F323109

General Info

Members Datasets Scaffolds Average Seq Length
212 102 424 179

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0711168|Ga0436365_0711168_508_1083
Length 191
Sequence VQSRPVGTLGTLRERILLSAQQIDRVIARIAHQVLEPEDAQSGLVLLGIRRGGEMLARRIAEKVQAISDAAPALGFLNVNLYRDDDVARALPDSEIHENLTGRVVVVVDDVLYTGRTVRSALDAVTDLGRPRAVRLAVLIDRGLRELPIQGDYVGRVIPTSAQERIEVMLSRRFSADDRVVLRSADDDARA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
3 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
13 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
24 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
25 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
26 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
27 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
30 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
31 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
32 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
35 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
50 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
51 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
52 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
56 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
68 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
71 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 3.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 83.02
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0711168 3300039437 Unclassified 1386
2 Ga0070691_10004077 3300005341 Bacteria 6624
3 Ga0070661_100077197 3300005344 Bacteria 2455
4 Ga0070661_101368836 3300005344 Bacteria 595
5 Ga0070709_10160133 3300005434 Bacteria 1564
6 Ga0070714_100000389 3300005435 Bacteria 32725
7 Ga0070714_100014726 3300005435 Bacteria 6285
8 Ga0070714_100178706 3300005435 Bacteria 1930
9 Ga0070714_100594909 3300005435 Unclassified 1062
10 Ga0070713_100048915 3300005436 Bacteria 3485
11 Ga0070713_100126322 3300005436 Bacteria 2250
12 Ga0070713_100627737 3300005436 Unclassified 1022
13 Ga0070663_100030520 3300005455 Bacteria 3695
14 Ga0070679_100379208 3300005530 Bacteria 1361
15 Ga0068855_100000448 3300005563 Bacteria 50961
16 Ga0068855_100028905 3300005563 Bacteria 6633
17 Ga0068854_100000018 3300005578 Bacteria 136417
18 Ga0068856_100012735 3300005614 Bacteria 8142
19 Ga0068852_100320886 3300005616 Bacteria 1504
20 Ga0068852_100665856 3300005616 Bacteria 1049
21 Ga0068859_100070989 3300005617 Unclassified 3518
22 Ga0068860_101256076 3300005843 Bacteria 761
23 Ga0068862_100593768 3300005844 Bacteria 1062
24 Ga0070717_10130604 3300006028 Bacteria 2160
25 Ga0070717_10233191 3300006028 Bacteria 1621
26 Ga0070716_100222574 3300006173 Bacteria 1269
27 Ga0097620_100070988 3300006931 Unclassified 3518
28 Ga0105240_10100368 3300009093 Bacteria 3522
29 Ga0105240_10157096 3300009093 Bacteria 2704
30 Ga0114129_10235382 3300009147 Bacteria 2464
31 Ga0157369_10362272 3300013105 Bacteria 1505
32 Ga0157374_10099203 3300013296 Bacteria 2789
