F322504

General Info

Members Datasets Scaffolds Average Seq Length
212 147 195 156

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_101033258|Ga0070714_1010332581
Length 153
Sequence MTDKRLAPGDPAPDFTLPDADGNQVSLSSFRGRRVIVYFYPAAMTPGCTKQACDFRDNLDAIGAQVLGISPDAPARLAKFRDRDALTFPLLSDPDHAVGQAYGAYGEKKLYGKTTVGVIRSTFVIDADGVIEKAMYSVKATGHVARLMAEIGA

Samples

Sample ID Description Type Environment
1 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
2 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
3 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
4 2619618881 Frankia sp. ACN1ag Isolate Unclassified
5 2619619003 Frankia sp. CpI1-P Isolate Nodule
6 2626541554 Frankia sp. AvcI.1 Isolate Nodule
7 2671180195 Frankia sp. CcI49 Isolate Nodule
8 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
9 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
10 2773857922 Frankia sp. CcI49 Isolate Nodule
11 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
12 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
13 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
14 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
15 2922554459 Rhodococcus sp. 66b Isolate Unclassified
16 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
20 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
21 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
22 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
67 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
107 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
110 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
130 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
147 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.57
Metatranscriptomes 1.42
Isolates 8.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.83
Nodule 2.83
Rhizoplane 2.36
Rhizosphere 82.55
Stem 0
Stem Tuber 0
Unclassified 9.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c008752 3300000041 Bacteria 857
2 JGI24740J21852_10008938 3300001979 Bacteria 3957
3 JGI24739J22299_10009242 3300001989 Bacteria 3678
4 JGI24737J22298_10005597 3300001990 Bacteria 4329
5 JGI24735J21928_10006918 3300002067 Bacteria 3713
6 JGI24735J21928_10028510 3300002067 Bacteria 1666
7 JGI25151J46595_10053304 3300003187 Bacteria 1352
8 JGI25406J46586_10002180 3300003203 Bacteria 9240
9 Ga0065714_10104233 3300005288 Bacteria 1588
10 Ga0070683_100134148 3300005329 Bacteria 2344
11 Ga0070714_100002230 3300005435 Bacteria 14279
12 Ga0070714_100002319 3300005435 Bacteria 13997
13 Ga0070714_100007006 3300005435 Bacteria 8743
14 Ga0070714_101033258 3300005435 Bacteria 800
15 Ga0070713_100053779 3300005436 Bacteria 3338
16 Ga0070713_100531781 3300005436 Bacteria 1112
17 Ga0070708_100017884 3300005445 Bacteria 5923
18 Ga0070708_100019918 3300005445 Bacteria 5646
19 Ga0070708_100039540 3300005445 Bacteria 4127
20 Ga0070708_100463348 3300005445 Bacteria 1196
21 Ga0070681_10039297 3300005458 Bacteria 4744
