F323029

General Info

Members Datasets Scaffolds Average Seq Length
212 111 112 135

Family's Representative Sequence

Representative Sequence 3300032004|Ga0307414_10966034|Ga0307414_109660342
Length 162
Sequence LPYAKVVLLNLGHLGYKFNTKNYKMTINQIYVNLPVKDVQKTREFWTKLGFSINEQFSNEQAICVVMREDYIYTMFLKEEFFQTFTNRPFAKGDTTQVLLAIGVNNRDEVDHMVKTAIENGGSTYSEPIDHGWMYQSAFADIDGHQWEVMYGDLSQLPADQS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
7 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
8 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
9 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
10 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
11 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
12 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
13 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
14 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
15 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
16 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
17 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
18 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
19 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
20 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
21 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
22 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
23 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
24 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
25 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
26 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
27 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
28 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
29 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
30 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
31 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
32 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
33 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
34 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
35 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
36 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
41 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
73 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
74 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
75 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
76 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
77 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
78 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
79 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
80 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
88 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
94 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
110 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
111 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.06
Metatranscriptomes 0.47
Isolates 25.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.36
Nodule 0.94
Rhizoplane 2.36
Rhizosphere 69.81
Stem 0
Stem Tuber 0
Unclassified 24.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1078572 2162886007 Bacteria 1186
2 SwRhRL2b_contig_3105950 2162886007 Bacteria 2412
3 JGI24741J21665_1015994 3300001915 Bacteria 1231
4 rootH2_10193247 3300003320 Bacteria 1726
5 rootL2_10027567 3300003322 Bacteria 2783
6 rootL2_10079963 3300003322 Bacteria 5675
7 rootH1_10052264 3300003323 Bacteria 11093
8 Ga0055534_1014651 3300003784 Bacteria 1461
9 Ga0058860_10933392 3300004801 Bacteria 1061
10 Ga0065714_10065186 3300005288 Bacteria 12125
11 Ga0065704_10072081 3300005289 Bacteria 9205
12 Ga0065704_10133854 3300005289 Bacteria 1595
