F323024

General Info

Members Datasets Scaffolds Average Seq Length
212 145 424 147

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100264024|Ga0307416_1002640242
Length 145
Sequence MSHVQRFDHVGITVADLDSATAFFVGLGLQVEGTGSVQGEFVETVCGIPGAHCQIAMLRAPDGGGLELSSFVTPDHVPGSPTAMANELGLRNVSFEVGDLQAAVDAVAEDGYGLIGGIGEYEGSVRMAYVRGPEGIIVSLFEQIG

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
29 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
30 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
35 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
67 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
68 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
79 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
80 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
83 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
84 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
85 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
86 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
87 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
95 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
96 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
97 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
105 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
135 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
138 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
139 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
140 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
141 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
142 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
143 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
144 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
145 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.23
Metatranscriptomes 0
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.91
Nodule 0
Rhizoplane 12.74
Rhizosphere 66.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100264024 3300032002 Bacteria 1685
2 Ga0070683_100263084 3300005329 Bacteria 1641
3 Ga0070673_101019575 3300005364 Bacteria 771
4 Ga0070659_100061346 3300005366 Bacteria 2972
5 Ga0070714_100004351 3300005435 Bacteria 10676
6 Ga0070714_100047526 3300005435 Bacteria 3646
7 Ga0070714_101104357 3300005435 Bacteria 773
8 Ga0070701_10313594 3300005438 Bacteria 968
9 Ga0070694_100000658 3300005444 Bacteria 19077
10 Ga0070694_100115450 3300005444 Bacteria 1919
11 Ga0070708_100001575 3300005445 Bacteria 17473
12 Ga0070708_100738863 3300005445 Bacteria 926
13 Ga0070708_101278196 3300005445 Bacteria 686
14 Ga0070707_100092544 3300005468 Bacteria 2927
15 Ga0070707_100604169 3300005468 Bacteria 1059
16 Ga0070698_100003236 3300005471 Bacteria 17928
17 Ga0070698_100273231 3300005471 Bacteria 1621
18 Ga0070699_100243342 3300005518 Bacteria 1606
19 Ga0070697_100032075 3300005536 Bacteria 4225
20 Ga0070697_100055699 3300005536 Bacteria 3215
21 Ga0070695_100052214 3300005545 Bacteria 2626
22 Ga0070704_100016089 3300005549 Bacteria 4718
23 Ga0068855_100167289 3300005563 Bacteria 2492
24 Ga0068861_100106252 3300005719 Bacteria 2242
25 Ga0068861_101037249 3300005719 Bacteria 785
26 Ga0081455_10034319 3300005937 Bacteria 4547
27 Ga0081540_1002946 3300005983 Bacteria 13677
28 Ga0070717_10422827 3300006028 Bacteria 1199
29 Ga0070717_10486488 3300006028 Bacteria 1114
30 Ga0075365_10063559 3300006038 Bacteria 2472
31 Ga0075365_10119064 3300006038 Bacteria 1820
32 Ga0075365_10391496 3300006038 Bacteria 980
33 Ga0075363_100012424 3300006048 Bacteria 4104
34 Ga0075363_100017070 3300006048 Bacteria 3594