22 Ga0070706_100002257 3300005467 Bacteria 19521
23 Ga0070706_100009744 3300005467 Bacteria 8927
24 Ga0070707_100010799 3300005468 Bacteria 8503
25 Ga0070707_101121823 3300005468 Bacteria 752
26 Ga0070707_101444390 3300005468 Bacteria 654
27 Ga0070698_100003200 3300005471 Bacteria 18039
28 Ga0070698_100005829 3300005471 Bacteria 13474
29 Ga0070698_100044667 3300005471 Bacteria 4535
30 Ga0070698_101235758 3300005471 Bacteria 697
31 Ga0070679_101375130 3300005530 Bacteria 652
32 Ga0070697_100064523 3300005536 Bacteria 2991
33 Ga0070665_100674733 3300005548 Bacteria 1046
34 Ga0068857_100624801 3300005577 Bacteria 1019
35 Ga0068856_100029473 3300005614 Bacteria 5361
36 Ga0068866_10239132 3300005718 Bacteria 1105
37 Ga0068861_100707309 3300005719 Bacteria 937
38 Ga0081455_10022022 3300005937 Bacteria 5966
39 Ga0081538_10269378 3300005981 Bacteria 638
40 Ga0081539_10001360 3300005985 Bacteria 42450
41 Ga0070717_10074131 3300006028 Bacteria 2845
42 Ga0070712_100765133 3300006175 Bacteria 827
43 Ga0075370_10082982 3300006353 Bacteria 1843
44 Ga0075428_100013049 3300006844 Bacteria 9234
45 Ga0075428_100029100 3300006844 Bacteria 6112
46 Ga0075428_101610095 3300006844 Bacteria 679
47 Ga0075430_100006683 3300006846 Bacteria 9730
48 Ga0075431_100002651 3300006847 Bacteria 17323
49 Ga0075431_101089521 3300006847 Bacteria 764
50 Ga0075433_10104196 3300006852 Bacteria 2513
51 Ga0075434_100216032 3300006871 Bacteria 1937
52 Ga0075429_100001968 3300006880 Bacteria 17077
53 Ga0068865_100745038 3300006881 Bacteria 841
54 Ga0075436_100051797 3300006914 Bacteria 2832
55 Ga0105240_10037820 3300009093 Bacteria 6198
56 Ga0114129_10039724 3300009147 Bacteria 6636
57 Ga0114129_11723699 3300009147 Bacteria 764
58 Ga0105243_12111119 3300009148 Bacteria 599
59 Ga0105237_10013003 3300009545 Bacteria 8741
60 Ga0105249_10054478 3300009553 Bacteria 3658
61 Ga0105249_13287064 3300009553 Bacteria 520
62 Ga0105239_10025441 3300010375 Bacteria 6517
63 Ga0105246_10068886 3300011119 Bacteria 2483
64 Ga0157370_11503846 3300013104 Bacteria 605
65 Ga0157372_10102587 3300013307 Bacteria 3268
66 Ga0157380_10732692 3300014326 Bacteria 998
67 Ga0206353_11035191 3300020082 Bacteria 971
68 Ga0213875_10240897 3300021388 Bacteria 852
69 Ga0224712_10490675 3300022467 Bacteria 593
70 Ga0224571_106415 3300022734 Bacteria 784
71 Ga0224572_1000609 3300024225 Bacteria 4437
72 Ga0209129_1000028 3300025258 Bacteria 405451
73 Ga0209025_1000112 3300025294 Bacteria 218958
74 Ga0209051_1041508 3300025303 Bacteria 1636
75 Ga0207696_1120287 3300025711 Bacteria 708
76 Ga0207642_10560655 3300025899 Bacteria 706
77 Ga0207647_10025020 3300025904 Bacteria 3930
78 Ga0207684_10038181 3300025910 Bacteria 4075
79 Ga0207684_10060072 3300025910 Bacteria 3228
80 Ga0207684_10095016 3300025910 Bacteria 2543
81 Ga0207695_10080017 3300025913 Bacteria 3310
82 Ga0207671_10067497 3300025914 Bacteria 2663
83 Ga0207671_11036455 3300025914 Bacteria 646
84 Ga0207693_10424237 3300025915 Bacteria 1040
