F322982

General Info

Members Datasets Scaffolds Average Seq Length
212 158 424 230

Family's Representative Sequence

Representative Sequence 3300030522|Ga0307512_10025992|Ga0307512_100259923
Length 258
Sequence MTDKARKRAAGDRVGRMTSPSEAPEETRSAVPYGTPAAPRIAVRGEAHLEVDPEIARIGITVSARGTDRRDALTDLTRRNATALDLVKTYGDAVERLETGAFSITPELTKHGRGERIRAYHGRVHITAELTDFTALGELTTRLADLDLTRVDGPWWALRPDSPAHRRARQQAVREXXXXAREYAEALGTTLAALVELADIGAENAHPYGMEAQAARSMRTMAFDASAPEGAPALDLEPERQHVYAQVNARFTMAPPEL

Samples

Sample ID Description Type Environment
1 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
2 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
3 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
4 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
5 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
6 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
7 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
8 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
9 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
10 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
11 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
12 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
13 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
14 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
15 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
16 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
17 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
18 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
19 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
20 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
21 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
22 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
23 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
24 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
25 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
26 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
27 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
28 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
29 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
30 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
31 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
32 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
33 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
34 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
35 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
36 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
37 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
38 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
39 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
40 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
41 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
42 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
43 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
44 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
45 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
46 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
47 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
48 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
49 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
50 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
51 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
52 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
53 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
54 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
55 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
56 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
57 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
58 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
59 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
60 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
61 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
62 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
70 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
76 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
77 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
78 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