13 Ga0065704_10179404 3300005289 Bacteria 1245
14 Ga0070682_100001169 3300005337 Bacteria 14977
15 Ga0070660_100199141 3300005339 Bacteria 1624
16 Ga0070661_100587425 3300005344 Bacteria 899
17 Ga0070668_100030486 3300005347 Bacteria 4100
18 Ga0070669_100850459 3300005353 Bacteria 777
19 Ga0070663_101037355 3300005455 Bacteria 714
20 Ga0105244_10000050 3300009036 Bacteria 138868
21 Ga0105250_10042255 3300009092 Bacteria 1827
22 Ga0105243_10002981 3300009148 Bacteria 13993
23 Ga0157373_10000005 3300013100 Bacteria 262158
24 Ga0157373_10071918 3300013100 Bacteria 2442
25 Ga0157373_10381050 3300013100 Bacteria 1009
26 Ga0157371_10116911 3300013102 Bacteria 1895
27 Ga0157370_10010675 3300013104 Bacteria 9662
28 Ga0157370_10048349 3300013104 Bacteria 4075
29 Ga0157370_10172705 3300013104 Bacteria 2009
30 Ga0157370_10243166 3300013104 Bacteria 1665
31 Ga0157370_10284691 3300013104 Bacteria 1527
32 Ga0157369_10703316 3300013105 Bacteria 1041
33 Ga0157375_10000222 3300013308 Bacteria 53493
34 Ga0182008_10000060 3300014497 Bacteria 95038
35 Ga0157379_10577818 3300014968 Bacteria 1047
36 Ga0182006_1000012 3300015261 Bacteria 394239
37 Ga0163161_10001964 3300017792 Bacteria 14938
38 Ga0163161_10041815 3300017792 Bacteria 3294
39 Ga0209673_1108939 3300025273 Bacteria 583
40 Ga0209675_1000088 3300025291 Bacteria 147320
41 Ga0207655_1000489 3300025728 Bacteria 51011
42 Ga0207657_10196283 3300025919 Bacteria 1626
43 Ga0207649_10256444 3300025920 Bacteria 1262
44 Ga0207709_10004569 3300025935 Bacteria 7968
45 Ga0207668_10030977 3300025972 Bacteria 3519
46 Ga0207668_10277233 3300025972 Bacteria 1373
47 Ga0207678_11071087 3300026067 Bacteria 714
48 Ga0307412_10000007 3300031911 Bacteria 486267
49 Ga0307412_10002392 3300031911 Bacteria 10422
50 Ga0307412_10002567 3300031911 Bacteria 10087
51 Ga0307416_100000003 3300032002 Bacteria 509060
52 Ga0307414_10000032 3300032004 Bacteria 186421
53 Ga0307414_10058011 3300032004 Bacteria 2725
54 Ga0307414_10061040 3300032004 Bacteria 2669
55 Ga0307414_10137991 3300032004 Bacteria 1904
56 Ga0307414_10966034 3300032004 Bacteria 783
57 Ga0395905_0016039 3300037471 Bacteria 7121
58 Ga0439466_0039858 3300041411 Bacteria 1573
59 Ga0439465_0001435 3300041413 Bacteria 7713
60 Ga0439445_0000970 3300042004 Bacteria 6108
61 Ga0439432_155806 3300042006 Bacteria 669
62 Ga0439444_0088903 3300042437 Bacteria 686
63 Ga0495627_000002 3300046453 Bacteria 903861
64 Ga0495627_028397 3300046453 Bacteria 1788
65 Ga0495590_0006887 3300046457 Bacteria 4413
66 Ga0495638_0381370 3300046460 Bacteria 736
67 Ga0495596_0002292 3300046500 Bacteria 10410
68 Ga0495606_0030963 3300046507 Bacteria 3727
69 Ga0495606_0080817 3300046507 Bacteria 2022
70 Ga0495610_0000009 3300046512 Bacteria 554843
71 Ga0495632_0001703 3300046519 Bacteria 17915
72 Ga0495643_0007522 3300046522 Bacteria 7008
73 Ga0495643_0066346 3300046522 Bacteria 1904
74 Ga0495663_0000073 3300046525 Bacteria 45656
75 Ga0495663_0000309 3300046525 Bacteria 18386
76 Ga0495663_0013151 3300046525 Bacteria 2313
77 Ga0495654_0000001 3300046530 Bacteria 1513197
78 Ga0495609_0000480 3300046538 Bacteria 32078
79 Ga0495633_0000002 3300046558 Bacteria 488754
80 Ga0495633_0001388 3300046558 Bacteria 18912
81 Ga0495625_0000899 3300046660 Bacteria 40086
82 Ga0495660_0343349 3300046810 Bacteria 665
83 Ga0495686_0000095 3300047472 Bacteria 184643
84 Ga0495686_0016154 3300047472 Bacteria 5072
85 Ga0496102_0826645 3300048905 Bacteria 849
86 Ga0496104_0242729 3300048907 Bacteria 1714
87 Ga0496105_0670456 3300048908 Bacteria 798
88 Ga0496113_0049090 3300048916 Bacteria 3142
89 Ga0496116_0000022 3300048919 Bacteria 482506