85 Ga0207693_10537196 3300025915 Bacteria 912
86 Ga0207662_10206686 3300025918 Bacteria 1273
87 Ga0207652_11029459 3300025921 Bacteria 723
88 Ga0207646_10018915 3300025922 Bacteria 6413
89 Ga0207646_10021231 3300025922 Bacteria 6002
90 Ga0207646_10137040 3300025922 Bacteria 2204
91 Ga0207646_11055670 3300025922 Bacteria 716
92 Ga0207700_10022915 3300025928 Bacteria 4293
93 Ga0207700_10064054 3300025928 Bacteria 2799
94 Ga0207664_10003098 3300025929 Bacteria 11047
95 Ga0207664_10011277 3300025929 Bacteria 6341
96 Ga0207664_10219992 3300025929 Bacteria 1646
97 Ga0207664_11572645 3300025929 Bacteria 579
98 Ga0207661_11395666 3300025944 Bacteria 643
99 Ga0207712_10117068 3300025961 Bacteria 2009
100 Ga0207668_10622650 3300025972 Bacteria 942
101 Ga0207658_10040605 3300025986 Bacteria 3365
102 Ga0207708_10031011 3300026075 Bacteria 4057
103 Ga0207702_10013133 3300026078 Bacteria 6886
104 Ga0207675_100081236 3300026118 Bacteria 3039
105 Ga0207683_10831730 3300026121 Bacteria 857
106 Ga0268266_10797019 3300028379 Bacteria 912
107 Ga0307512_10098572 3300030522 Bacteria 1994
108 Ga0316178_1039028 3300030735 Bacteria 934
109 Ga0307405_10328673 3300031731 Bacteria 1171
110 Ga0307410_10255089 3300031852 Bacteria 1365
111 Ga0307412_10051199 3300031911 Bacteria 2728
112 Ga0307409_101518401 3300031995 Bacteria 697
113 Ga0307416_100536297 3300032002 Bacteria 1241
114 Ga0372808_009608 3300036459 Bacteria 1353
115 Ga0373925_0273095 3300037068 Bacteria 1360
116 Ga0395899_0296247 3300037312 Bacteria 1096
117 Ga0395900_0127588 3300037418 Bacteria 2608
118 Ga0395900_0159291 3300037418 Bacteria 2303
119 Ga0395898_0013187 3300037466 Bacteria 8514
120 Ga0395898_0088681 3300037466 Bacteria 2977
121 Ga0395898_0139953 3300037466 Bacteria 2317
122 Ga0436364_0096222 3300037853 Bacteria 855
123 Ga0436364_0223555 3300037853 Bacteria 5358
124 Ga0436364_0332993 3300037853 Bacteria 815
125 Ga0436364_0508410 3300037853 Bacteria 1220
126 Ga0395901_0016201 3300038443 Bacteria 7594
127 Ga0395901_0124421 3300038443 Bacteria 2709
128 Ga0395901_0366637 3300038443 Bacteria 1484
129 Ga0395901_1211701 3300038443 Bacteria 720
130 Ga0436363_0532768 3300039450 Bacteria 2532
131 Ga0436363_1359725 3300039450 Bacteria 3420
132 Ga0451833_0806558 3300041491 Bacteria 35180
133 Ga0451837_0813642 3300041494 Bacteria 1725
134 Ga0439463_125050 3300042016 Unclassified 665
135 Ga0450903_038715 3300042138 Bacteria 708
136 Ga0466972_0013346 3300044658 Bacteria 4125
137 Ga0466972_0139976 3300044658 Bacteria 1139
138 Ga0466965_0084243 3300044683 Bacteria 1610
139 Ga0466966_0324173 3300044684 Bacteria 925
140 Ga0466961_0010000 3300044693 Bacteria 6044
141 Ga0466961_0012063 3300044693 Bacteria 5523
142 Ga0466961_0017953 3300044693 Bacteria 4549
143 Ga0466961_0018119 3300044693 Bacteria 4528
144 Ga0466961_0021578 3300044693 Bacteria 4144
145 Ga0466963_0005875 3300044694 Bacteria 7234
146 Ga0466963_0024170 3300044694 Bacteria 3867
