F323096

General Info

Members Datasets Scaffolds Average Seq Length
212 153 424 255

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0793745|Ga0436364_0793745_121_1029
Length 302
Sequence VTSRRPGASRTSAHLRAFSSVDLVPRLQERVAIVTGGALGIGGATARRLAEEGARVLVADIDSEAAARNAETIRATGGIAEALACDVGVESDLQGMVTRAVDLWGKLDILVNNAYPVGRSGLAGDAVHLSEQAWDDGFNIGLKSMLRAARFAVPHLSSAGGGSIVNMSSVHGLLAEPGQLVYETLMAGVMSLSRQMAVEYGPDGIRVNAICPGHIVTERMQVRWREHPETLRFFAEQYPLRRTGAPVDIANAVVFLCSDEAAFITGHSLVVDGGLSIQLQEQYATRIARYAQAHADSLTWFP

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
70 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
79 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
80 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
81 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
82 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
89 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
103 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
118 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
140 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
143 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
144 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2501939600 Micromonospora sp. L5 Isolate Unclassified
147 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
148 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
149 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
150 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
151 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
152 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
153 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.75
Metatranscriptomes 0.47
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 1.42
Rhizoplane 9.91
Rhizosphere 76.89
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0793745 3300037853 Bacteria 1377
2 Ga0070676_10189934 3300005328 Bacteria 1340
3 Ga0070670_100480517 3300005331 Unclassified 1103
4 Ga0070680_100019396 3300005336 Bacteria 5388
5 Ga0070682_100076725 3300005337 Bacteria 2152
6 Ga0070682_100091240 3300005337 Bacteria 1993
7 Ga0068868_100231945 3300005338 Bacteria 1549
8 Ga0070660_100044147 3300005339 Plasmid 3408
9 Ga0070661_100022117 3300005344 Plasmid 4549
10 Ga0070671_100022759 3300005355 Bacteria 5119
11 Ga0070674_100398296 3300005356 Bacteria 1124
12 Ga0070673_100249879 3300005364 Unclassified 1545
13 Ga0070659_100041755 3300005366 Plasmid 3586
14 Ga0070681_10004320 3300005458 Bacteria 13502
15 Ga0070681_10209169 3300005458 Unclassified 1867
16 Ga0070706_100081448 3300005467 Unclassified 2998
17 Ga0070707_100209577 3300005468 Bacteria 1900
18 Ga0070707_100547257 3300005468 Unclassified 1120
19 Ga0070698_100053640 3300005471 Bacteria 4097
20 Ga0070698_100266123 3300005471 Unclassified 1646
21 Ga0070679_100053608 3300005530 Bacteria 4014
22 Ga0070679_100070404 3300005530 Unclassified 3490
23 Ga0070684_100289993 3300005535 Unclassified 1500
24 Ga0070697_100020743 3300005536 Bacteria 5203
25 Ga0070697_100081387 3300005536 Unclassified 2669
26 Ga0068853_100003804 3300005539 Bacteria 11569
27 Ga0070664_100007835 3300005564 Bacteria 8626
28 Ga0070664_100407003 3300005564 Bacteria 1245
29 Ga0068857_100001555 3300005577 Bacteria 18389
30 Ga0068857_100065349 3300005577 Bacteria 3234
31 Ga0068854_100022959 3300005578 Bacteria 4256