79 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
80 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
81 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
82 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
87 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
101 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
105 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
117 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
118 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
119 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
120 2643221647 Streptomyces sp. Root369 Isolate Unclassified
121 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
122 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
123 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
124 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
125 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
126 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
127 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
128 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
129 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
130 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
131 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
132 2862574272 Streptomyces sp. AcE210 Isolate Nodule
133 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
134 2867369537 Streptomyces sp. Z26 Isolate Unclassified
135 2867428634 Streptomyces sp. RP5T Isolate Unclassified
136 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
137 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
138 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
139 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
140 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
141 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
142 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
143 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
144 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
145 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
146 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
147 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
148 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
149 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
150 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
151 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
152 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
153 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
154 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
155 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
156 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
157 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
158 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.72
Metatranscriptomes 0
Isolates 20.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 1.42
Rhizoplane 0.47
Rhizosphere 80.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307512_10025992 3300030522 Bacteria 5174
2 Ga0068857_100406989 3300005577 Bacteria 1267
3 Ga0075370_10077718 3300006353 Bacteria 1905
4 Ga0105246_10005332 3300011119 Bacteria 7828
5 Ga0182008_10007297 3300014497 Bacteria 6114
6 Ga0182007_10010356 3300015262 Bacteria 3691
7 Ga0182005_1056074 3300015265 Bacteria 1074
8 Ga0183367_1007 3300015688 Bacteria 498079
9 Ga0307517_10004661 3300028786 Bacteria 21021
10 Ga0307515_10008399 3300028794 Bacteria 20135
11 Ga0268256_1028028 3300030500 Bacteria 1396
12 Ga0307511_10006903 3300030521 Bacteria 11443
13 Ga0307512_10090463 3300030522 Bacteria 2134
14 Ga0307513_10010653 3300031456 Bacteria 11501
15 Ga0307513_10054765 3300031456 Bacteria 4274
16 Ga0307509_10059779 3300031507 Bacteria 4031
17 Ga0307508_10103896 3300031616 Bacteria 2438
18 Ga0307514_10006436 3300031649 Bacteria 10241
19 Ga0307514_10096959 3300031649 Bacteria 2129
20 Ga0307514_10156028 3300031649 Bacteria 1521
21 Ga0307518_10128028 3300031838 Bacteria 1788
22 Ga0307518_10371091 3300031838 Bacteria 819
23 Ga0307507_10026673 3300033179 Bacteria 6216
24 Ga0307507_10029004 3300033179 Bacteria 5879
25 Ga0307507_10098646 3300033179 Bacteria 2458
26 Ga0395900_0435956 3300037418 Bacteria 1269
27 Ga0395898_0031019 3300037466 Bacteria 5346
28 Ga0439436_0000670 3300041404 Bacteria 9171