35 Ga0075364_10374631 3300006051 Bacteria 971
36 Ga0070716_100496086 3300006173 Bacteria 900
37 Ga0070712_100480779 3300006175 Bacteria 1038
38 Ga0070712_100809786 3300006175 Bacteria 804
39 Ga0075367_10052996 3300006178 Bacteria 2403
40 Ga0075370_10053291 3300006353 Bacteria 2296
41 Ga0075370_10204229 3300006353 Bacteria 1166
42 Ga0075370_10209183 3300006353 Bacteria 1152
43 Ga0075435_100067590 3300007076 Bacteria 2910
44 Ga0099795_10181395 3300007788 Bacteria 879
45 Ga0105244_10083580 3300009036 Bacteria 1578
46 Ga0105242_11350701 3300009176 Bacteria 738
47 Ga0105248_11102031 3300009177 Bacteria 897
48 Ga0105249_10020057 3300009553 Bacteria 5971
49 Ga0105249_10070649 3300009553 Bacteria 3223
50 Ga0105249_10395540 3300009553 Bacteria 1411
51 Ga0105239_10592812 3300010375 Bacteria 1264
52 Ga0105239_11382089 3300010375 Bacteria 813
53 Ga0157327_1052250 3300012512 Bacteria 585
54 Ga0157338_1010523 3300012515 Bacteria 935
55 Ga0157378_11725538 3300013297 Bacteria 673
56 Ga0163162_10443156 3300013306 Bacteria 1431
57 Ga0163162_10913993 3300013306 Bacteria 990
58 Ga0157375_10712098 3300013308 Bacteria 1157
59 Ga0157377_10706437 3300014745 Bacteria 733
60 Ga0157376_11338779 3300014969 Bacteria 747
61 Ga0213874_10050917 3300021377 Bacteria 1270
62 Ga0213874_10335160 3300021377 Bacteria 577
63 Ga0213876_10057584 3300021384 Bacteria 2052
64 Ga0213876_10360404 3300021384 Bacteria 773
65 Ga0213875_10042110 3300021388 Bacteria 2146
66 Ga0213875_10064827 3300021388 Bacteria 1707
67 Ga0207684_10002123 3300025910 Bacteria 20330
68 Ga0207684_10032691 3300025910 Bacteria 4423
69 Ga0207693_10604922 3300025915 Bacteria 853
70 Ga0207646_10000031 3300025922 Bacteria 219144
71 Ga0207646_10128737 3300025922 Bacteria 2277
72 Ga0207646_10148259 3300025922 Bacteria 2115
73 Ga0207687_10845136 3300025927 Bacteria 782
74 Ga0207664_10079195 3300025929 Bacteria 2667
75 Ga0207664_10405098 3300025929 Bacteria 1213
76 Ga0207664_11058174 3300025929 Bacteria 726
77 Ga0207690_10124004 3300025932 Bacteria 1881
78 Ga0207686_11444654 3300025934 Bacteria 566
79 Ga0207709_10114385 3300025935 Bacteria 1810
80 Ga0207665_10585786 3300025939 Bacteria 870
81 Ga0207711_10333223 3300025941 Bacteria 1404
82 Ga0207661_10241745 3300025944 Bacteria 1602
83 Ga0207667_10338214 3300025949 Bacteria 1536
84 Ga0207712_10024579 3300025961 Bacteria 3992
85 Ga0207668_10728178 3300025972 Bacteria 874
86 Ga0207675_100144863 3300026118 Bacteria 2258
87 Ga0207675_100518018 3300026118 Bacteria 1188
88 Ga0207698_10336461 3300026142 Bacteria 1420
89 Ga0209588_1084332 3300027671 Bacteria 1026
90 Ga0268265_10204386 3300028380 Bacteria 1716
91 Ga0307408_100719402 3300031548 Bacteria 899
92 Ga0307407_10026030 3300031903 Bacteria 3093
93 Ga0307416_100599195 3300032002 Bacteria 1181
94 Ga0307411_10670507 3300032005 Bacteria 900
95 Ga0307411_11511773 3300032005 Bacteria 617
96 Ga0307415_100132918 3300032126 Bacteria 1887
97 Ga0373933_0142664 3300035724 Bacteria 1513
98 Ga0373947_0736539 3300035725 Bacteria 673
99 Ga0373937_0263845 3300036401 Bacteria 1624
100 Ga0373937_1059604 3300036401 Bacteria 760
101 Ga0395899_0010685 3300037312 Bacteria 7036
102 Ga0395900_0115486 3300037418 Bacteria 2754
103 Ga0395900_0467701 3300037418 Bacteria 1215
104 Ga0395898_0720304 3300037466 Bacteria 939
105 Ga0395905_0264315 3300037471 Bacteria 1606
106 Ga0436364_0194779 3300037853 Bacteria 3498
107 Ga0436364_0228757 3300037853 Bacteria 6132
108 Ga0436364_0382755 3300037853 Bacteria 1320
109 Ga0436365_0170420 3300039437 Bacteria 9854
110 Ga0436365_0351997 3300039437 Bacteria 2035
111 Ga0436365_0540902 3300039437 Bacteria 1369
