F322703

General Info

Members Datasets Scaffolds Average Seq Length
212 143 424 246

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100353509|Ga0075430_1003535092
Length 292
Sequence VLPSTVAMPRGEYGYDAPYALVIFGSLAVVSGLGAAIAWWRMPVHAAAPISLYFVLFLANTTSFFYTTRRGKFIEWERILDRTQLRGDEIVLDMGCGRGAVLTAVARRLTTGRVTGVDIWSTTDQSGNAKDVALRNASLEGVSDRVHIETADMRALPFPDGTFDLVVSSLAIHNIRSNADRKRAITEGFRVMKPEGRMVIADIRATATYADVLRTLGASNVEHHRLGWRFWWGNPLAATTLLTASKKKVLSLRHLSGAIYGRCSPEWQLFSNRVQLSVTHFCLSNYLLPNIG

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
115 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
118 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
121 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
122 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
123 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
143 2643221677 Streptomyces sp. Root1304 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 0
Rhizoplane 7.08
Rhizosphere 85.85
Stem 0
Stem Tuber 0
Unclassified 16.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100353509 3300006846 Unclassified 1213
2 JGI24751J29686_10001882 3300002459 Bacteria 4295
3 Ga0070658_10068009 3300005327 Bacteria 2912
4 Ga0070676_10058803 3300005328 Bacteria 2279
5 Ga0070683_100383277 3300005329 Bacteria 1340
6 Ga0070670_100248919 3300005331 Bacteria 1548
7 Ga0068869_100010471 3300005334 Bacteria 6048
8 Ga0068868_100573852 3300005338 Bacteria 997
9 Ga0070660_100432447 3300005339 Bacteria 1090
10 Ga0070689_100070274 3300005340 Bacteria 2733
11 Ga0070669_100404025 3300005353 Unclassified 1118
12 Ga0070675_100149306 3300005354 Bacteria 2003
13 Ga0070671_100038888 3300005355 Bacteria 3948
14 Ga0070674_100113897 3300005356 Bacteria 1991
15 Ga0070674_100342122 3300005356 Unclassified 1205
16 Ga0070659_100098103 3300005366 Bacteria 2356
17 Ga0070659_100123220 3300005366 Unclassified 2101
18 Ga0070659_100269879 3300005366 Bacteria 1413
19 Ga0070667_100503247 3300005367 Unclassified 1111
20 Ga0070708_100006893 3300005445 Bacteria 9066
21 Ga0070708_100447087 3300005445 Bacteria 1219
22 Ga0070663_100595519 3300005455 Bacteria 929
23 Ga0070678_100118046 3300005456 Bacteria 2087
24 Ga0070662_100391525 3300005457 Unclassified 1145
25 Ga0070681_10006185 3300005458 Bacteria 11633
26 Ga0070681_10049994 3300005458 Bacteria 4172
27 Ga0070681_10122635 3300005458 Bacteria 2532
28 Ga0068867_100023981 3300005459 Unclassified 4371
29 Ga0070707_100090940 3300005468 Bacteria 2954
30 Ga0070698_100039370 3300005471 Unclassified 4866
31 Ga0070698_100099617 3300005471 Bacteria 2879
32 Ga0070698_100261313 3300005471 Bacteria 1663
33 Ga0070698_100354513 3300005471 Unclassified 1399
34 Ga0070679_100211220 3300005530 Bacteria 1904
35 Ga0070684_100515651 3300005535 Bacteria 1108
36 Ga0070684_100909804 3300005535 Unclassified 824
37 Ga0068853_100244297 3300005539 Bacteria 1646
38 Ga0070672_100044037 3300005543 Bacteria 3445
39 Ga0070686_100120430 3300005544 Bacteria 1801
40 Ga0070693_100138122 3300005547 Bacteria 1531
41 Ga0070665_100099433 3300005548 Bacteria 2913
42 Ga0070665_100357500 3300005548 Bacteria 1466
43 Ga0068855_100303109 3300005563 Bacteria 1769
44 Ga0070664_100066361 3300005564 Bacteria 3081
45 Ga0070664_100066742 3300005564 Unclassified 3073
46 Ga0070664_100618189 3300005564 Bacteria 1005