32 Ga0068854_100310742 3300005578 Bacteria 1278
33 Ga0068858_100453531 3300005842 Bacteria 1236
34 Ga0068860_100219268 3300005843 Bacteria 1847
35 Ga0075428_100700066 3300006844 Unclassified 1079
36 Ga0075430_100003214 3300006846 Bacteria 13685
37 Ga0075430_100028111 3300006846 Bacteria 4777
38 Ga0075431_100010579 3300006847 Bacteria 9277
39 Ga0075431_100156713 3300006847 Bacteria 2343
40 Ga0075429_100031477 3300006880 Bacteria 4611
41 Ga0105240_10002979 3300009093 Bacteria 26653
42 Ga0105240_10083128 3300009093 Bacteria 3930
43 Ga0105245_10431698 3300009098 Bacteria 1322
44 Ga0114129_10060756 3300009147 Bacteria 5283
45 Ga0114129_10111236 3300009147 Bacteria 3780
46 Ga0114129_10268606 3300009147 Bacteria 2283
47 Ga0105241_10144833 3300009174 Bacteria 1938
48 Ga0105237_10038563 3300009545 Bacteria 4825
49 Ga0105238_10589597 3300009551 Bacteria 1119
50 Ga0157373_10099145 3300013100 Unclassified 2050
51 Ga0157374_10617222 3300013296 Bacteria 1095
52 Ga0163162_10320306 3300013306 Bacteria 1683
53 Ga0157372_10179427 3300013307 Unclassified 2451
54 Ga0163163_10010715 3300014325 Bacteria 8266
55 Ga0206354_10759833 3300020081 Bacteria 1481
56 Ga0213876_10003383 3300021384 Bacteria 9130
57 Ga0207688_10182887 3300025901 Bacteria 1251
58 Ga0207647_10028443 3300025904 Bacteria 3630
59 Ga0207645_10008739 3300025907 Bacteria 7053
60 Ga0207645_10036866 3300025907 Bacteria 3140
61 Ga0207705_10014157 3300025909 Bacteria 5746
62 Ga0207684_10155753 3300025910 Bacteria 1966
63 Ga0207707_10003710 3300025912 Bacteria 13529
64 Ga0207707_10443353 3300025912 Bacteria 1111
65 Ga0207695_10063131 3300025913 Unclassified 3820
66 Ga0207671_10067530 3300025914 Bacteria 2663
67 Ga0207660_10015300 3300025917 Bacteria 5060
68 Ga0207657_10008590 3300025919 Bacteria 10346
69 Ga0207657_10094262 3300025919 Bacteria 2493
70 Ga0207649_10034994 3300025920 Bacteria 3014
71 Ga0207649_10202351 3300025920 Unclassified 1404
72 Ga0207652_10052347 3300025921 Unclassified 3503
73 Ga0207652_10560248 3300025921 Bacteria 1026
74 Ga0207687_10115753 3300025927 Bacteria 1998
75 Ga0207644_10061200 3300025931 Bacteria 2726
76 Ga0207690_10232465 3300025932 Unclassified 1416
77 Ga0207661_10282249 3300025944 Bacteria 1484
78 Ga0207679_10003044 3300025945 Bacteria 10379
79 Ga0207651_10216084 3300025960 Unclassified 1547
80 Ga0207640_10246429 3300025981 Bacteria 1384
81 Ga0207639_10008781 3300026041 Bacteria 6944
82 Ga0207639_10187664 3300026041 Unclassified 1763
83 Ga0207678_10064815 3300026067 Bacteria 3139
84 Ga0207702_10628677 3300026078 Bacteria 1055
85 Ga0207676_10102281 3300026095 Unclassified 2378
86 Ga0207674_10002138 3300026116 Bacteria 24965
87 Ga0207674_10005529 3300026116 Bacteria 15003
88 Ga0207683_10287005 3300026121 Bacteria 1504
89 Ga0207683_10350261 3300026121 Bacteria 1355
90 Ga0307515_10121248 3300028794 Bacteria 2959
91 Ga0265331_10011508 3300031250 Bacteria 4842
92 Ga0307508_10017821 3300031616 Bacteria 6459
93 Ga0307409_100034260 3300031995 Bacteria 3706
94 Ga0307415_100000407 3300032126 Bacteria 18365
95 Ga0307415_100524984 3300032126 Bacteria 1040
96 Ga0307415_100647296 3300032126 Bacteria 947
97 Ga0373943_0172016 3300035170 Bacteria 1186
98 Ga0373947_0047062 3300035725 Bacteria 2584
99 Ga0373925_0000053 3300037068 Bacteria 125353
100 Ga0373925_0000600 3300037068 Bacteria 34510
101 Ga0436364_0976647 3300037853 Bacteria 1223