112 Ga0436365_0604860 3300039437 Bacteria 924
113 Ga0436365_0975894 3300039437 Bacteria 836
114 Ga0436363_0679694 3300039450 Bacteria 61452
115 Ga0436363_1430547 3300039450 Bacteria 1429
116 Ga0436362_0321003 3300039453 Bacteria 2129
117 Ga0436362_0514851 3300039453 Bacteria 595
118 Ga0439466_0061454 3300041411 Bacteria 1209
119 Ga0451798_1079429 3300041458 Bacteria 916
120 Ga0451833_0944563 3300041491 Bacteria 629
121 Ga0439433_0122984 3300041999 Bacteria 655
122 Ga0439449_0004677 3300042007 Bacteria 5287
123 Ga0439434_0107974 3300042435 Bacteria 900
124 Ga0466965_0538735 3300044683 Bacteria 658
125 Ga0466966_0793799 3300044684 Bacteria 571
126 Ga0466961_0493316 3300044693 Bacteria 740
127 Ga0466963_0006658 3300044694 Bacteria 6861
128 Ga0466963_0473159 3300044694 Bacteria 884
129 Ga0466963_0917903 3300044694 Bacteria 617
130 Ga0466971_0216473 3300044719 Bacteria 907
131 Ga0466970_0064819 3300044765 Bacteria 1960
132 Ga0466970_0109846 3300044765 Bacteria 1505
133 Ga0466957_0718397 3300044842 Bacteria 706
134 Ga0466960_0019517 3300044901 Bacteria 2989
135 Ga0466959_0242627 3300045049 Bacteria 1244
136 Ga0466959_0536448 3300045049 Bacteria 790
137 Ga0466958_0097212 3300045836 Bacteria 1827
138 Ga0466967_0187274 3300045976 Bacteria 1955
139 Ga0466967_0267458 3300045976 Bacteria 1637
140 Ga0466967_1820847 3300045976 Bacteria 606
141 Ga0466967_1894504 3300045976 Bacteria 593
142 Ga0495629_0098325 3300046459 Bacteria 2042
143 Ga0495641_0205404 3300046461 Bacteria 883
144 Ga0495596_0235451 3300046500 Bacteria 711
145 Ga0495620_0364020 3300046515 Bacteria 548
146 Ga0495630_1211349 3300046517 Bacteria 571
147 Ga0495640_0555374 3300046533 Bacteria 696
148 Ga0495656_0438964 3300046615 Bacteria 687
149 Ga0495668_0003059 3300046616 Bacteria 12975
150 Ga0495634_0787287 3300046642 Bacteria 543
151 Ga0495599_0083333 3300046678 Bacteria 1997
152 Ga0495658_0357202 3300046683 Bacteria 929
153 Ga0495581_0298003 3300047315 Bacteria 942
154 Ga0495674_0154948 3300047319 Bacteria 1920
155 Ga0495674_0229176 3300047319 Bacteria 1534
156 Ga0495676_0427664 3300047321 Bacteria 876
157 Ga0495677_0180411 3300047445 Bacteria 818
158 Ga0496101_0168794 3300048904 Bacteria 1681
159 Ga0496102_0021211 3300048905 Bacteria 5745
160 Ga0496102_1020513 3300048905 Bacteria 748
161 Ga0496104_0546192 3300048907 Bacteria 1069
162 Ga0496105_0032965 3300048908 Bacteria 4253
163 Ga0496105_0051056 3300048908 Bacteria 3417
164 Ga0496106_0387209 3300048909 Bacteria 1123
165 Ga0496107_0222264 3300048910 Bacteria 1405
166 Ga0496107_0749952 3300048910 Bacteria 716
167 Ga0496108_0515466 3300048911 Bacteria 1044
168 Ga0496108_0813592 3300048911 Bacteria 806
169 Ga0496109_0017926 3300048912 Bacteria 6215
170 Ga0496109_1179250 3300048912 Bacteria 703
171 Ga0496110_0320000 3300048913 Bacteria 1413
172 Ga0496110_1041726 3300048913 Bacteria 726
173 Ga0496110_1086346 3300048913 Bacteria 708
174 Ga0496111_0059422 3300048914 Bacteria 2770
175 Ga0496111_0396758 3300048914 Bacteria 1020
176 Ga0496111_0532562 3300048914 Bacteria 863
177 Ga0496111_0611844 3300048914 Bacteria 797
178 Ga0496112_0163710 3300048915 Bacteria 2190
179 Ga0496113_0551181 3300048916 Bacteria 925
180 Ga0496114_0942213 3300048917 Bacteria 746
181 Ga0496114_1152970 3300048917 Bacteria 661
182 Ga0496115_0042935 3300048918 Bacteria 3604
183 Ga0496115_0457608 3300048918 Bacteria 1030
184 Ga0496125_0059452 3300048928 Bacteria 3079
185 Ga0501067_0100379 3300049583 Bacteria 1608
186 Ga0501067_0116014 3300049583 Bacteria 1489
187 Ga0501068_0351342 3300049584 Bacteria 947
188 Ga0501074_0261957 3300049590 Bacteria 1229