47 Ga0068857_100009641 3300005577 Bacteria 8389
48 Ga0068856_100061426 3300005614 Bacteria 3712
49 Ga0068856_100530749 3300005614 Bacteria 1198
50 Ga0068852_100080385 3300005616 Bacteria 2890
51 Ga0068859_100005531 3300005617 Bacteria 12867
52 Ga0068859_100016019 3300005617 Bacteria 7534
53 Ga0068859_100101222 3300005617 Bacteria 2938
54 Ga0068859_100696292 3300005617 Bacteria 1107
55 Ga0068864_100052582 3300005618 Bacteria 3511
56 Ga0068864_100337146 3300005618 Bacteria 1420
57 Ga0068861_100266468 3300005719 Bacteria 1469
58 Ga0068858_100026888 3300005842 Bacteria 5344
59 Ga0068858_100478866 3300005842 Bacteria 1201
60 Ga0068862_100273084 3300005844 Unclassified 1547
61 Ga0081455_10294278 3300005937 Unclassified 1167
62 Ga0075365_10126688 3300006038 Bacteria 1765
63 Ga0075364_10133820 3300006051 Bacteria 1665
64 Ga0075364_10207967 3300006051 Bacteria 1327
65 Ga0097621_100116483 3300006237 Unclassified 2263
66 Ga0097621_100550452 3300006237 Unclassified 1050
67 Ga0068871_100060446 3300006358 Bacteria 3091
68 Ga0068871_100583414 3300006358 Unclassified 1015
69 Ga0075428_100005153 3300006844 Bacteria 14529
70 Ga0075428_100058598 3300006844 Bacteria 4216
71 Ga0075433_10017659 3300006852 Bacteria 5917
72 Ga0075434_100004428 3300006871 Bacteria 12662
73 Ga0075434_100226520 3300006871 Bacteria 1889
74 Ga0075434_100805770 3300006871 Unclassified 955
75 Ga0075429_100041308 3300006880 Bacteria 4017
76 Ga0068865_100068468 3300006881 Bacteria 2510
77 Ga0097620_100005531 3300006931 Bacteria 12867
78 Ga0097620_100016019 3300006931 Bacteria 7534
79 Ga0097620_100101223 3300006931 Bacteria 2938
80 Ga0097620_100446080 3300006931 Unclassified 1390
81 Ga0097620_100696311 3300006931 Bacteria 1107
82 Ga0075435_100051138 3300007076 Bacteria 3328
83 Ga0075435_100255248 3300007076 Bacteria 1493
84 Ga0075435_100370866 3300007076 Bacteria 1229
85 Ga0111539_10025293 3300009094 Bacteria 7277
86 Ga0111539_10044817 3300009094 Bacteria 5296
87 Ga0111539_10070238 3300009094 Bacteria 4134
88 Ga0105245_10047447 3300009098 Bacteria 3840
89 Ga0105247_10015063 3300009101 Bacteria 4637
90 Ga0105248_10012725 3300009177 Bacteria 9281
91 Ga0105248_10156137 3300009177 Bacteria 2575
92 Ga0105248_10207265 3300009177 Bacteria 2209
93 Ga0105237_10423453 3300009545 Bacteria 1337
94 Ga0105239_10015510 3300010375 Bacteria 8438
95 Ga0157370_10491514 3300013104 Bacteria 1127
96 Ga0157369_11034985 3300013105 Bacteria 840
97 Ga0157374_10019404 3300013296 Bacteria 6017
98 Ga0157374_10286493 3300013296 Unclassified 1627
99 Ga0157378_10023986 3300013297 Bacteria 5366
100 Ga0163162_10026792 3300013306 Bacteria 5700
101 Ga0157375_10139265 3300013308 Bacteria 2552
102 Ga0163163_10054506 3300014325 Bacteria 3950
103 Ga0163163_10057356 3300014325 Bacteria 3850
104 Ga0163163_10268614 3300014325 Bacteria 1757
105 Ga0157380_10679387 3300014326 Bacteria 1031
106 Ga0157379_10027040 3300014968 Bacteria 5105
107 Ga0157379_10139043 3300014968 Bacteria 2189
108 Ga0157376_10022973 3300014969 Bacteria 4872
109 Ga0157376_10164774 3300014969 Unclassified 2013
110 Ga0157376_10176433 3300014969 Bacteria 1950
111 Ga0213876_10006091 3300021384 Bacteria 6591
112 Ga0213875_10031125 3300021388 Bacteria 2525
113 Ga0207710_10048277 3300025900 Bacteria 1905
114 Ga0207647_10048118 3300025904 Bacteria 2649