90 Ga0496117_0000074 3300048920 Bacteria 232732
91 Ga0496118_0001613 3300048921 Bacteria 33370
92 Ga0496118_0164020 3300048921 Bacteria 1369
93 Ga0496119_0000017 3300048922 Bacteria 309779
94 Ga0496120_0063361 3300048923 Bacteria 2057
95 Ga0496121_0157312 3300048924 Bacteria 1666
96 Ga0496122_0000159 3300048925 Bacteria 159297
97 Ga0496122_0000354 3300048925 Bacteria 98798
98 Ga0496122_0000357 3300048925 Bacteria 98456
99 Ga0496122_0001690 3300048925 Bacteria 34216
100 Ga0496122_0002282 3300048925 Bacteria 27757
101 Ga0496123_0001157 3300048926 Bacteria 39190
102 Ga0496123_0034782 3300048926 Bacteria 3602
103 Ga0496123_0072746 3300048926 Bacteria 2137
104 Ga0496123_0194340 3300048926 Bacteria 1046
105 Ga0496124_0007620 3300048927 Bacteria 11470
106 Ga0496125_0000156 3300048928 Bacteria 151400
107 Ga0496125_0007856 3300048928 Bacteria 11272
108 Ga0496126_0009304 3300048929 Bacteria 10462
109 Ga0496126_0227229 3300048929 Bacteria 1565
110 Ga0501251_036646 3300049681 Bacteria 725
111 Ga0501241_000015 3300049758 Bacteria 100297
112 Ga0501269_000639 3300049766 Bacteria 6060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_028397 Ga0495627_028397_1404_1778 124
2 iso_pu_bacteria 2993372514 2993373080 130
3 iso_pu_bacteria 2993480792 2993483761 130
4 iso_pu_bacteria 2511231000 2511231457 131
5 iso_pu_bacteria 2582581278 2585145501 131
6 iso_pu_bacteria 2582581281 2585158839 131
7 iso_pu_bacteria 2582581282 2585163127 131
8 iso_pu_bacteria 2585428061 2587750829 131
9 iso_pu_bacteria 2585428095 2587867985 131
10 iso_pu_bacteria 2585428115 2587943318 131
11 iso_pu_bacteria 2585428182 2588209570 131
12 iso_pu_bacteria 2585428183 2588213859 131
13 iso_pu_bacteria 2585428184 2588218524 131
14 iso_pu_bacteria 2585428185 2588225791 131
15 iso_pu_bacteria 2585428187 2588233820 131
16 iso_pu_bacteria 2765235839 2765573275 131
17 iso_pu_bacteria 2775506739 2775672535 131
18 iso_pu_bacteria 2816332188 2816873678 131
19 iso_pu_bacteria 2871720351 2871720767 131
20 iso_pu_bacteria 2889290771 2889291052 131
21 iso_pu_bacteria 2919097161 2919100647 131
22 iso_pu_bacteria 2919399522 2919400489 131
23 iso_pu_bacteria 2945924605 2945927924 131
24 iso_pu_bacteria 2946019816 2946021926 131
25 iso_pu_bacteria 2977243572 2977245726 131
26 3300037471 Ga0395905_0016039 Ga0395905_0016039_3612_4019 132
27 3300046457 Ga0495590_0006887 Ga0495590_0006887_3279_3686 132
28 iso_pu_bacteria 2511231000 2511231456 132
29 iso_pu_bacteria 2582581278 2585145502 132
30 iso_pu_bacteria 2582581281 2585158840 132
31 iso_pu_bacteria 2582581282 2585163128 132
32 iso_pu_bacteria 2582581873 2585425057 132
33 iso_pu_bacteria 2585428045 2587677650 132
34 iso_pu_bacteria 2585428045 2587677651 132
35 iso_pu_bacteria 2585428060 2587746802 132
36 iso_pu_bacteria 2585428061 2587750830 132
37 iso_pu_bacteria 2585428095 2587867984 132
38 iso_pu_bacteria 2585428115 2587943319 132
39 iso_pu_bacteria 2585428182 2588209569 132
40 iso_pu_bacteria 2585428183 2588213858 132
41 iso_pu_bacteria 2585428184 2588218525 132
42 iso_pu_bacteria 2585428185 2588225790 132
43 iso_pu_bacteria 2588253712 2588444966 132
44 iso_pu_bacteria 2588254255 2590604458 132
45 iso_pu_bacteria 2588254255 2590604459 132
46 iso_pu_bacteria 2588254257 2590612458 132
47 iso_pu_bacteria 2728369107 2729199176 132
48 iso_pu_bacteria 2765235839 2765573274 132
49 iso_pu_bacteria 2772190705 2772604862 132
50 iso_pu_bacteria 2775506739 2775672534 132
51 iso_pu_bacteria 2816332188 2816873677 132
52 iso_pu_bacteria 2842083920 2842085106 132
53 iso_pu_bacteria 2871720351 2871720768 132
54 iso_pu_bacteria 2889290771 2889291053 132
55 iso_pu_bacteria 2905999023 2905999622 132
56 iso_pu_bacteria 2919097161 2919100648 132