189 nmdc:mga03n38_32316_c1 3300050490 Bacteria 2216
190 nmdc:mga03n38_49277_c1 3300050490 Bacteria 1872
191 nmdc:mga00v17_1233_c1 3300050491 Bacteria 13427
192 nmdc:mga00v17_414855_c1 3300050491 Bacteria 874
193 nmdc:mga0yw44_114358_c1 3300050492 Bacteria 1732
194 nmdc:mga0yw44_84068_c1 3300050492 Bacteria 2000
195 nmdc:mga06z11_24878_c1 3300050494 Bacteria 2830
196 nmdc:mga07m45_223669_c1 3300050496 Bacteria 1095
197 nmdc:mga07m45_86345_c1 3300050496 Bacteria 1795
198 nmdc:mga08x19_147183_c1 3300050514 Bacteria 1594
199 Ga0495595_0346866 3300053084 Bacteria 749
200 Ga0500593_000181 3300053117 Bacteria 25642
201 Ga0500573_0005996 3300053140 Bacteria 6541
202 Ga0466962_0378390 3300061719 Bacteria 707
203 Ga0466962_0457730 3300061719 Bacteria 643
204 Ga0530510_0078395 3300061734 Bacteria 2402
205 2566993290 2565956761 Bacteria 6601618
206 2738889038 2738541308 Bacteria 7020677
207 2739239919 2738543011 Bacteria 5731169
208 2889302696 2889300758 Bacteria 5690814
209 2904537097 2904535858 Bacteria 6308016
210 2919053175 2919051321 Bacteria 4210889
211 2928147253 2928142448 Bacteria 5288925
212 2939747915 2939743619 Bacteria 5762299
213 Ga0307416_100264024
214 Ga0070683_100263084
215 Ga0070673_101019575
216 Ga0070659_100061346
217 Ga0070714_100004351
218 Ga0070714_100047526
219 Ga0070714_101104357
220 Ga0070701_10313594
221 Ga0070694_100000658
222 Ga0070694_100115450
223 Ga0070708_100001575
224 Ga0070708_100738863
225 Ga0070708_101278196
226 Ga0070707_100092544
227 Ga0070707_100604169
228 Ga0070698_100003236
229 Ga0070698_100273231
230 Ga0070699_100243342
231 Ga0070697_100032075
232 Ga0070697_100055699
233 Ga0070695_100052214
234 Ga0070704_100016089
235 Ga0068855_100167289
236 Ga0068861_100106252
237 Ga0068861_101037249
238 Ga0081455_10034319
239 Ga0081540_1002946
240 Ga0070717_10422827
241 Ga0070717_10486488
242 Ga0075365_10063559
243 Ga0075365_10119064
244 Ga0075365_10391496
245 Ga0075363_100012424
246 Ga0075363_100017070
247 Ga0075364_10374631
248 Ga0070716_100496086
249 Ga0070712_100480779
250 Ga0070712_100809786
251 Ga0075367_10052996
252 Ga0075370_10053291
253 Ga0075370_10204229
254 Ga0075370_10209183
255 Ga0075435_100067590
256 Ga0099795_10181395
257 Ga0105244_10083580
258 Ga0105242_11350701
259 Ga0105248_11102031
260 Ga0105249_10020057
261 Ga0105249_10070649
262 Ga0105249_10395540
263 Ga0105239_10592812
264 Ga0105239_11382089
265 Ga0157327_1052250
266 Ga0157338_1010523
267 Ga0157378_11725538
268 Ga0163162_10443156
269 Ga0163162_10913993
270 Ga0157375_10712098
271 Ga0157377_10706437
272 Ga0157376_11338779
273 Ga0213874_10050917
274 Ga0213874_10335160
275 Ga0213876_10057584
276 Ga0213876_10360404
277 Ga0213875_10042110
278 Ga0213875_10064827
279 Ga0207684_10002123
280 Ga0207684_10032691
281 Ga0207693_10604922
282 Ga0207646_10000031
283 Ga0207646_10128737
284 Ga0207646_10148259
285 Ga0207687_10845136
286 Ga0207664_10079195
287 Ga0207664_10405098
288 Ga0207664_11058174
289 Ga0207690_10124004
290 Ga0207686_11444654
291 Ga0207709_10114385
292 Ga0207665_10585786
293 Ga0207711_10333223
294 Ga0207661_10241745
295 Ga0207667_10338214
296 Ga0207712_10024579
297 Ga0207668_10728178
298 Ga0207675_100144863
299 Ga0207675_100518018
300 Ga0207698_10336461
301 Ga0209588_1084332
302 Ga0268265_10204386
303 Ga0307408_100719402
304 Ga0307407_10026030
305 Ga0307416_100599195
306 Ga0307411_10670507
307 Ga0307411_11511773
308 Ga0307415_100132918
309 Ga0373933_0142664
310 Ga0373947_0736539
311 Ga0373937_0263845
312 Ga0373937_1059604
313 Ga0395899_0010685
314 Ga0395900_0115486
315 Ga0395900_0467701
316 Ga0395898_0720304
317 Ga0395905_0264315