29 Ga0439436_0003098 3300041404 Bacteria 5041
30 Ga0439439_0010476 3300041406 Bacteria 2217
31 Ga0451802_0505829 3300041460 Bacteria 2665
32 Ga0451837_0250012 3300041494 Bacteria 1778
33 Ga0451853_0188415 3300041512 Bacteria 5439
34 Ga0451853_0884962 3300041512 Bacteria 6618
35 Ga0451853_1309389 3300041512 Bacteria 2928
36 Ga0439433_0007562 3300041999 Bacteria 2347
37 Ga0439442_018832 3300042002 Bacteria 1428
38 Ga0439449_0029831 3300042007 Bacteria 2032
39 Ga0439457_000095 3300042014 Bacteria 20373
40 Ga0439457_005204 3300042014 Bacteria 3299
41 Ga0450894_001863 3300042131 Bacteria 2923
42 Ga0450903_000250 3300042138 Bacteria 11984
43 Ga0439458_0000561 3300042157 Bacteria 9548
44 Ga0439458_0036446 3300042157 Bacteria 1184
45 Ga0439458_0063577 3300042157 Bacteria 924
46 Ga0466972_0004856 3300044658 Bacteria 6742
47 Ga0466972_0006937 3300044658 Bacteria 5681
48 Ga0466965_0004668 3300044683 Bacteria 6109
49 Ga0466966_0004300 3300044684 Bacteria 9395
50 Ga0466961_0009387 3300044693 Bacteria 6233
51 Ga0466961_0225760 3300044693 Bacteria 1153
52 Ga0466963_0034068 3300044694 Bacteria 3312
53 Ga0466964_0007660 3300044706 Bacteria 4040
54 Ga0466971_0000186 3300044719 Bacteria 23665
55 Ga0466970_0007499 3300044765 Bacteria 5473
56 Ga0466957_0000142 3300044842 Bacteria 30899
57 Ga0466960_0023559 3300044901 Bacteria 2765
58 Ga0466958_0003556 3300045836 Bacteria 8107
59 Ga0495617_003689 3300046452 Bacteria 5709
60 Ga0495627_030305 3300046453 Bacteria 1715
61 Ga0495592_0019923 3300046454 Bacteria 5100
62 Ga0495603_0010991 3300046455 Bacteria 5491
63 Ga0495603_0012364 3300046455 Bacteria 5168
64 Ga0495603_0136480 3300046455 Bacteria 1427
65 Ga0495629_0014844 3300046459 Bacteria 5603
66 Ga0495629_0041709 3300046459 Bacteria 3228
67 Ga0495629_0068956 3300046459 Bacteria 2467
68 Ga0495638_0083825 3300046460 Bacteria 1930
69 Ga0495651_0030801 3300046462 Bacteria 4183
70 Ga0495580_0219295 3300046472 Bacteria 1307
71 Ga0495605_0017637 3300046474 Bacteria 3839
72 Ga0495662_0010614 3300046476 Bacteria 4505
73 Ga0495662_0052980 3300046476 Bacteria 1959
74 Ga0495664_0001685 3300046477 Bacteria 11752
75 Ga0495585_0156202 3300046492 Bacteria 1186
76 Ga0495594_0048905 3300046499 Bacteria 2323
77 Ga0495594_0086156 3300046499 Bacteria 1757
78 Ga0495594_0108694 3300046499 Bacteria 1563
79 Ga0495607_0004800 3300046501 Bacteria 9863
80 Ga0495583_0157755 3300046506 Bacteria 937
81 Ga0495606_0048375 3300046507 Bacteria 2797
82 Ga0495608_0064683 3300046511 Bacteria 2397
83 Ga0495610_0036901 3300046512 Bacteria 2493
84 Ga0495616_0020840 3300046513 Bacteria 3560
85 Ga0495618_0055187 3300046514 Bacteria 2515
86 Ga0495620_0083260 3300046515 Bacteria 1291
87 Ga0495620_0123797 3300046515 Bacteria 1017
88 Ga0495628_0169583 3300046516 Bacteria 1655
89 Ga0495628_0206531 3300046516 Bacteria 1478
90 Ga0495630_0043404 3300046517 Bacteria 3359
91 Ga0495631_0002506 3300046518 Bacteria 10336
92 Ga0495643_0005293 3300046522 Bacteria 8762
93 Ga0495644_0049228 3300046523 Bacteria 1582
94 Ga0495648_0140037 3300046524 Bacteria 1274
95 Ga0495648_0190382 3300046524 Bacteria 1035
96 Ga0495652_0096039 3300046529 Bacteria 2414
97 Ga0495640_0022236 3300046533 Bacteria 4639
98 Ga0495645_0179033 3300046543 Bacteria 1454
99 Ga0495645_0263367 3300046543 Bacteria 1140
100 Ga0495622_0023090 3300046557 Bacteria 2899
101 Ga0495622_0063137 3300046557 Bacteria 1714
102 Ga0495633_0043120 3300046558 Bacteria 2140
103 Ga0495634_0013918 3300046642 Bacteria 5813
104 Ga0495634_0279374 3300046642 Bacteria 1014
105 Ga0495611_0042220 3300046648 Bacteria 2036
106 Ga0495611_0047229 3300046648 Bacteria 1931
107 Ga0495625_0012343 3300046660 Bacteria 6927
108 Ga0495625_0131110 3300046660 Bacteria 1698
109 Ga0495635_0002533 3300046663 Bacteria 12500
110 Ga0495588_0003495 3300046674 Bacteria 6848
111 Ga0495657_0009254 3300046675 Bacteria 7477
112 Ga0495599_0106017 3300046678 Bacteria 1751
113 Ga0495599_0151553 3300046678 Bacteria 1436
114 Ga0495646_0015021 3300046680 Bacteria 4918
115 Ga0495646_0031890 3300046680 Bacteria 3281
116 Ga0495613_0054339 3300046689 Bacteria 2944
117 Ga0495613_0105545 3300046689 Bacteria 2033
118 Ga0495624_0029814 3300046690 Bacteria 3556
119 Ga0495624_0249906 3300046690 Bacteria 1072
120 Ga0495671_0003017 3300046692 Bacteria 10466