147 Ga0466963_0068245 3300044694 Bacteria 2388
148 Ga0466963_0106058 3300044694 Bacteria 1926
149 Ga0466963_0217326 3300044694 Bacteria 1338
150 Ga0466963_0272186 3300044694 Bacteria 1190
151 Ga0466963_0310328 3300044694 Bacteria 1110
152 Ga0466964_0002057 3300044706 Bacteria 7078
153 Ga0466964_0350138 3300044706 Bacteria 759
154 Ga0466971_0023712 3300044719 Bacteria 2735
155 Ga0466968_0100296 3300044735 Bacteria 1292
156 Ga0466968_0293171 3300044735 Bacteria 781
157 Ga0466970_0103540 3300044765 Bacteria 1551
158 Ga0466957_0013051 3300044842 Bacteria 4814
159 Ga0466957_0045660 3300044842 Bacteria 2657
160 Ga0466957_0491699 3300044842 Bacteria 850
161 Ga0466957_1264874 3300044842 Bacteria 535
162 Ga0466960_0007707 3300044901 Bacteria 4386
163 Ga0466960_0426243 3300044901 Bacteria 768
164 Ga0466959_0088429 3300045049 Bacteria 2227
165 Ga0466958_0026006 3300045836 Bacteria 3456
166 Ga0466958_0065888 3300045836 Bacteria 2210
167 Ga0466958_0486160 3300045836 Bacteria 801
168 Ga0466967_0002478 3300045976 Bacteria 11516
169 Ga0466967_0625368 3300045976 Bacteria 1063
170 Ga0466967_1188397 3300045976 Bacteria 760
171 Ga0466967_1804504 3300045976 Bacteria 609
172 Ga0495603_0601894 3300046455 Bacteria 629
173 Ga0495668_0000476 3300046616 Bacteria 50569
174 Ga0495625_0130350 3300046660 Bacteria 1704
175 Ga0495581_0120941 3300047315 Bacteria 1524
176 Ga0496102_0589430 3300048905 Bacteria 1035
177 Ga0496103_0207572 3300048906 Bacteria 1260
178 Ga0496108_0160685 3300048911 Bacteria 1941
179 Ga0496108_0195047 3300048911 Bacteria 1756
180 Ga0496109_0450148 3300048912 Bacteria 1216
181 Ga0496125_0048088 3300048928 Bacteria 3560
182 Ga0496126_0292396 3300048929 Bacteria 1347
183 Ga0501214_059015 3300049659 Bacteria 602
184 Ga0501035_0570192 3300049822 Bacteria 925
185 nmdc:mga03n38_63071_c1 3300050490 Bacteria 1693
186 nmdc:mga05p37_16007_c1 3300050507 Bacteria 9024
187 nmdc:mga0qj67_100677_c1 3300050509 Bacteria 2330
188 nmdc:mga0rr50_22857_c1 3300050513 Bacteria 4300
189 nmdc:mga08x19_9868_c1 3300050514 Bacteria 5723
190 nmdc:mga0a205_2543_c1 3300050515 Bacteria 13172
191 Ga0495655_0001936 3300053083 Bacteria 3229
192 Ga0495655_0076465 3300053083 Bacteria 948
193 Ga0466962_0055122 3300061719 Bacteria 1899
194 Ga0466962_0290904 3300061719 Bacteria 807
195 Ga0530510_0996480 3300061734 Bacteria 641

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8054920844 8054922360 149
2 3300005288 Ga0065714_10104233 Ga0065714_101042331 150
3 3300005435 Ga0070714_101033258 Ga0070714_1010332581 151
4 3300006175 Ga0070712_100765133 Ga0070712_1007651332 151
5 3300025915 Ga0207693_10424237 Ga0207693_104242372 151
6 3300025929 Ga0207664_11572645 Ga0207664_115726452 151
7 3300045976 Ga0466967_1188397 Ga0466967_1188397_125_586 151
8 3300048911 Ga0496108_0160685 Ga0496108_0160685_839_1294 151
9 iso_pu_bacteria 2816332119 2816424142 151
10 iso_pu_bacteria 2844849076 2844849358 151
11 iso_pu_bacteria 2905926851 2905927412 151