115 Ga0207645_10099061 3300025907 Bacteria 1879
116 Ga0207705_10101288 3300025909 Bacteria 2119
117 Ga0207707_10037200 3300025912 Bacteria 4252
118 Ga0207671_10088853 3300025914 Bacteria 2325
119 Ga0207660_10132371 3300025917 Bacteria 1899
120 Ga0207660_10172894 3300025917 Bacteria 1673
121 Ga0207649_10114023 3300025920 Unclassified 1811
122 Ga0207646_10086391 3300025922 Bacteria 2806
123 Ga0207650_10373215 3300025925 Unclassified 1177
124 Ga0207659_10047071 3300025926 Bacteria 3049
125 Ga0207687_10017229 3300025927 Bacteria 4753
126 Ga0207690_10082163 3300025932 Bacteria 2253
127 Ga0207706_10288283 3300025933 Unclassified 1431
128 Ga0207670_10378562 3300025936 Bacteria 1127
129 Ga0207691_10007319 3300025940 Bacteria 10648
130 Ga0207711_10003749 3300025941 Bacteria 13096
131 Ga0207711_10039514 3300025941 Bacteria 4014
132 Ga0207711_10063212 3300025941 Bacteria 3195
133 Ga0207711_10237257 3300025941 Unclassified 1671
134 Ga0207689_10000353 3300025942 Bacteria 43010
135 Ga0207661_10157120 3300025944 Bacteria 1971
136 Ga0207679_10031167 3300025945 Bacteria 3731
137 Ga0207679_10038304 3300025945 Bacteria 3415
138 Ga0207667_10343986 3300025949 Unclassified 1522
139 Ga0207667_10385855 3300025949 Bacteria 1427
140 Ga0207651_10111777 3300025960 Bacteria 2052
141 Ga0207677_10387560 3300026023 Bacteria 1181
142 Ga0207703_10029508 3300026035 Bacteria 4329
143 Ga0207703_10440167 3300026035 Bacteria 1216
144 Ga0207639_10191988 3300026041 Unclassified 1745
145 Ga0207639_10608774 3300026041 Bacteria 1008
146 Ga0207678_10202784 3300026067 Bacteria 1696
147 Ga0207678_10488081 3300026067 Bacteria 1073
148 Ga0207676_10063765 3300026095 Bacteria 2928
149 Ga0207676_10257768 3300026095 Bacteria 1573
150 Ga0207676_10384369 3300026095 Bacteria 1307
151 Ga0207683_10263236 3300026121 Bacteria 1575
152 Ga0207683_10346526 3300026121 Bacteria 1363
153 Ga0207698_10255715 3300026142 Bacteria 1606
154 Ga0207428_10006640 3300027907 Bacteria 10629
155 Ga0207428_10069036 3300027907 Bacteria 2779
156 Ga0268266_10041475 3300028379 Bacteria 3928
157 Ga0268265_10179070 3300028380 Bacteria 1820
158 Ga0373937_0249781 3300036401 Unclassified 1672
159 Ga0373937_0398240 3300036401 Bacteria 1306
160 Ga0436364_0428295 3300037853 Bacteria 5276
161 Ga0436364_0565461 3300037853 Bacteria 8227
162 Ga0436364_1417850 3300037853 Unclassified 3631
163 Ga0436365_0563360 3300039437 Unclassified 3853
164 Ga0436363_1034985 3300039450 Bacteria 7717
165 Ga0436362_0890501 3300039453 Unclassified 2587
166 Ga0453684_0041047 3300044712 Bacteria 6267
167 Ga0451576_0294444 3300045051 Bacteria 1697
168 Ga0495592_0214263 3300046454 Archaea 1292
169 Ga0495580_0036412 3300046472 Bacteria 3533
170 Ga0495580_0326749 3300046472 Unclassified 1042
171 Ga0495628_0000052 3300046516 Bacteria 91554
172 Ga0495659_0092433 3300046664 Bacteria 1163
173 Ga0495670_0027026 3300046691 Bacteria 2841
174 Ga0495600_0035311 3300046809 Bacteria 3246
175 Ga0495604_0252796 3300047317 Bacteria 1201
176 Ga0495687_028070 3300047443 Bacteria 2622
177 Ga0495684_0156130 3300047471 Bacteria 1704
178 Ga0496101_0003494 3300048904 Bacteria 9803
179 Ga0496102_0364582 3300048905 Bacteria 1360
180 Ga0496102_0512687 3300048905 Bacteria 1122
181 Ga0496104_0203179 3300048907 Bacteria 1893
182 Ga0496105_0188809 3300048908 Unclassified 1686