121 Ga0495671_0111516 3300046692 Bacteria 1336
122 Ga0495649_0074258 3300046694 Bacteria 1821
123 Ga0495589_0060231 3300046794 Bacteria 1864
124 Ga0495589_0124933 3300046794 Bacteria 1237
125 Ga0495589_0157513 3300046794 Bacteria 1082
126 Ga0495589_0167189 3300046794 Bacteria 1046
127 Ga0495600_0064691 3300046809 Bacteria 2390
128 Ga0495600_0157390 3300046809 Bacteria 1469
129 Ga0495660_0081925 3300046810 Bacteria 1690
130 Ga0495660_0156618 3300046810 Bacteria 1120
131 Ga0495604_0000463 3300047317 Bacteria 36017
132 Ga0495636_0004615 3300047318 Bacteria 5403
133 Ga0495636_0049670 3300047318 Bacteria 1754
134 Ga0495674_0030398 3300047319 Bacteria 4911
135 Ga0495672_0029267 3300047320 Bacteria 3472
136 Ga0495676_0001882 3300047321 Bacteria 18410
137 Ga0495676_0037684 3300047321 Bacteria 4021
138 Ga0495676_0044022 3300047321 Bacteria 3647
139 Ga0495680_0166087 3300047322 Bacteria 1600
140 Ga0495683_0182439 3300047323 Bacteria 957
141 Ga0495687_003207 3300047443 Bacteria 12119
142 Ga0495687_008019 3300047443 Bacteria 6109
143 Ga0495687_064976 3300047443 Bacteria 1487
144 Ga0495687_106732 3300047443 Bacteria 1038
145 Ga0495687_110960 3300047443 Bacteria 1008
146 Ga0495675_0111160 3300047444 Bacteria 1710
147 Ga0495685_011434 3300047447 Bacteria 2994
148 Ga0495685_033774 3300047447 Bacteria 1757
149 Ga0495685_040431 3300047447 Bacteria 1595
150 Ga0495685_064079 3300047447 Bacteria 1236
151 Ga0495681_0009883 3300047470 Bacteria 5831
152 Ga0495593_0018894 3300047673 Bacteria 3867
153 Ga0495602_0004050 3300048088 Bacteria 15267
154 Ga0495614_0047870 3300048089 Bacteria 1833
155 Ga0495614_0104357 3300048089 Bacteria 1241
156 Ga0495614_0134358 3300048089 Bacteria 1096
157 Ga0495626_0055764 3300048091 Bacteria 1810
158 Ga0495682_0005566 3300049460 Bacteria 5214
159 Ga0501031_0111094 3300049568 Bacteria 1790
160 Ga0501034_0246789 3300049571 Bacteria 1730
161 Ga0501038_0014466 3300049574 Bacteria 7191
162 Ga0501043_0070358 3300049579 Bacteria 2748
163 Ga0501047_0023473 3300049581 Bacteria 5921
164 Ga0501047_0225385 3300049581 Bacteria 1729
165 Ga0501080_0203130 3300049742 Bacteria 1819
166 Ga0501035_0040233 3300049822 Bacteria 4226
167 Ga0501044_0014797 3300049823 Bacteria 8411
168 Ga0501044_0155021 3300049823 Bacteria 2270
169 Ga0466962_0003371 3300061719 Bacteria 7603
170 2585306682 2582581313 Bacteria 10042643
171 2585314215 2582581314 Bacteria 11452267
172 2616694159 2616644814 Bacteria 11555299
173 2616899310 2616644941 Bacteria 8510691
174 2644270999 2643221647 Bacteria 10741251
175 2785345063 2784746763 Bacteria 9783172
176 2785367820 2784746768 Bacteria 10036182
177 2786668864 2786546132 Bacteria 10419719
178 2808919056 2808606375 Bacteria 9466072
179 2811847482 2808606982 Bacteria 7791042
180 2812359706 2811994879 Bacteria 9313447
181 2812481815 2811994917 Bacteria 7761064
182 2852638315 2852635781 Bacteria 8251373
183 2862183084 2862178590 Bacteria 8583590
184 2862288817 2862281513 Bacteria 9621493
185 2862391209 2862382967 Bacteria 10317375
186 2862583088 2862574272 Bacteria 10567477
187 2863406321 2863404153 Bacteria 9672205
188 2867370521 2867369537 Bacteria 6501581
189 2867432387 2867428634 Bacteria 9590268
190 2873157133 2873151551 Bacteria 8625867
191 2877682738 2877676314 Bacteria 9512378
192 2912721755 2912715099 Bacteria 9460473
193 2912759397 2912757875 Bacteria 7940295
194 2919473078 2919468124 Bacteria 9133025
195 2935395562 2935390628 Bacteria 7043367
196 2946066204 2946064051 Bacteria 8957905
197 2947231169 2947224130 Bacteria 9938529
198 2954004473 2954002825 Bacteria 9173742
199 2954387931 2954380949 Bacteria 10050426
200 2954675143 2954673503 Bacteria 9685905
201 2954688992 2954682443 Bacteria 9862841
202 2954698741 2954691527 Bacteria 10720516
203 2954703481 2954701450 Bacteria 10834262
204 2990061840 2990059506 Bacteria 9321252
205 2997458658 2997451912 Bacteria 8492419
206 3006396041 3006393351 Bacteria 6615579
207 3006492267 3006486233 Bacteria 8157040
208 8008561985 8008558824 Bacteria 10610750
209 8025535491 8025530807 Bacteria 8495698
210 8048410008 8048406513 Bacteria 8936924
211 8054163556 8054160619 Bacteria 7783213
212 8056667671 8056667051 Bacteria 6953971
213 Ga0307512_10025992
214 Ga0068857_100406989
215 Ga0075370_10077718
216 Ga0105246_10005332
217 Ga0182008_10007297
218 Ga0182007_10010356