57 iso_pu_bacteria 2919399522 2919400490 132
58 3300003322 rootL2_10079963 rootL2_100799633 133
59 3300013104 Ga0157370_10243166 Ga0157370_102431663 133
60 3300017792 Ga0163161_10001964 Ga0163161_100019646 133
61 2162886007 SwRhRL2b_contig_3105950 SwRhRL2b_0486.00004310 134
62 3300005289 Ga0065704_10072081 Ga0065704_100720815 134
63 3300005344 Ga0070661_100587425 Ga0070661_1005874252 134
64 3300025920 Ga0207649_10256444 Ga0207649_102564441 134
65 3300003320 rootH2_10193247 rootH2_101932472 135
66 3300003322 rootL2_10027567 rootL2_100275672 135
67 3300003323 rootH1_10052264 rootH1_100522642 135
68 3300003784 Ga0055534_1014651 Ga0055534_10146512 135
69 3300005288 Ga0065714_10065186 Ga0065714_1006518615 135
70 3300005337 Ga0070682_100001169 Ga0070682_10000116914 135
71 3300005339 Ga0070660_100199141 Ga0070660_1001991412 135
72 3300005353 Ga0070669_100850459 Ga0070669_1008504592 135
73 3300005455 Ga0070663_101037355 Ga0070663_1010373551 135
74 3300009036 Ga0105244_10000050 Ga0105244_1000005078 135
75 3300013100 Ga0157373_10000005 Ga0157373_100000056 135
76 3300013100 Ga0157373_10381050 Ga0157373_103810502 135
77 3300013102 Ga0157371_10116911 Ga0157371_101169112 135
78 3300013104 Ga0157370_10010675 Ga0157370_100106753 135
79 3300013104 Ga0157370_10172705 Ga0157370_101727054 135
80 3300013104 Ga0157370_10284691 Ga0157370_102846913 135
81 3300013308 Ga0157375_10000222 Ga0157375_1000022214 135
82 3300014497 Ga0182008_10000060 Ga0182008_1000006024 135
83 3300017792 Ga0163161_10041815 Ga0163161_100418154 135
84 3300025291 Ga0209675_1000088 Ga0209675_1000088146 135
85 3300025728 Ga0207655_1000489 Ga0207655_10004893 135
86 3300025919 Ga0207657_10196283 Ga0207657_101962833 135
87 3300025972 Ga0207668_10277233 Ga0207668_102772332 135
88 3300026067 Ga0207678_11071087 Ga0207678_110710872 135
89 3300031911 Ga0307412_10002392 Ga0307412_1000239214 135
90 3300031911 Ga0307412_10002567 Ga0307412_100025678 135
91 3300032004 Ga0307414_10000032 Ga0307414_1000003298 135
92 3300032004 Ga0307414_10058011 Ga0307414_100580111 135
93 3300032004 Ga0307414_10061040 Ga0307414_100610403 135
94 3300041411 Ga0439466_0039858 Ga0439466_0039858_206_613 135
95 3300041413 Ga0439465_0001435 Ga0439465_0001435_849_1256 135
96 3300042004 Ga0439445_0000970 Ga0439445_0000970_319_726 135
97 3300042006 Ga0439432_155806 Ga0439432_155806_15_422 135
98 3300042437 Ga0439444_0088903 Ga0439444_0088903_199_606 135
99 3300046453 Ga0495627_000002 Ga0495627_000002_222958_223365 135
100 3300046500 Ga0495596_0002292 Ga0495596_0002292_8131_8538 135
101 3300046507 Ga0495606_0080817 Ga0495606_0080817_149_556 135
102 3300046519 Ga0495632_0001703 Ga0495632_0001703_4910_5317 135
103 3300046522 Ga0495643_0007522 Ga0495643_0007522_2970_3380 135
104 3300046525 Ga0495663_0000073 Ga0495663_0000073_45160_45639 135
105 3300046530 Ga0495654_0000001 Ga0495654_0000001_1257988_1258395 135
106 3300046538 Ga0495609_0000480 Ga0495609_0000480_7494_7901 135
107 3300046558 Ga0495633_0000002 Ga0495633_0000002_205628_206035 135
108 3300046558 Ga0495633_0001388 Ga0495633_0001388_13767_14174 135
109 3300046660 Ga0495625_0000899 Ga0495625_0000899_23208_23615 135
110 3300046810 Ga0495660_0343349 Ga0495660_0343349_185_592 135
111 3300047472 Ga0495686_0000095 Ga0495686_0000095_141005_141412 135
112 3300047472 Ga0495686_0016154 Ga0495686_0016154_3983_4390 135
113 3300048907 Ga0496104_0242729 Ga0496104_0242729_127_534 135
114 3300048908 Ga0496105_0670456 Ga0496105_0670456_222_629 135
115 3300048916 Ga0496113_0049090 Ga0496113_0049090_2348_2755 135
116 3300048919 Ga0496116_0000022 Ga0496116_0000022_68494_68901 135
117 3300048920 Ga0496117_0000074 Ga0496117_0000074_71889_72296 135