12 3300031995 Ga0307409_101518401 Ga0307409_1015184012 152
13 3300049659 Ga0501214_059015 Ga0501214_059015_24_500 152
14 iso_pu_bacteria 2585427649 2586058661 152
15 iso_pu_bacteria 2565956761 2566995412 153
16 iso_pu_bacteria 2751185725 2753035336 153
17 iso_pu_bacteria 2751185792 2753323853 153
18 iso_pu_bacteria 2904535858 2904539680 153
19 iso_pu_bacteria 2922554459 2922557692 153
20 3300005329 Ga0070683_100134148 Ga0070683_1001341483 154
21 3300005435 Ga0070714_100002230 Ga0070714_1000022307 154
22 3300005435 Ga0070714_100007006 Ga0070714_1000070067 154
23 3300005436 Ga0070713_100053779 Ga0070713_1000537796 154
24 3300005436 Ga0070713_100531781 Ga0070713_1005317812 154
25 3300005445 Ga0070708_100017884 Ga0070708_1000178844 154
26 3300005445 Ga0070708_100019918 Ga0070708_1000199186 154
27 3300005445 Ga0070708_100039540 Ga0070708_1000395405 154
28 3300005445 Ga0070708_100463348 Ga0070708_1004633482 154
29 3300005458 Ga0070681_10039297 Ga0070681_100392973 154
30 3300005467 Ga0070706_100002257 Ga0070706_1000022575 154
31 3300005467 Ga0070706_100009744 Ga0070706_1000097447 154
32 3300005468 Ga0070707_100010799 Ga0070707_1000107996 154
33 3300005468 Ga0070707_101121823 Ga0070707_1011218231 154
34 3300005468 Ga0070707_101444390 Ga0070707_1014443901 154
35 3300005471 Ga0070698_100003200 Ga0070698_1000032001 154
36 3300005471 Ga0070698_100005829 Ga0070698_1000058299 154
37 3300005471 Ga0070698_100044667 Ga0070698_1000446673 154
38 3300005471 Ga0070698_101235758 Ga0070698_1012357582 154
39 3300005530 Ga0070679_101375130 Ga0070679_1013751301 154
40 3300005536 Ga0070697_100064523 Ga0070697_1000645233 154
41 3300005548 Ga0070665_100674733 Ga0070665_1006747332 154
42 3300005614 Ga0068856_100029473 Ga0068856_1000294734 154
43 3300006028 Ga0070717_10074131 Ga0070717_100741313 154
44 3300006353 Ga0075370_10082982 Ga0075370_100829824 154
45 3300006852 Ga0075433_10104196 Ga0075433_101041963 154
46 3300006871 Ga0075434_100216032 Ga0075434_1002160322 154
47 3300006914 Ga0075436_100051797 Ga0075436_1000517974 154
48 3300009093 Ga0105240_10037820 Ga0105240_100378208 154
49 3300009545 Ga0105237_10013003 Ga0105237_100130038 154
50 3300009553 Ga0105249_13287064 Ga0105249_132870641 154
51 3300010375 Ga0105239_10025441 Ga0105239_100254414 154
52 3300020082 Ga0206353_11035191 Ga0206353_110351913 154
53 3300021388 Ga0213875_10240897 Ga0213875_102408971 154
54 3300022467 Ga0224712_10490675 Ga0224712_104906751 154
55 3300022734 Ga0224571_106415 Ga0224571_1064151 154
56 3300024225 Ga0224572_1000609 Ga0224572_10006093 154
57 3300025910 Ga0207684_10038181 Ga0207684_100381815 154
58 3300025910 Ga0207684_10060072 Ga0207684_100600724 154
59 3300025910 Ga0207684_10095016 Ga0207684_100950162 154
60 3300025913 Ga0207695_10080017 Ga0207695_100800174 154
61 3300025914 Ga0207671_10067497 Ga0207671_100674974 154
62 3300025915 Ga0207693_10537196 Ga0207693_105371963 154
63 3300025921 Ga0207652_11029459 Ga0207652_110294591 154
64 3300025922 Ga0207646_10018915 Ga0207646_100189159 154