219 Ga0182005_1056074
220 Ga0183367_1007
221 Ga0307517_10004661
222 Ga0307515_10008399
223 Ga0268256_1028028
224 Ga0307511_10006903
225 Ga0307512_10090463
226 Ga0307513_10010653
227 Ga0307513_10054765
228 Ga0307509_10059779
229 Ga0307508_10103896
230 Ga0307514_10006436
231 Ga0307514_10096959
232 Ga0307514_10156028
233 Ga0307518_10128028
234 Ga0307518_10371091
235 Ga0307507_10026673
236 Ga0307507_10029004
237 Ga0307507_10098646
238 Ga0395900_0435956
239 Ga0395898_0031019
240 Ga0439436_0000670
241 Ga0439436_0003098
242 Ga0439439_0010476
243 Ga0451802_0505829
244 Ga0451837_0250012
245 Ga0451853_0188415
246 Ga0451853_0884962
247 Ga0451853_1309389
248 Ga0439433_0007562
249 Ga0439442_018832
250 Ga0439449_0029831
251 Ga0439457_000095
252 Ga0439457_005204
253 Ga0450894_001863
254 Ga0450903_000250
255 Ga0439458_0000561
256 Ga0439458_0036446
257 Ga0439458_0063577
258 Ga0466972_0004856
259 Ga0466972_0006937
260 Ga0466965_0004668
261 Ga0466966_0004300
262 Ga0466961_0009387
263 Ga0466961_0225760
264 Ga0466963_0034068
265 Ga0466964_0007660
266 Ga0466971_0000186
267 Ga0466970_0007499
268 Ga0466957_0000142
269 Ga0466960_0023559
270 Ga0466958_0003556
271 Ga0495617_003689
272 Ga0495627_030305
273 Ga0495592_0019923
274 Ga0495603_0010991
275 Ga0495603_0012364
276 Ga0495603_0136480
277 Ga0495629_0014844
278 Ga0495629_0041709
279 Ga0495629_0068956
280 Ga0495638_0083825
281 Ga0495651_0030801
282 Ga0495580_0219295
283 Ga0495605_0017637
284 Ga0495662_0010614
285 Ga0495662_0052980
286 Ga0495664_0001685
287 Ga0495585_0156202
288 Ga0495594_0048905
289 Ga0495594_0086156
290 Ga0495594_0108694
291 Ga0495607_0004800
292 Ga0495583_0157755
293 Ga0495606_0048375
294 Ga0495608_0064683
295 Ga0495610_0036901
296 Ga0495616_0020840
297 Ga0495618_0055187
298 Ga0495620_0083260
299 Ga0495620_0123797
300 Ga0495628_0169583
301 Ga0495628_0206531
302 Ga0495630_0043404
303 Ga0495631_0002506
304 Ga0495643_0005293
305 Ga0495644_0049228
306 Ga0495648_0140037
307 Ga0495648_0190382
308 Ga0495652_0096039
309 Ga0495640_0022236
310 Ga0495645_0179033
311 Ga0495645_0263367
312 Ga0495622_0023090
313 Ga0495622_0063137
314 Ga0495633_0043120
315 Ga0495634_0013918
316 Ga0495634_0279374
317 Ga0495611_0042220
318 Ga0495611_0047229
319 Ga0495625_0012343
320 Ga0495625_0131110
321 Ga0495635_0002533
322 Ga0495588_0003495
323 Ga0495657_0009254
324 Ga0495599_0106017
325 Ga0495599_0151553
326 Ga0495646_0015021
327 Ga0495646_0031890
328 Ga0495613_0054339
329 Ga0495613_0105545
330 Ga0495624_0029814
331 Ga0495624_0249906
332 Ga0495671_0003017
333 Ga0495671_0111516
334 Ga0495649_0074258
335 Ga0495589_0060231
336 Ga0495589_0124933
337 Ga0495589_0157513
338 Ga0495589_0167189
339 Ga0495600_0064691
340 Ga0495600_0157390
341 Ga0495660_0081925
342 Ga0495660_0156618
343 Ga0495604_0000463
344 Ga0495636_0004615
345 Ga0495636_0049670
346 Ga0495674_0030398
347 Ga0495672_0029267
348 Ga0495676_0001882
349 Ga0495676_0037684
350 Ga0495676_0044022
351 Ga0495680_0166087
352 Ga0495683_0182439
353 Ga0495687_003207
354 Ga0495687_008019
355 Ga0495687_064976
356 Ga0495687_106732
357 Ga0495687_110960
358 Ga0495675_0111160
359 Ga0495685_011434
360 Ga0495685_033774
361 Ga0495685_040431
362 Ga0495685_064079
363 Ga0495681_0009883
364 Ga0495593_0018894
365 Ga0495602_0004050
366 Ga0495614_0047870
367 Ga0495614_0104357
368 Ga0495614_0134358
369 Ga0495626_0055764
370 Ga0495682_0005566
371 Ga0501031_0111094
372 Ga0501034_0246789
373 Ga0501038_0014466
374 Ga0501043_0070358
375 Ga0501047_0023473
376 Ga0501047_0225385
377 Ga0501080_0203130
378 Ga0501035_0040233
379 Ga0501044_0014797
380 Ga0501044_0155021
381 Ga0466962_0003371
382 2585306682
383 2585314215
384 2616694159
385 2616899310
386 2644270999
387 2785345063
388 2785367820
389 2786668864
390 2808919056
391 2811847482
392 2812359706
393 2812481815
394 2852638315
395 2862183084
396 2862288817
397 2862391209
398 2862583088
399 2863406321
400 2867370521
401 2867432387
402 2873157133
403 2877682738
404 2912721755
405 2912759397
406 2919473078
407 2935395562
408 2946066204
409 2947231169
410 2954004473
411 2954387931
412 2954675143
413 2954688992
414 2954698741
415 2954703481
416 2990061840
417 2997458658
418 3006396041
419 3006492267
420 8008561985
421 8025535491
422 8048410008
423 8054163556
424 8056667671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04402