102 Ga0436364_1334594 3300037853 Bacteria 9804
103 Ga0436365_0042865 3300039437 Bacteria 1764
104 Ga0436365_0056373 3300039437 Bacteria 4366
105 Ga0436365_0132934 3300039437 Bacteria 23357
106 Ga0436365_1060995 3300039437 Unclassified 2473
107 Ga0436365_1703142 3300039437 Bacteria 34231
108 Ga0436365_1739085 3300039437 Bacteria 2047
109 Ga0436365_1861371 3300039437 Bacteria 3296
110 Ga0451791_0458097 3300041451 Bacteria 3990
111 Ga0451797_1236175 3300041453 Bacteria 5677
112 Ga0451802_1999071 3300041460 Bacteria 2540
113 Ga0451843_0836575 3300041509 Bacteria 4483
114 Ga0451853_0375660 3300041512 Bacteria 895
115 Ga0466969_0128547 3300044656 Bacteria 1175
116 Ga0466966_0046169 3300044684 Bacteria 2782
117 Ga0466959_0000777 3300045049 Bacteria 18701
118 Ga0451576_0026995 3300045051 Bacteria 6170
119 Ga0451576_0354973 3300045051 Bacteria 1535
120 Ga0495629_0480276 3300046459 Bacteria 839
121 Ga0495640_0171176 3300046533 Bacteria 1388
122 Ga0495646_0061731 3300046680 Bacteria 2231
123 Ga0495624_0127415 3300046690 Bacteria 1562
124 Ga0495600_0067008 3300046809 Bacteria 2347
125 Ga0495593_0108108 3300047673 Bacteria 1422
126 Ga0496102_0012519 3300048905 Bacteria 7345
127 Ga0496102_0022156 3300048905 Bacteria 5629
128 Ga0496103_0222082 3300048906 Bacteria 1215
129 Ga0496104_0013915 3300048907 Bacteria 7259
130 Ga0496104_0115834 3300048907 Bacteria 2572
131 Ga0496105_0004575 3300048908 Bacteria 10422
132 Ga0496108_0032621 3300048911 Bacteria 4326
133 Ga0496108_0227947 3300048911 Bacteria 1620
134 Ga0496109_0001685 3300048912 Bacteria 18406
135 Ga0496110_0047434 3300048913 Bacteria 3761
136 Ga0496111_0000363 3300048914 Bacteria 22534
137 Ga0496112_0503122 3300048915 Bacteria 1147
138 Ga0496114_0001214 3300048917 Bacteria 19488
139 Ga0496114_0003234 3300048917 Bacteria 12494
140 Ga0496114_0103743 3300048917 Bacteria 2431
141 Ga0496114_0146206 3300048917 Bacteria 2049
142 Ga0496114_0199739 3300048917 Bacteria 1751
143 Ga0496114_0680465 3300048917 Bacteria 903
144 Ga0496124_0425142 3300048927 Bacteria 914
145 Ga0496125_0002736 3300048928 Bacteria 22344
146 Ga0501031_0009053 3300049568 Bacteria 6475
147 Ga0501032_0009925 3300049569 Bacteria 6875
148 Ga0501033_0000068 3300049570 Bacteria 98461
149 Ga0501033_0103466 3300049570 Bacteria 2076
150 Ga0501034_0061408 3300049571 Bacteria 3773
151 Ga0501038_0058045 3300049574 Bacteria 3319
152 Ga0501039_0246954 3300049575 Bacteria 1403
153 Ga0501040_0134092 3300049576 Bacteria 1742
154 Ga0501040_0138087 3300049576 Bacteria 1716
155 Ga0501041_0025728 3300049577 Bacteria 3537
156 Ga0501042_0025817 3300049578 Bacteria 4129
157 Ga0501042_0044428 3300049578 Bacteria 3165
158 Ga0501043_0038230 3300049579 Bacteria 3773
159 Ga0501046_0020117 3300049580 Bacteria 5525
160 Ga0501047_0005724 3300049581 Bacteria 11696
161 Ga0501048_0041602 3300049582 Bacteria 3290
162 Ga0501068_0003852 3300049584 Bacteria 8143
163 Ga0501069_0003450 3300049585 Bacteria 8132
164 Ga0501069_0203208 3300049585 Bacteria 1148
165 Ga0501070_0463620 3300049586 Bacteria 1020
166 Ga0501071_0097865 3300049587 Bacteria 2160
167 Ga0501072_0004698 3300049588 Bacteria 10407
168 Ga0501072_0106063 3300049588 Bacteria 2235
169 Ga0501072_0142613 3300049588 Bacteria 1910
170 Ga0501073_0045967 3300049589 Bacteria 3073
171 Ga0501074_0144122 3300049590 Bacteria 1703
172 Ga0501075_0124040 3300049591 Bacteria 1966