33 Ga0157378_10460663 3300013297 Bacteria 1263
34 Ga0163162_10542738 3300013306 Bacteria 1291
35 Ga0206356_11644647 3300020070 Bacteria 4479
36 Ga0206352_10330809 3300020078 Bacteria 1862
37 Ga0206354_10159059 3300020081 Bacteria 1956
38 Ga0206353_10548498 3300020082 Bacteria 1242
39 Ga0213873_10001290 3300021358 Bacteria 4123
40 Ga0213873_10019947 3300021358 Bacteria 1561
41 Ga0213873_10036237 3300021358 Bacteria 1251
42 Ga0213873_10036524 3300021358 Bacteria 1247
43 Ga0213873_10114298 3300021358 Unclassified 787
44 Ga0213872_10006509 3300021361 Bacteria 5849
45 Ga0213872_10013124 3300021361 Bacteria 3884
46 Ga0213872_10124216 3300021361 Bacteria 1140
47 Ga0213874_10015115 3300021377 Bacteria 2030
48 Ga0213876_10006230 3300021384 Bacteria 6506
49 Ga0213876_10016295 3300021384 Bacteria 3928
50 Ga0213876_10123228 3300021384 Bacteria 1377
51 Ga0213876_10146474 3300021384 Unclassified 1256
52 Ga0213875_10000001 3300021388 Bacteria 2793540
53 Ga0213875_10009104 3300021388 Bacteria 5045
54 Ga0213875_10013196 3300021388 Bacteria 4062
55 Ga0213871_10002407 3300021441 Bacteria 3432
56 Ga0213871_10006367 3300021441 Bacteria 2494
57 Ga0213871_10024904 3300021441 Bacteria 1520
58 Ga0213871_10052875 3300021441 Unclassified 1117
59 Ga0213871_10059799 3300021441 Bacteria 1059
60 Ga0207699_10117516 3300025906 Bacteria 1714
61 Ga0207695_10386461 3300025913 Bacteria 1285
62 Ga0207693_10077369 3300025915 Bacteria 2605
63 Ga0207663_10121004 3300025916 Bacteria 1793
64 Ga0207649_11219691 3300025920 Bacteria 595
65 Ga0207700_10010070 3300025928 Bacteria 5943
66 Ga0207700_10283864 3300025928 Bacteria 1425
67 Ga0207700_10288804 3300025928 Bacteria 1413
68 Ga0207664_10000411 3300025929 Bacteria 30634
69 Ga0207664_10003929 3300025929 Bacteria 9991
70 Ga0207664_10052296 3300025929 Bacteria 3230
71 Ga0207664_10111634 3300025929 Bacteria 2275
72 Ga0207664_10293492 3300025929 Bacteria 1429
73 Ga0207664_10564356 3300025929 Unclassified 1022
74 Ga0207667_10000086 3300025949 Bacteria 150941
75 Ga0207667_10033994 3300025949 Bacteria 5477
76 Ga0207640_10000027 3300025981 Bacteria 137684
77 Ga0207678_10040247 3300026067 Bacteria 4055
78 Ga0207702_10192265 3300026078 Bacteria 1886
79 Ga0207648_10393705 3300026089 Bacteria 1254
80 Ga0207698_10113754 3300026142 Bacteria 2275
81 Ga0207698_10551179 3300026142 Bacteria 1130
82 Ga0209966_1055752 3300027695 Bacteria 847
83 Ga0265356_1000069 3300028017 Bacteria 16891
84 Ga0265334_10027176 3300028573 Bacteria 2306
85 Ga0265338_10000370 3300028800 Bacteria 80574
86 Ga0265338_10104511 3300028800 Bacteria 2298
87 Ga0265762_1012370 3300030760 Unclassified 1530
88 Ga0265762_1040505 3300030760 Bacteria 911
89 Ga0265770_1041474 3300030878 Bacteria 806
90 Ga0265760_10000722 3300031090 Bacteria 9412
91 Ga0265325_10002819 3300031241 Bacteria 11597
92 Ga0265329_10118176 3300031242 Bacteria 849
93 Ga0265340_10031066 3300031247 Bacteria 2673
94 Ga0265339_10007624 3300031249 Bacteria 6974
95 Ga0265327_10144942 3300031251 Bacteria 1107