SIMPL

Protein of unknown function (DUF541)

41

251

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p4v-assembly1.cif.gz_A glnk1 from methanothermococcus thermolithotrophicus with dadp at a resolution of 1.94 a 0.6044 37 134
2j9d-assembly2.cif.gz_F structure of glnk1 with bound effectors indicates regulatory mechanism for ammonia uptake 0.5984 36 146
2bvz-assembly1.cif.gz_A mutant of the ribosomal protein s6 0.5945 39 142
8fmw-assembly1.cif.gz_F the structure of a hibernating ribosome in the lyme disease pathogen 0.5855 37 145
2bvz-assembly1.cif.gz_A mutant of the ribosomal protein s6 0.5746 39 142
ID Description Score Start End Superfamily
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7838 37 132 3.30.70.2970
af_P0ADS6_28_138_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7758 21 123 3.30.70.2970
4hvzD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7551 35 141 3.30.70.2970
af_I6X7X3_52_151_3.30.70.2970 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7488 37 132 3.30.70.2970
4hvzD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Protein of unknown function (DUF541), domain 2 0.7191 35 141 3.30.70.2970
ID Description Score Start End GO Terms
AF-K2CUP3-F1-model_v4 DUF541 domain-containing protein 0.7687 6 144 GO:0006974
AF-A0A2V8PY39-F1-model_v4 TonB-dependent receptor plug domain-containing protein 0.766 6 114 GO:0006974
GO:0016020
AF-A0A139CKM8-F1-model_v4 DUF541 domain-containing protein 0.7557 12 139 GO:0006974
GO:0016020
AF-A0A2A2TBI3-F1-model_v4 SIMPL domain-containing protein 0.7482 33 163 GO:0006974
AF-A0A819BKL9-F1-model_v4 Autotransporter domain-containing protein 0.7473 33 163 GO:0019867

Map