173 Ga0501076_0003171 3300049592 Bacteria 11468
174 Ga0501076_0096239 3300049592 Bacteria 2384
175 Ga0501077_0062287 3300049593 Bacteria 2367
176 Ga0501077_0082197 3300049593 Bacteria 2041
177 Ga0501079_0103859 3300049741 Bacteria 2204
178 Ga0501079_0171702 3300049741 Bacteria 1691
179 Ga0501080_0474822 3300049742 Bacteria 1119
180 Ga0501081_0021527 3300049743 Bacteria 4304
181 Ga0501081_0038408 3300049743 Bacteria 3271
182 Ga0501081_0066149 3300049743 Bacteria 2513
183 Ga0501083_0005106 3300049744 Bacteria 9295
184 Ga0501035_0006021 3300049822 Bacteria 11418
185 Ga0501044_0002645 3300049823 Bacteria 20386
186 Ga0501045_0184910 3300049824 Bacteria 1552
187 nmdc:mga0yw44_175593_c1 3300050492 Bacteria 1408
188 nmdc:mga05p37_313733_c1 3300050507 Bacteria 1858
189 nmdc:mga05p37_69064_c1 3300050507 Bacteria 4345
190 nmdc:mga05p37_91338_c1 3300050507 Bacteria 3752
191 nmdc:mga09592_64260_c1 3300050508 Bacteria 3107
192 nmdc:mga0qj67_222_c1 3300050509 Bacteria 38773
193 nmdc:mga06r32_167000_c1 3300050510 Bacteria 2184
194 Ga0500643_000453 3300053087 Bacteria 30334
195 Ga0500566_0000211 3300053094 Bacteria 30837
196 Ga0500559_0122710 3300053136 Bacteria 1209
197 Ga0500630_110747 3300053159 Bacteria 1234
198 Ga0501084_0000061 3300054114 Bacteria 83188
199 Ga0501084_0189421 3300054114 Bacteria 1735
200 Ga0501082_0003076 3300060353 Bacteria 14555
201 Ga0530510_0027215 3300061734 Bacteria 4097
202 Ga0530510_0053627 3300061734 Bacteria 2914
203 Ga0530510_0070665 3300061734 Bacteria 2533
204 Ga0530510_0394480 3300061734 Bacteria 1042
205 2501940901 2501939600 Bacteria 6907073
206 2623586889 2622736626 Bacteria 7181580
207 2819699153 2818991463 Bacteria 7948711
208 2856861802 2856858025 Bacteria 7255264
209 2869278955 2869278585 Bacteria 7077053
210 2958058338 2958041894 Bacteria 13082850
211 2970593549 2970593180 Bacteria 7073582
212 649812400 649633069 Bacteria 6962533
213 Ga0436364_0793745
214 Ga0070676_10189934
215 Ga0070670_100480517
216 Ga0070680_100019396
217 Ga0070682_100076725
218 Ga0070682_100091240
219 Ga0068868_100231945
220 Ga0070660_100044147
221 Ga0070661_100022117
222 Ga0070671_100022759
223 Ga0070674_100398296
224 Ga0070673_100249879
225 Ga0070659_100041755
226 Ga0070681_10004320
227 Ga0070681_10209169
228 Ga0070706_100081448
229 Ga0070707_100209577
230 Ga0070707_100547257
231 Ga0070698_100053640
232 Ga0070698_100266123
233 Ga0070679_100053608
234 Ga0070679_100070404
235 Ga0070684_100289993
236 Ga0070697_100020743
237 Ga0070697_100081387
238 Ga0068853_100003804
239 Ga0070664_100007835
240 Ga0070664_100407003
241 Ga0068857_100001555
242 Ga0068857_100065349
243 Ga0068854_100022959
244 Ga0068854_100310742
245 Ga0068858_100453531
246 Ga0068860_100219268
247 Ga0075428_100700066
248 Ga0075430_100003214
249 Ga0075430_100028111
250 Ga0075431_100010579
251 Ga0075431_100156713
252 Ga0075429_100031477
253 Ga0105240_10002979
254 Ga0105240_10083128
255 Ga0105245_10431698
256 Ga0114129_10060756
257 Ga0114129_10111236
258 Ga0114129_10268606
259 Ga0105241_10144833
260 Ga0105237_10038563
261 Ga0105238_10589597
262 Ga0157373_10099145
263 Ga0157374_10617222
264 Ga0163162_10320306
265 Ga0157372_10179427
266 Ga0163163_10010715
267 Ga0206354_10759833
268 Ga0213876_10003383
269 Ga0207688_10182887
270 Ga0207647_10028443
271 Ga0207645_10008739
272 Ga0207645_10036866
273 Ga0207705_10014157