96 Ga0265316_10014172 3300031344 Bacteria 7032
97 Ga0265313_10008009 3300031595 Bacteria 7091
98 Ga0265342_10001589 3300031712 Bacteria 20970
99 Ga0373926_0100397 3300035083 Bacteria 1082
100 Ga0373934_0057383 3300035086 Bacteria 1549
101 Ga0373923_0048087 3300035111 Bacteria 1780
102 Ga0373923_0289534 3300035111 Bacteria 773
103 Ga0373945_0148376 3300035116 Bacteria 949
104 Ga0373953_0087072 3300035117 Bacteria 1304
105 Ga0373953_0265546 3300035117 Bacteria 747
106 Ga0373954_0045972 3300035118 Bacteria 2040
107 Ga0373956_0101966 3300035119 Bacteria 1332
108 Ga0373943_0339586 3300035170 Bacteria 859
109 Ga0373924_0180891 3300035410 Bacteria 928
110 Ga0373935_0147668 3300035692 Bacteria 1593
111 Ga0373927_0022290 3300035695 Bacteria 4149
112 Ga0373927_0030333 3300035695 Bacteria 3528
113 Ga0373927_0408275 3300035695 Bacteria 896
114 Ga0373933_0018164 3300035724 Bacteria 3952
115 Ga0373947_0029278 3300035725 Bacteria 3231
116 Ga0373947_0078697 3300035725 Bacteria 2036
117 Ga0373947_0220020 3300035725 Bacteria 1248
118 Ga0373937_0009610 3300036401 Bacteria 8419
119 Ga0373937_0114164 3300036401 Bacteria 2514
120 Ga0373937_0401318 3300036401 Bacteria 1301
121 Ga0373925_0052970 3300037068 Bacteria 3032
122 Ga0373925_0082419 3300037068 Bacteria 2448
123 Ga0395899_0016389 3300037312 Bacteria 5648
124 Ga0395900_0013693 3300037418 Bacteria 8280
125 Ga0395898_0008582 3300037466 Bacteria 10783
126 Ga0436364_0273345 3300037853 Bacteria 2794207
127 Ga0436364_0505119 3300037853 Bacteria 10146
128 Ga0436364_0551252 3300037853 Bacteria 3089
129 Ga0436364_0679047 3300037853 Unclassified 824
130 Ga0436364_0935123 3300037853 Bacteria 995
131 Ga0436364_0962120 3300037853 Bacteria 1108
132 Ga0436364_1328369 3300037853 Bacteria 544
133 Ga0436364_1468510 3300037853 Bacteria 1949
134 Ga0436364_1503417 3300037853 Bacteria 11695
135 Ga0395901_0024743 3300038443 Bacteria 6164
136 Ga0436365_0039394 3300039437 Bacteria 5307
137 Ga0436365_0484910 3300039437 Bacteria 737
138 Ga0436365_0569681 3300039437 Unclassified 970
139 Ga0436365_1039212 3300039437 Bacteria 2488
140 Ga0436365_1143360 3300039437 Bacteria 2043
141 Ga0436365_1261063 3300039437 Bacteria 840
142 Ga0436365_1473286 3300039437 Bacteria 13365
143 Ga0436360_0240409 3300039438 Bacteria 2138
144 Ga0436360_0283564 3300039438 Bacteria 2151
145 Ga0436360_0455598 3300039438 Bacteria 1442
146 Ga0436360_0555632 3300039438 Unclassified 922
147 Ga0436360_0698152 3300039438 Bacteria 1127
148 Ga0436360_0705360 3300039438 Bacteria 6227
149 Ga0436360_0806292 3300039438 Bacteria 1292
150 Ga0436360_1061411 3300039438 Bacteria 2002
151 Ga0436360_1096780 3300039438 Bacteria 3302
152 Ga0436360_1154689 3300039438 Bacteria 1657
153 Ga0436360_1179120 3300039438 Bacteria 951
154 Ga0436360_1332930 3300039438 Bacteria 3899
155 Ga0436361_0111092 3300039447 Bacteria 17494
156 Ga0436361_0162831 3300039447 Bacteria 1528
157 Ga0436361_0308951 3300039447 Bacteria 886
158 Ga0436361_0512540 3300039447 Bacteria 937
159 Ga0436361_0822504 3300039447 Bacteria 3254