118 3300048921 Ga0496118_0001613 Ga0496118_0001613_21587_21994 135
119 3300048921 Ga0496118_0164020 Ga0496118_0164020_136_543 135
120 3300048922 Ga0496119_0000017 Ga0496119_0000017_160354_160761 135
121 3300048924 Ga0496121_0157312 Ga0496121_0157312_1011_1418 135
122 3300048925 Ga0496122_0000354 Ga0496122_0000354_47429_47836 135
123 3300048925 Ga0496122_0002282 Ga0496122_0002282_7338_7745 135
124 3300048926 Ga0496123_0001157 Ga0496123_0001157_24810_25217 135
125 3300048926 Ga0496123_0034782 Ga0496123_0034782_63_470 135
126 3300048927 Ga0496124_0007620 Ga0496124_0007620_5903_6310 135
127 3300048928 Ga0496125_0000156 Ga0496125_0000156_6484_6891 135
128 3300048928 Ga0496125_0007856 Ga0496125_0007856_370_777 135
129 3300048929 Ga0496126_0009304 Ga0496126_0009304_1817_2224 135
130 3300048929 Ga0496126_0227229 Ga0496126_0227229_149_556 135
131 3300049681 Ga0501251_036646 Ga0501251_036646_32_439 135
132 3300049758 Ga0501241_000015 Ga0501241_000015_4217_4624 135
133 3300049766 Ga0501269_000639 Ga0501269_000639_4429_4836 135
134 2162886007 SwRhRL2b_contig_1078572 SwRhRL2b_0101.00006910 136
135 3300001915 JGI24741J21665_1015994 JGI24741J21665_10159941 136
136 3300003322 rootL2_10027567 rootL2_100275673 136
137 3300003323 rootH1_10052264 rootH1_100522643 136
138 3300003784 Ga0055534_1014651 Ga0055534_10146513 136
139 3300004801 Ga0058860_10933392 Ga0058860_109333922 136
140 3300005289 Ga0065704_10133854 Ga0065704_101338543 136
141 3300005289 Ga0065704_10179404 Ga0065704_101794042 136
142 3300005337 Ga0070682_100001169 Ga0070682_10000116915 136
143 3300005339 Ga0070660_100199141 Ga0070660_1001991413 136
144 3300005347 Ga0070668_100030486 Ga0070668_1000304862 136
145 3300005347 Ga0070668_100030486 Ga0070668_1000304863 136
146 3300009036 Ga0105244_10000050 Ga0105244_1000005079 136
147 3300009092 Ga0105250_10042255 Ga0105250_100422552 136
148 3300009148 Ga0105243_10002981 Ga0105243_1000298113 136
149 3300009148 Ga0105243_10002981 Ga0105243_1000298114 136
150 3300013100 Ga0157373_10071918 Ga0157373_100719182 136
151 3300013102 Ga0157371_10116911 Ga0157371_101169113 136
152 3300013104 Ga0157370_10010675 Ga0157370_100106754 136
153 3300013104 Ga0157370_10048349 Ga0157370_100483494 136
154 3300013105 Ga0157369_10703316 Ga0157369_107033161 136
155 3300013308 Ga0157375_10000222 Ga0157375_1000022215 136
156 3300014497 Ga0182008_10000060 Ga0182008_1000006025 136
157 3300014968 Ga0157379_10577818 Ga0157379_105778182 136
158 3300015261 Ga0182006_1000012 Ga0182006_1000012109 136
159 3300017792 Ga0163161_10041815 Ga0163161_100418153 136
160 3300025273 Ga0209673_1108939 Ga0209673_11089391 136
161 3300025291 Ga0209675_1000088 Ga0209675_1000088145 136
162 3300025728 Ga0207655_1000489 Ga0207655_10004894 136
163 3300025919 Ga0207657_10196283 Ga0207657_101962832 136
164 3300025935 Ga0207709_10004569 Ga0207709_100045692 136
165 3300025972 Ga0207668_10030977 Ga0207668_100309774 136
166 3300025972 Ga0207668_10030977 Ga0207668_100309775 136
167 3300031911 Ga0307412_10000007 Ga0307412_10000007310 136
168 3300031911 Ga0307412_10002567 Ga0307412_100025677 136
169 3300032002 Ga0307416_100000003 Ga0307416_100000003215 136
170 3300032004 Ga0307414_10000032 Ga0307414_1000003297 136
171 3300032004 Ga0307414_10058011 Ga0307414_100580112 136
172 3300032004 Ga0307414_10137991 Ga0307414_101379913 136
173 3300032004 Ga0307414_10966034 Ga0307414_109660342 136
174 3300041413 Ga0439465_0001435 Ga0439465_0001435_1295_1705 136
175 3300046453 Ga0495627_000002 Ga0495627_000002_223405_223815 136
176 3300046460 Ga0495638_0381370 Ga0495638_0381370_73_483 136
177 3300046500 Ga0495596_0002292 Ga0495596_0002292_7697_8107 136