65 3300025922 Ga0207646_10021231 Ga0207646_100212314 154
66 3300025922 Ga0207646_10137040 Ga0207646_101370403 154
67 3300025922 Ga0207646_11055670 Ga0207646_110556701 154
68 3300025928 Ga0207700_10022915 Ga0207700_100229155 154
69 3300025928 Ga0207700_10064054 Ga0207700_100640542 154
70 3300025929 Ga0207664_10011277 Ga0207664_100112777 154
71 3300025929 Ga0207664_10219992 Ga0207664_102199923 154
72 3300025944 Ga0207661_11395666 Ga0207661_113956661 154
73 3300026078 Ga0207702_10013133 Ga0207702_100131333 154
74 3300028379 Ga0268266_10797019 Ga0268266_107970191 154
75 3300032002 Ga0307416_100536297 Ga0307416_1005362973 154
76 3300036459 Ga0372808_009608 Ga0372808_009608_748_1218 154
77 3300037068 Ga0373925_0273095 Ga0373925_0273095_470_934 154
78 3300037853 Ga0436364_0096222 Ga0436364_0096222_89_562 154
79 3300037853 Ga0436364_0223555 Ga0436364_0223555_4735_5205 154
80 3300037853 Ga0436364_0332993 Ga0436364_0332993_256_720 154
81 3300037853 Ga0436364_0508410 Ga0436364_0508410_463_933 154
82 3300039450 Ga0436363_0532768 Ga0436363_0532768_340_810 154
83 3300039450 Ga0436363_1359725 Ga0436363_1359725_368_832 154
84 3300044658 Ga0466972_0013346 Ga0466972_0013346_290_757 154
85 3300044658 Ga0466972_0139976 Ga0466972_0139976_333_800 154
86 3300044684 Ga0466966_0324173 Ga0466966_0324173_378_845 154
87 3300044693 Ga0466961_0010000 Ga0466961_0010000_2341_2808 154
88 3300044693 Ga0466961_0012063 Ga0466961_0012063_3384_3851 154
89 3300044693 Ga0466961_0018119 Ga0466961_0018119_3320_3787 154
90 3300044693 Ga0466961_0021578 Ga0466961_0021578_3546_4013 154
91 3300044694 Ga0466963_0005875 Ga0466963_0005875_981_1448 154
92 3300044694 Ga0466963_0024170 Ga0466963_0024170_1700_2173 154
93 3300044694 Ga0466963_0068245 Ga0466963_0068245_1525_1992 154
94 3300044694 Ga0466963_0217326 Ga0466963_0217326_720_1187 154
95 3300044694 Ga0466963_0272186 Ga0466963_0272186_315_779 154
96 3300044706 Ga0466964_0002057 Ga0466964_0002057_3703_4170 154
97 3300044706 Ga0466964_0350138 Ga0466964_0350138_58_531 154
98 3300044719 Ga0466971_0023712 Ga0466971_0023712_1288_1755 154
99 3300044735 Ga0466968_0100296 Ga0466968_0100296_650_1117 154
100 3300044735 Ga0466968_0293171 Ga0466968_0293171_141_608 154
101 3300044765 Ga0466970_0103540 Ga0466970_0103540_263_730 154
102 3300044842 Ga0466957_0013051 Ga0466957_0013051_1789_2256 154
103 3300044842 Ga0466957_0045660 Ga0466957_0045660_1323_1790 154
104 3300044901 Ga0466960_0007707 Ga0466960_0007707_718_1185 154
105 3300044901 Ga0466960_0426243 Ga0466960_0426243_244_711 154
106 3300045049 Ga0466959_0088429 Ga0466959_0088429_1543_2007 154
107 3300045836 Ga0466958_0026006 Ga0466958_0026006_2145_2612 154
108 3300045836 Ga0466958_0065888 Ga0466958_0065888_1611_2078 154
109 3300045836 Ga0466958_0486160 Ga0466958_0486160_259_726 154
110 3300045976 Ga0466967_0002478 Ga0466967_0002478_3867_4340 154
111 3300045976 Ga0466967_0625368 Ga0466967_0625368_383_850 154