160 Ga0436361_1049870 3300039447 Unclassified 1347
161 Ga0436361_1054550 3300039447 Bacteria 3265
162 Ga0436361_1083470 3300039447 Bacteria 47595
163 Ga0436361_1102713 3300039447 Bacteria 3028
164 Ga0436361_1120639 3300039447 Bacteria 2279
165 Ga0436363_0003310 3300039450 Bacteria 6907
166 Ga0436363_0047245 3300039450 Bacteria 982
167 Ga0436363_0255086 3300039450 Bacteria 1121
168 Ga0436363_0566238 3300039450 Bacteria 1125
169 Ga0436363_0752665 3300039450 Bacteria 796
170 Ga0436363_0994542 3300039450 Bacteria 1298
171 Ga0436363_1250626 3300039450 Bacteria 733
172 Ga0436363_1496677 3300039450 Bacteria 2775
173 Ga0436363_1519485 3300039450 Bacteria 3949
174 Ga0436363_1524398 3300039450 Bacteria 650
175 Ga0436363_1552734 3300039450 Bacteria 35712
176 Ga0436362_0147388 3300039453 Unclassified 1037
177 Ga0436362_0295582 3300039453 Bacteria 3475
178 Ga0436362_0553927 3300039453 Bacteria 894
179 Ga0436362_0559541 3300039453 Bacteria 4598
180 Ga0436362_0584401 3300039453 Bacteria 5446
181 Ga0436362_0601679 3300039453 Bacteria 5380
182 Ga0436362_0653947 3300039453 Bacteria 1899
183 Ga0436362_0679149 3300039453 Bacteria 2760
184 Ga0436362_0768474 3300039453 Bacteria 1526
185 Ga0436362_0806908 3300039453 Bacteria 2517
186 Ga0436362_1017838 3300039453 Bacteria 1323
187 Ga0436362_1026750 3300039453 Unclassified 2081
188 Ga0436362_1169689 3300039453 Unclassified 750
189 Ga0466966_0333811 3300044684 Bacteria 911
190 Ga0466963_0009443 3300044694 Bacteria 5873
191 Ga0466963_0012473 3300044694 Bacteria 5204
192 Ga0466957_0009357 3300044842 Bacteria 5593
193 Ga0466959_0209243 3300045049 Bacteria 1356
194 Ga0466959_0276133 3300045049 Bacteria 1154
195 Ga0466958_0022515 3300045836 Bacteria 3692
196 Ga0466958_0028556 3300045836 Bacteria 3308
197 Ga0466958_0133787 3300045836 Bacteria 1558
198 Ga0466958_0370896 3300045836 Unclassified 922
199 Ga0466967_0018073 3300045976 Bacteria 5624
200 Ga0466967_1438205 3300045976 Unclassified 687
201 Ga0495651_0334558 3300046462 Bacteria 1005
202 Ga0495580_0002384 3300046472 Bacteria 16410
203 Ga0495580_0035040 3300046472 Bacteria 3610
204 Ga0495582_0388972 3300046473 Bacteria 804
205 Ga0495608_0201993 3300046511 Bacteria 1252
206 Ga0495665_0159515 3300046531 Bacteria 1176
207 Ga0495667_0491806 3300046559 Bacteria 769
208 Ga0495674_0241933 3300047319 Bacteria 1487
209 Ga0495674_0500162 3300047319 Unclassified 972
210 Ga0495675_0580237 3300047444 Bacteria 637
211 Ga0495684_0024958 3300047471 Bacteria 4597
212 Ga0495602_0188087 3300048088 Bacteria 1586
213 Ga0436365_0711168
214 Ga0070691_10004077
215 Ga0070661_100077197
216 Ga0070661_101368836
217 Ga0070709_10160133
218 Ga0070714_100000389
219 Ga0070714_100014726
220 Ga0070714_100178706
221 Ga0070714_100594909
222 Ga0070713_100048915
223 Ga0070713_100126322
224 Ga0070713_100627737
225 Ga0070663_100030520
226 Ga0070679_100379208
227 Ga0068855_100000448
228 Ga0068855_100028905
229 Ga0068854_100000018
230 Ga0068856_100012735
231 Ga0068852_100320886
232 Ga0068852_100665856