274 Ga0207684_10155753
275 Ga0207707_10003710
276 Ga0207707_10443353
277 Ga0207695_10063131
278 Ga0207671_10067530
279 Ga0207660_10015300
280 Ga0207657_10008590
281 Ga0207657_10094262
282 Ga0207649_10034994
283 Ga0207649_10202351
284 Ga0207652_10052347
285 Ga0207652_10560248
286 Ga0207687_10115753
287 Ga0207644_10061200
288 Ga0207690_10232465
289 Ga0207661_10282249
290 Ga0207679_10003044
291 Ga0207651_10216084
292 Ga0207640_10246429
293 Ga0207639_10008781
294 Ga0207639_10187664
295 Ga0207678_10064815
296 Ga0207702_10628677
297 Ga0207676_10102281
298 Ga0207674_10002138
299 Ga0207674_10005529
300 Ga0207683_10287005
301 Ga0207683_10350261
302 Ga0307515_10121248
303 Ga0265331_10011508
304 Ga0307508_10017821
305 Ga0307409_100034260
306 Ga0307415_100000407
307 Ga0307415_100524984
308 Ga0307415_100647296
309 Ga0373943_0172016
310 Ga0373947_0047062
311 Ga0373925_0000053
312 Ga0373925_0000600
313 Ga0436364_0976647
314 Ga0436364_1334594
315 Ga0436365_0042865
316 Ga0436365_0056373
317 Ga0436365_0132934
318 Ga0436365_1060995
319 Ga0436365_1703142
320 Ga0436365_1739085
321 Ga0436365_1861371
322 Ga0451791_0458097
323 Ga0451797_1236175
324 Ga0451802_1999071
325 Ga0451843_0836575
326 Ga0451853_0375660
327 Ga0466969_0128547
328 Ga0466966_0046169
329 Ga0466959_0000777
330 Ga0451576_0026995
331 Ga0451576_0354973
332 Ga0495629_0480276
333 Ga0495640_0171176
334 Ga0495646_0061731
335 Ga0495624_0127415
336 Ga0495600_0067008
337 Ga0495593_0108108
338 Ga0496102_0012519
339 Ga0496102_0022156
340 Ga0496103_0222082
341 Ga0496104_0013915
342 Ga0496104_0115834
343 Ga0496105_0004575
344 Ga0496108_0032621
345 Ga0496108_0227947
346 Ga0496109_0001685
347 Ga0496110_0047434
348 Ga0496111_0000363
349 Ga0496112_0503122
350 Ga0496114_0001214
351 Ga0496114_0003234
352 Ga0496114_0103743
353 Ga0496114_0146206
354 Ga0496114_0199739
355 Ga0496114_0680465
356 Ga0496124_0425142
357 Ga0496125_0002736
358 Ga0501031_0009053
359 Ga0501032_0009925
360 Ga0501033_0000068
361 Ga0501033_0103466
362 Ga0501034_0061408
363 Ga0501038_0058045
364 Ga0501039_0246954
365 Ga0501040_0134092
366 Ga0501040_0138087
367 Ga0501041_0025728
368 Ga0501042_0025817
369 Ga0501042_0044428
370 Ga0501043_0038230
371 Ga0501046_0020117
372 Ga0501047_0005724
373 Ga0501048_0041602
374 Ga0501068_0003852
375 Ga0501069_0003450
376 Ga0501069_0203208
377 Ga0501070_0463620
378 Ga0501071_0097865
379 Ga0501072_0004698
380 Ga0501072_0106063
381 Ga0501072_0142613
382 Ga0501073_0045967
383 Ga0501074_0144122
384 Ga0501075_0124040
385 Ga0501076_0003171
386 Ga0501076_0096239
387 Ga0501077_0062287
388 Ga0501077_0082197
389 Ga0501079_0103859
390 Ga0501079_0171702
391 Ga0501080_0474822
392 Ga0501081_0021527
393 Ga0501081_0038408
394 Ga0501081_0066149
395 Ga0501083_0005106
396 Ga0501035_0006021
397 Ga0501044_0002645
398 Ga0501045_0184910
399 nmdc:mga0yw44_175593_c1
400 nmdc:mga05p37_313733_c1
401 nmdc:mga05p37_69064_c1
402 nmdc:mga05p37_91338_c1
403 nmdc:mga09592_64260_c1
404 nmdc:mga0qj67_222_c1
405 nmdc:mga06r32_167000_c1
406 Ga0500643_000453
407 Ga0500566_0000211
408 Ga0500559_0122710
409 Ga0500630_110747
410 Ga0501084_0000061
411 Ga0501084_0189421
412 Ga0501082_0003076
413 Ga0530510_0027215
414 Ga0530510_0053627
415 Ga0530510_0070665
416 Ga0530510_0394480
417 2501940901
418 2623586889
419 2819699153
420 2856861802
421 2869278955
422 2958058338
423 2970593549
424 649812400

