178 298
194 iso_pu_bacteria 2739367653 2739603204 298
195 iso_pu_bacteria 2808606700 2810364970 298
196 iso_pu_bacteria 2816332305 2817508265 298
197 iso_pu_bacteria 2857727296 2857729174 298
198 iso_pu_bacteria 2905926851 2905928849 298
199 iso_pu_bacteria 2946003308 2946006016 298
200 3300013105 Ga0157369_10130571 Ga0157369_101305713 299
201 iso_pu_bacteria 2935890801 2935892514 299
202 3300048928 Ga0496125_0000913 Ga0496125_0000913_42149_43120 300
203 3300005614 Ga0068856_100142156 Ga0068856_1001421562 302
204 3300009545 Ga0105237_10219428 Ga0105237_102194282 302
205 3300010375 Ga0105239_10044024 Ga0105239_100440242 302
206 3300026078 Ga0207702_10025261 Ga0207702_100252612 302
207 3300013308 Ga0157375_10336022 Ga0157375_103360222 305
208 3300003285 Ga0007423J48922_100466 Ga0007423J48922_1004662 306
209 3300026067 Ga0207678_10075592 Ga0207678_100755923 306
210 3300032002 Ga0307416_100218973 Ga0307416_1002189732 306
211 3300041451 Ga0451791_0467323 Ga0451791_0467323_140_1135 306
212 3300048914 Ga0496111_0163787 Ga0496111_0163787_178_1173 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

130

335

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.6567 57 288
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6314 65 294
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.5987 24 301
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.5966 24 294
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.5858 94 296
ID Description Score Start End Superfamily
af_P33359_41_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.843 170 296 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7406 172 296 1.10.3720.10
af_P0DP70_1_121_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7255 172 296 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7247 69 296 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.714 69 296 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2S8MNW2-F1-model_v4 deleted 0.9448 187 306
AF-A9WNW0-F1-model_v4 ABC transporter sugar permease 0.934 127 296 GO:0005886
GO:0055085
AF-A0A528ITX9-F1-model_v4 Sugar ABC transporter permease 0.9331 128 296 GO:0005886
GO:0055085
AF-A0A0P9ES80-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9324 127 299 GO:0005886
GO:0055085
AF-H0K831-F1-model_v4 deleted 0.9317 127 298

Feature Viewer

pLDDT pTM Quality
70.31 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map