233 Ga0068859_100070989
234 Ga0068860_101256076
235 Ga0068862_100593768
236 Ga0070717_10130604
237 Ga0070717_10233191
238 Ga0070716_100222574
239 Ga0097620_100070988
240 Ga0105240_10100368
241 Ga0105240_10157096
242 Ga0114129_10235382
243 Ga0157369_10362272
244 Ga0157374_10099203
245 Ga0157378_10460663
246 Ga0163162_10542738
247 Ga0206356_11644647
248 Ga0206352_10330809
249 Ga0206354_10159059
250 Ga0206353_10548498
251 Ga0213873_10001290
252 Ga0213873_10019947
253 Ga0213873_10036237
254 Ga0213873_10036524
255 Ga0213873_10114298
256 Ga0213872_10006509
257 Ga0213872_10013124
258 Ga0213872_10124216
259 Ga0213874_10015115
260 Ga0213876_10006230
261 Ga0213876_10016295
262 Ga0213876_10123228
263 Ga0213876_10146474
264 Ga0213875_10000001
265 Ga0213875_10009104
266 Ga0213875_10013196
267 Ga0213871_10002407
268 Ga0213871_10006367
269 Ga0213871_10024904
270 Ga0213871_10052875
271 Ga0213871_10059799
272 Ga0207699_10117516
273 Ga0207695_10386461
274 Ga0207693_10077369
275 Ga0207663_10121004
276 Ga0207649_11219691
277 Ga0207700_10010070
278 Ga0207700_10283864
279 Ga0207700_10288804
280 Ga0207664_10000411
281 Ga0207664_10003929
282 Ga0207664_10052296
283 Ga0207664_10111634
284 Ga0207664_10293492
285 Ga0207664_10564356
286 Ga0207667_10000086
287 Ga0207667_10033994
288 Ga0207640_10000027
289 Ga0207678_10040247
290 Ga0207702_10192265
291 Ga0207648_10393705
292 Ga0207698_10113754
293 Ga0207698_10551179
294 Ga0209966_1055752
295 Ga0265356_1000069
296 Ga0265334_10027176
297 Ga0265338_10000370
298 Ga0265338_10104511
299 Ga0265762_1012370
300 Ga0265762_1040505
301 Ga0265770_1041474
302 Ga0265760_10000722
303 Ga0265325_10002819
304 Ga0265329_10118176
305 Ga0265340_10031066
306 Ga0265339_10007624
307 Ga0265327_10144942
308 Ga0265316_10014172
309 Ga0265313_10008009
310 Ga0265342_10001589
311 Ga0373926_0100397
312 Ga0373934_0057383
313 Ga0373923_0048087
314 Ga0373923_0289534
315 Ga0373945_0148376
316 Ga0373953_0087072
317 Ga0373953_0265546
318 Ga0373954_0045972
319 Ga0373956_0101966
320 Ga0373943_0339586
321 Ga0373924_0180891
322 Ga0373935_0147668
323 Ga0373927_0022290
324 Ga0373927_0030333
325 Ga0373927_0408275
326 Ga0373933_0018164
327 Ga0373947_0029278
328 Ga0373947_0078697
329 Ga0373947_0220020
330 Ga0373937_0009610
331 Ga0373937_0114164
332 Ga0373937_0401318
333 Ga0373925_0052970
334 Ga0373925_0082419
335 Ga0395899_0016389
336 Ga0395900_0013693
337 Ga0395898_0008582
338 Ga0436364_0273345
339 Ga0436364_0505119
340 Ga0436364_0551252
341 Ga0436364_0679047
342 Ga0436364_0935123
343 Ga0436364_0962120
344 Ga0436364_1328369
345 Ga0436364_1468510
346 Ga0436364_1503417
347 Ga0395901_0024743
348 Ga0436365_0039394
349 Ga0436365_0484910
350 Ga0436365_0569681
351 Ga0436365_1039212
352 Ga0436365_1143360
353 Ga0436365_1261063
354 Ga0436365_1473286
355 Ga0436360_0240409
356 Ga0436360_0283564
357 Ga0436360_0455598
358 Ga0436360_0555632
359 Ga0436360_0698152
360 Ga0436360_0705360
361 Ga0436360_0806292
362 Ga0436360_1061411
363 Ga0436360_1096780
364 Ga0436360_1154689