318 Ga0436364_0194779
319 Ga0436364_0228757
320 Ga0436364_0382755
321 Ga0436365_0170420
322 Ga0436365_0351997
323 Ga0436365_0540902
324 Ga0436365_0604860
325 Ga0436365_0975894
326 Ga0436363_0679694
327 Ga0436363_1430547
328 Ga0436362_0321003
329 Ga0436362_0514851
330 Ga0439466_0061454
331 Ga0451798_1079429
332 Ga0451833_0944563
333 Ga0439433_0122984
334 Ga0439449_0004677
335 Ga0439434_0107974
336 Ga0466965_0538735
337 Ga0466966_0793799
338 Ga0466961_0493316
339 Ga0466963_0006658
340 Ga0466963_0473159
341 Ga0466963_0917903
342 Ga0466971_0216473
343 Ga0466970_0064819
344 Ga0466970_0109846
345 Ga0466957_0718397
346 Ga0466960_0019517
347 Ga0466959_0242627
348 Ga0466959_0536448
349 Ga0466958_0097212
350 Ga0466967_0187274
351 Ga0466967_0267458
352 Ga0466967_1820847
353 Ga0466967_1894504
354 Ga0495629_0098325
355 Ga0495641_0205404
356 Ga0495596_0235451
357 Ga0495620_0364020
358 Ga0495630_1211349
359 Ga0495640_0555374
360 Ga0495656_0438964
361 Ga0495668_0003059
362 Ga0495634_0787287
363 Ga0495599_0083333
364 Ga0495658_0357202
365 Ga0495581_0298003
366 Ga0495674_0154948
367 Ga0495674_0229176
368 Ga0495676_0427664
369 Ga0495677_0180411
370 Ga0496101_0168794
371 Ga0496102_0021211
372 Ga0496102_1020513
373 Ga0496104_0546192
374 Ga0496105_0032965
375 Ga0496105_0051056
376 Ga0496106_0387209
377 Ga0496107_0222264
378 Ga0496107_0749952
379 Ga0496108_0515466
380 Ga0496108_0813592
381 Ga0496109_0017926
382 Ga0496109_1179250
383 Ga0496110_0320000
384 Ga0496110_1041726
385 Ga0496110_1086346
386 Ga0496111_0059422
387 Ga0496111_0396758
388 Ga0496111_0532562
389 Ga0496111_0611844
390 Ga0496112_0163710
391 Ga0496113_0551181
392 Ga0496114_0942213
393 Ga0496114_1152970
394 Ga0496115_0042935
395 Ga0496115_0457608
396 Ga0496125_0059452
397 Ga0501067_0100379
398 Ga0501067_0116014
399 Ga0501068_0351342
400 Ga0501074_0261957
401 nmdc:mga03n38_32316_c1
402 nmdc:mga03n38_49277_c1
403 nmdc:mga00v17_1233_c1
404 nmdc:mga00v17_414855_c1
405 nmdc:mga0yw44_114358_c1
406 nmdc:mga0yw44_84068_c1
407 nmdc:mga06z11_24878_c1
408 nmdc:mga07m45_223669_c1
409 nmdc:mga07m45_86345_c1
410 nmdc:mga08x19_147183_c1
411 Ga0495595_0346866
412 Ga0500593_000181
413 Ga0500573_0005996
414 Ga0466962_0378390
415 Ga0466962_0457730
416 Ga0530510_0078395
417 2566993290
418 2738889038
419 2739239919
420 2889302696
421 2904537097
422 2919053175
423 2928147253
424 2939747915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

140

0.9

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

8

129

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.7689 113 144
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.7686 113 144
2r5v-assembly2.cif.gz_B hydroxymandelate synthase crystal structure 0.7536 2 146
8im2-assembly2.cif.gz_F crystal structure of human hppd complexed with ntbc 0.7511 2 145
1sqi-assembly1.cif.gz_A structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases 0.7308 4 145
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8412 93 145 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.802 93 146 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7907 93 145 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7902 93 145 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7793 93 146 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A6J4RTX7-F1-model_v4 Glyoxalase family protein 0.9811 8 69
AF-A0A6A8VRK5-F1-model_v4 deleted 0.978 4 77
AF-A0A517VGR3-F1-model_v4 Glyoxalase-like domain protein 0.9742 1 75
AF-A0A4Q6BND0-F1-model_v4 VOC family protein 0.9696 1 69
AF-A0A1H4K072-F1-model_v4 VOC domain-containing protein 0.9627 2 146 GO:0004493
GO:0046491

Map