178 3300046507 Ga0495606_0030963 Ga0495606_0030963_2060_2470 136
179 3300046507 Ga0495606_0080817 Ga0495606_0080817_593_1006 136
180 3300046512 Ga0495610_0000009 Ga0495610_0000009_106302_106712 136
181 3300046522 Ga0495643_0066346 Ga0495643_0066346_1169_1579 136
182 3300046525 Ga0495663_0000309 Ga0495663_0000309_17810_18223 136
183 3300046525 Ga0495663_0013151 Ga0495663_0013151_1248_1658 136
184 3300046530 Ga0495654_0000001 Ga0495654_0000001_1258435_1258845 136
185 3300046538 Ga0495609_0000480 Ga0495609_0000480_7056_7466 136
186 3300046558 Ga0495633_0000002 Ga0495633_0000002_206077_206487 136
187 3300047472 Ga0495686_0000095 Ga0495686_0000095_140555_140965 136
188 3300047472 Ga0495686_0016154 Ga0495686_0016154_3533_3943 136
189 3300048905 Ga0496102_0826645 Ga0496102_0826645_254_664 136
190 3300048907 Ga0496104_0242729 Ga0496104_0242729_629_1039 136
191 3300048919 Ga0496116_0000022 Ga0496116_0000022_68996_69406 136
192 3300048920 Ga0496117_0000074 Ga0496117_0000074_72391_72801 136
193 3300048921 Ga0496118_0001613 Ga0496118_0001613_22089_22499 136
194 3300048922 Ga0496119_0000017 Ga0496119_0000017_159849_160259 136
195 3300048923 Ga0496120_0063361 Ga0496120_0063361_1367_1777 136
196 3300048925 Ga0496122_0000159 Ga0496122_0000159_34873_35283 136
197 3300048925 Ga0496122_0000159 Ga0496122_0000159_35439_35855 136
198 3300048925 Ga0496122_0000354 Ga0496122_0000354_46924_47334 136
199 3300048925 Ga0496122_0000357 Ga0496122_0000357_66457_66867 136
200 3300048925 Ga0496122_0001690 Ga0496122_0001690_23618_24031 136
201 3300048925 Ga0496122_0002282 Ga0496122_0002282_6833_7243 136
202 3300048926 Ga0496123_0001157 Ga0496123_0001157_25312_25722 136
203 3300048926 Ga0496123_0034782 Ga0496123_0034782_565_975 136
204 3300048926 Ga0496123_0072746 Ga0496123_0072746_1494_1904 136
205 3300048926 Ga0496123_0194340 Ga0496123_0194340_505_915 136
206 3300048927 Ga0496124_0007620 Ga0496124_0007620_5398_5808 136
207 3300048928 Ga0496125_0000156 Ga0496125_0000156_6986_7396 136
208 3300048928 Ga0496125_0007856 Ga0496125_0007856_872_1282 136
209 3300048929 Ga0496126_0009304 Ga0496126_0009304_2321_2731 136
210 3300048929 Ga0496126_0227229 Ga0496126_0227229_652_1062 136
211 3300049758 Ga0501241_000015 Ga0501241_000015_3769_4179 136
212 3300049766 Ga0501269_000639 Ga0501269_000639_4875_5285 136

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

149

0.96

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

29

67

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9423 2 134
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9204 2 136
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9156 2 134
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9073 2 136
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8655 1 128
ID Description Score Start End Superfamily
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9074 2 136 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8941 2 136 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8722 75 128 3.30.720.110
4pavC00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8426 5 128 3.10.180.10
3bqxA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8318 5 127 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A0K9XW78-F1-model_v4 Extradiol dioxygenase 0.9793 1 136 GO:0051213
AF-A0A562SHK4-F1-model_v4 VOC domain-containing protein 0.9762 1 135
AF-A0A223V8Q9-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.976 1 135 GO:0051213
AF-S2DD92-F1-model_v4 Glyoxalase family protein 0.9718 2 132
AF-A0A7Y6CS50-F1-model_v4 Glyoxalase 0.9698 4 128

Feature Viewer

pLDDT pTM Quality
89.86 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map