365 Ga0436360_1179120
366 Ga0436360_1332930
367 Ga0436361_0111092
368 Ga0436361_0162831
369 Ga0436361_0308951
370 Ga0436361_0512540
371 Ga0436361_0822504
372 Ga0436361_1049870
373 Ga0436361_1054550
374 Ga0436361_1083470
375 Ga0436361_1102713
376 Ga0436361_1120639
377 Ga0436363_0003310
378 Ga0436363_0047245
379 Ga0436363_0255086
380 Ga0436363_0566238
381 Ga0436363_0752665
382 Ga0436363_0994542
383 Ga0436363_1250626
384 Ga0436363_1496677
385 Ga0436363_1519485
386 Ga0436363_1524398
387 Ga0436363_1552734
388 Ga0436362_0147388
389 Ga0436362_0295582
390 Ga0436362_0553927
391 Ga0436362_0559541
392 Ga0436362_0584401
393 Ga0436362_0601679
394 Ga0436362_0653947
395 Ga0436362_0679149
396 Ga0436362_0768474
397 Ga0436362_0806908
398 Ga0436362_1017838
399 Ga0436362_1026750
400 Ga0436362_1169689
401 Ga0466966_0333811
402 Ga0466963_0009443
403 Ga0466963_0012473
404 Ga0466957_0009357
405 Ga0466959_0209243
406 Ga0466959_0276133
407 Ga0466958_0022515
408 Ga0466958_0028556
409 Ga0466958_0133787
410 Ga0466958_0370896
411 Ga0466967_0018073
412 Ga0466967_1438205
413 Ga0495651_0334558
414 Ga0495580_0002384
415 Ga0495580_0035040
416 Ga0495582_0388972
417 Ga0495608_0201993
418 Ga0495665_0159515
419 Ga0495667_0491806
420 Ga0495674_0241933
421 Ga0495674_0500162
422 Ga0495675_0580237
423 Ga0495684_0024958
424 Ga0495602_0188087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00156

Pribosyltran

Phosphoribosyl transferase domain

15

169

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p80-assembly1.cif.gz_A structure of ancestral pyrr protein (ancgreenpyrr) 0.9295 6 177
1non-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus 0.929 8 177
4p83-assembly1.cif.gz_A structure of engineered pyrr protein (purple pyrr) 0.9286 8 176
1xz8-assembly1.cif.gz_A pyrr, the regulator of the pyrimidine biosynthetic operon in bacillus caldolyticus, nucleotide-bound form 0.9276 8 177
4p80-assembly1.cif.gz_A structure of ancestral pyrr protein (ancgreenpyrr) 0.9186 6 177
ID Description Score Start End Superfamily
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8914 8 177 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8865 1 176 3.40.50.2020
4p83D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8764 8 177 3.40.50.2020
af_P9WHK3_1_193_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8635 1 176 3.40.50.2020
1hgxB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8045 8 152 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A3B8HHD8-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR 0.96 8 163 GO:0016757
AF-A0A2W5XD78-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.9588 8 179 GO:0004845
GO:0006355
AF-A0A6A2F5P6-F1-model_v4 deleted 0.9577 8 162
AF-A0A662D9V2-F1-model_v4 Bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR (EC 2.4.2.9) 0.9563 11 163 GO:0004845
AF-A0A7X7Z255-F1-model_v4 Bifunctional protein PyrR [Includes: Pyrimidine operon regulatory protein; Uracil phosphoribosyltransferase (UPRTase) (EC 2.4.2.9)] 0.954 7 180 GO:0004845
GO:0006355

Map