183 Ga0496106_0066910 3300048909 Bacteria 2738
184 Ga0496106_0141773 3300048909 Bacteria 1891
185 Ga0496107_0319854 3300048910 Bacteria 1155
186 Ga0496109_0616333 3300048912 Bacteria 1022
187 Ga0496110_0021827 3300048913 Bacteria 5428
188 Ga0496111_0456630 3300048914 Unclassified 942
189 Ga0496112_0001123 3300048915 Bacteria 19904
190 Ga0496112_0015408 3300048915 Bacteria 7134
191 Ga0496113_0355166 3300048916 Bacteria 1176
192 Ga0496114_0000906 3300048917 Bacteria 22197
193 nmdc:mga00v17_11494_c1 3300050491 Bacteria 4864
194 nmdc:mga0yw44_167980_c1 3300050492 Bacteria 1439
195 nmdc:mga05p37_569017_c1 3300050507 Bacteria 1286
196 nmdc:mga05p37_88883_c1 3300050507 Bacteria 3808
197 nmdc:mga09592_386041_c1 3300050508 Bacteria 1211
198 nmdc:mga09592_564781_c1 3300050508 Bacteria 977
199 nmdc:mga06r32_417159_c1 3300050510 Bacteria 1324
200 nmdc:mga08y16_113887_c1 3300050511 Bacteria 2815
201 nmdc:mga08y16_397_c1 3300050511 Bacteria 39847
202 nmdc:mga08y16_730533_c1 3300050511 Bacteria 988
203 nmdc:mga0n895_122031_c1 3300050512 Unclassified 2627
204 nmdc:mga0n895_180147_c1 3300050512 Bacteria 2144
205 nmdc:mga0n895_50554_c1 3300050512 Bacteria 4075
206 nmdc:mga0n895_671_c1 3300050512 Bacteria 23991
207 nmdc:mga0rr50_17411_c1 3300050513 Bacteria 4798
208 nmdc:mga0rr50_367728_c1 3300050513 Unclassified 890
209 nmdc:mga0a205_1029_c1 3300050515 Bacteria 23209
210 Ga0500644_0121791 3300053088 Bacteria 1017
211 2643945962 2643221587 Bacteria 7586415
212 2644432751 2643221677 Bacteria 7584031
213 Ga0075430_100353509
214 JGI24751J29686_10001882
215 Ga0070658_10068009
216 Ga0070676_10058803
217 Ga0070683_100383277
218 Ga0070670_100248919
219 Ga0068869_100010471
220 Ga0068868_100573852
221 Ga0070660_100432447
222 Ga0070689_100070274
223 Ga0070669_100404025
224 Ga0070675_100149306
225 Ga0070671_100038888
226 Ga0070674_100113897
227 Ga0070674_100342122
228 Ga0070659_100098103
229 Ga0070659_100123220
230 Ga0070659_100269879
231 Ga0070667_100503247
232 Ga0070708_100006893
233 Ga0070708_100447087
234 Ga0070663_100595519
235 Ga0070678_100118046
236 Ga0070662_100391525
237 Ga0070681_10006185
238 Ga0070681_10049994
239 Ga0070681_10122635
240 Ga0068867_100023981
241 Ga0070707_100090940
242 Ga0070698_100039370
243 Ga0070698_100099617
244 Ga0070698_100261313
245 Ga0070698_100354513
246 Ga0070679_100211220
247 Ga0070684_100515651
248 Ga0070684_100909804
249 Ga0068853_100244297
250 Ga0070672_100044037
251 Ga0070686_100120430
252 Ga0070693_100138122
253 Ga0070665_100099433
254 Ga0070665_100357500
255 Ga0068855_100303109
256 Ga0070664_100066361
257 Ga0070664_100066742
258 Ga0070664_100618189
259 Ga0068857_100009641
260 Ga0068856_100061426
261 Ga0068856_100530749
262 Ga0068852_100080385
263 Ga0068859_100005531
264 Ga0068859_100016019
265 Ga0068859_100101222
266 Ga0068859_100696292
267 Ga0068864_100052582
268 Ga0068864_100337146
269 Ga0068861_100266468
270 Ga0068858_100026888
271 Ga0068858_100478866
272 Ga0068862_100273084
273 Ga0081455_10294278
274 Ga0075365_10126688
275 Ga0075364_10133820
276 Ga0075364_10207967
277 Ga0097621_100116483
278 Ga0097621_100550452
279 Ga0068871_100060446
280 Ga0068871_100583414
281 Ga0075428_100005153
282 Ga0075428_100058598
283 Ga0075433_10017659
284 Ga0075434_100004428
285 Ga0075434_100226520