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

30

228

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

36

276

0.94

PF08659

KR

KR domain

31

197

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gco-assembly1.cif.gz_A crystal structure of glucose dehydrogenase complexed with nad+ 0.9789 3 250
3ay6-assembly1.cif.gz_C crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose 0.9789 2 253
1gee-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ 0.9785 3 250
7do5-assembly2.cif.gz_G crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase(apo-form) 0.9785 3 250
4z9y-assembly1.cif.gz_B crystal structure of 2-keto-3-deoxy-d-gluconate dehydrogenase from pectobacterium carotovorum 0.9779 2 251
ID Description Score Start End Superfamily
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9787 3 250 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9771 6 248 3.40.50.720
af_P76633_10_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9762 2 251 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9676 6 248 3.40.50.720
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9672 3 251 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G4ZTI1-F1-model_v4 Glucose 1-dehydrogenase B (EC 1.1.1.47) 0.9961 1 162 GO:0047936
AF-A0A6N7FUE5-F1-model_v4 SDR family oxidoreductase 0.99 59 255
AF-A0A2V8NH54-F1-model_v4 SDR family oxidoreductase 0.989 3 250 GO:0016491
AF-A0A2V8S3U5-F1-model_v4 SDR family oxidoreductase 0.9888 3 253 GO:0016491
AF-A0A4V2G576-F1-model_v4 Glucose 1-dehydrogenase 0.9885 3 250 GO:0016491

Map