286 Ga0075434_100805770
287 Ga0075429_100041308
288 Ga0068865_100068468
289 Ga0097620_100005531
290 Ga0097620_100016019
291 Ga0097620_100101223
292 Ga0097620_100446080
293 Ga0097620_100696311
294 Ga0075435_100051138
295 Ga0075435_100255248
296 Ga0075435_100370866
297 Ga0111539_10025293
298 Ga0111539_10044817
299 Ga0111539_10070238
300 Ga0105245_10047447
301 Ga0105247_10015063
302 Ga0105248_10012725
303 Ga0105248_10156137
304 Ga0105248_10207265
305 Ga0105237_10423453
306 Ga0105239_10015510
307 Ga0157370_10491514
308 Ga0157369_11034985
309 Ga0157374_10019404
310 Ga0157374_10286493
311 Ga0157378_10023986
312 Ga0163162_10026792
313 Ga0157375_10139265
314 Ga0163163_10054506
315 Ga0163163_10057356
316 Ga0163163_10268614
317 Ga0157380_10679387
318 Ga0157379_10027040
319 Ga0157379_10139043
320 Ga0157376_10022973
321 Ga0157376_10164774
322 Ga0157376_10176433
323 Ga0213876_10006091
324 Ga0213875_10031125
325 Ga0207710_10048277
326 Ga0207647_10048118
327 Ga0207645_10099061
328 Ga0207705_10101288
329 Ga0207707_10037200
330 Ga0207671_10088853
331 Ga0207660_10132371
332 Ga0207660_10172894
333 Ga0207649_10114023
334 Ga0207646_10086391
335 Ga0207650_10373215
336 Ga0207659_10047071
337 Ga0207687_10017229
338 Ga0207690_10082163
339 Ga0207706_10288283
340 Ga0207670_10378562
341 Ga0207691_10007319
342 Ga0207711_10003749
343 Ga0207711_10039514
344 Ga0207711_10063212
345 Ga0207711_10237257
346 Ga0207689_10000353
347 Ga0207661_10157120
348 Ga0207679_10031167
349 Ga0207679_10038304
350 Ga0207667_10343986
351 Ga0207667_10385855
352 Ga0207651_10111777
353 Ga0207677_10387560
354 Ga0207703_10029508
355 Ga0207703_10440167
356 Ga0207639_10191988
357 Ga0207639_10608774
358 Ga0207678_10202784
359 Ga0207678_10488081
360 Ga0207676_10063765
361 Ga0207676_10257768
362 Ga0207676_10384369
363 Ga0207683_10263236
364 Ga0207683_10346526
365 Ga0207698_10255715
366 Ga0207428_10006640
367 Ga0207428_10069036
368 Ga0268266_10041475
369 Ga0268265_10179070
370 Ga0373937_0249781
371 Ga0373937_0398240
372 Ga0436364_0428295
373 Ga0436364_0565461
374 Ga0436364_1417850
375 Ga0436365_0563360
376 Ga0436363_1034985
377 Ga0436362_0890501
378 Ga0453684_0041047
379 Ga0451576_0294444
380 Ga0495592_0214263
381 Ga0495580_0036412
382 Ga0495580_0326749
383 Ga0495628_0000052
384 Ga0495659_0092433
385 Ga0495670_0027026
386 Ga0495600_0035311
387 Ga0495604_0252796
388 Ga0495687_028070
389 Ga0495684_0156130
390 Ga0496101_0003494
391 Ga0496102_0364582
392 Ga0496102_0512687
393 Ga0496104_0203179
394 Ga0496105_0188809
395 Ga0496106_0066910
396 Ga0496106_0141773
397 Ga0496107_0319854
398 Ga0496109_0616333
399 Ga0496110_0021827
400 Ga0496111_0456630
401 Ga0496112_0001123
402 Ga0496112_0015408
403 Ga0496113_0355166
404 Ga0496114_0000906
405 nmdc:mga00v17_11494_c1
406 nmdc:mga0yw44_167980_c1
407 nmdc:mga05p37_569017_c1
408 nmdc:mga05p37_88883_c1
409 nmdc:mga09592_386041_c1
410 nmdc:mga09592_564781_c1
411 nmdc:mga06r32_417159_c1
412 nmdc:mga08y16_113887_c1
413 nmdc:mga08y16_397_c1
414 nmdc:mga08y16_730533_c1
415 nmdc:mga0n895_122031_c1
416 nmdc:mga0n895_180147_c1
417 nmdc:mga0n895_50554_c1
418 nmdc:mga0n895_671_c1
419 nmdc:mga0rr50_17411_c1
420 nmdc:mga0rr50_367728_c1
421 nmdc:mga0a205_1029_c1
422 Ga0500644_0121791
423 2643945962
424 2644432751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

92

200

0.9

PF08242

Methyltransf_12

Methyltransferase domain

92

198

0.9

PF13649

Methyltransf_25

Methyltransferase domain

91

196

0.89

PF13847

Methyltransf_31

Methyltransferase domain

85

253

0.81

PF05175

MTS

Methyltransferase small domain

78

228

0.79

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

71

213

0.78

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

77

208

0.74

PF13489

Methyltransf_23

Methyltransferase domain

68

242

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4n-assembly1.cif.gz_A c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.9138 13 60
3nym-assembly1.cif.gz_B the crystal structure of functionally unknown protein from neisseria meningitidis mc58 0.9074 11 60
1f4n-assembly1.cif.gz_B c2 crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8809 15 60
6gkz-assembly1.cif.gz_D crystal structure of coclaurine n-methyltransferase (cnmt) bound to n-methylheliamine and sah 0.8503 69 198
6p3o-assembly1.cif.gz_A-2 tetrahydroprotoberberine n-methyltransferase in complex with (s)-cis-n-methylstylopine and s-adenosylhomocysteine 0.8332 72 198
ID Description Score Start End Superfamily
af_Q9R1S8_2_77_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9754 16 57 1.20.58.80
af_Q2G0A8_1_95_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9318 11 61 1.20.58.80
1f4nA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9138 13 60 1.10.287.230
af_Q553T0_166_421_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8887 68 197 3.40.50.150
1f4mA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8862 15 60 1.10.287.230
ID Description Score Start End GO Terms
AF-A0A419VQ66-F1-model_v4 deleted 0.9769 57 242
AF-A0A5N0HLJ5-F1-model_v4 Class I SAM-dependent methyltransferase 0.976 82 242 GO:0008757
GO:0032259
AF-A0A5N0HLJ5-F1-model_v4 Class I SAM-dependent methyltransferase 0.9642 82 242 GO:0008757
GO:0032259
AF-A0A4V2PHR9-F1-model_v4 Methyltransferase family protein 0.962 16 243 GO:0008757
GO:0032259
AF-A0A224VIU1-F1-model_v4 SAM-dependent methyltransferase 0.96 80 241 GO:0008757
GO:0032259

Map