112 3300046616 Ga0495668_0000476 Ga0495668_0000476_25400_25873 154
113 3300048906 Ga0496103_0207572 Ga0496103_0207572_593_1060 154
114 3300048928 Ga0496125_0048088 Ga0496125_0048088_92_565 154
115 3300048929 Ga0496126_0292396 Ga0496126_0292396_412_885 154
116 3300050490 nmdc:mga03n38_63071_c1 nmdc:mga03n38_63071_c1_673_1146 154
117 3300050513 nmdc:mga0rr50_22857_c1 nmdc:mga0rr50_22857_c1_1280_1744 154
118 3300050514 nmdc:mga08x19_9868_c1 nmdc:mga08x19_9868_c1_2992_3456 154
119 3300050515 nmdc:mga0a205_2543_c1 nmdc:mga0a205_2543_c1_3713_4177 154
120 3300053083 Ga0495655_0076465 Ga0495655_0076465_180_650 154
121 3300061719 Ga0466962_0055122 Ga0466962_0055122_892_1359 154
122 3300061719 Ga0466962_0290904 Ga0466962_0290904_123_590 154
123 iso_pu_bacteria 2579778521 2579853757 154
124 iso_pu_bacteria 2619618881 2619854521 154
125 iso_pu_bacteria 2619619003 2620348487 154
126 iso_pu_bacteria 2626541554 2626639329 154
127 iso_pu_bacteria 2671180195 2671837807 154
128 iso_pu_bacteria 2773857922 2774855963 154
129 iso_pu_bacteria 8054913762 8054915831 154
130 3300000041 ARcpr5oldR_c008752 ARcpr5oldR_0087522 155
131 3300001979 JGI24740J21852_10008938 JGI24740J21852_100089382 155
132 3300001989 JGI24739J22299_10009242 JGI24739J22299_100092423 155
133 3300001990 JGI24737J22298_10005597 JGI24737J22298_100055972 155
134 3300002067 JGI24735J21928_10006918 JGI24735J21928_100069182 155
135 3300002067 JGI24735J21928_10028510 JGI24735J21928_100285102 155
136 3300003187 JGI25151J46595_10053304 JGI25151J46595_100533042 155
137 3300003203 JGI25406J46586_10002180 JGI25406J46586_100021809 155
138 3300005435 Ga0070714_100002319 Ga0070714_10000231913 155
139 3300005577 Ga0068857_100624801 Ga0068857_1006248011 155
140 3300005718 Ga0068866_10239132 Ga0068866_102391322 155
141 3300005719 Ga0068861_100707309 Ga0068861_1007073092 155
142 3300005937 Ga0081455_10022022 Ga0081455_100220222 155
143 3300005981 Ga0081538_10269378 Ga0081538_102693781 155
144 3300005985 Ga0081539_10001360 Ga0081539_1000136023 155
145 3300006844 Ga0075428_100013049 Ga0075428_1000130497 155
146 3300006844 Ga0075428_100029100 Ga0075428_1000291004 155
147 3300006844 Ga0075428_101610095 Ga0075428_1016100951 155
148 3300006846 Ga0075430_100006683 Ga0075430_1000066838 155
149 3300006847 Ga0075431_100002651 Ga0075431_1000026519 155
150 3300006847 Ga0075431_101089521 Ga0075431_1010895211 155
151 3300006880 Ga0075429_100001968 Ga0075429_1000019688 155
152 3300006881 Ga0068865_100745038 Ga0068865_1007450382 155
153 3300009147 Ga0114129_10039724 Ga0114129_100397249 155
154 3300009147 Ga0114129_11723699 Ga0114129_117236992 155
155 3300009148 Ga0105243_12111119 Ga0105243_121111191 155
156 3300009553 Ga0105249_10054478 Ga0105249_100544782 155
157 3300011119 Ga0105246_10068886 Ga0105246_100688863 155
158 3300013104 Ga0157370_11503846 Ga0157370_115038461 155
159 3300013307 Ga0157372_10102587 Ga0157372_101025872 155
160 3300014326 Ga0157380_10732692 Ga0157380_107326922 155
161 3300025258 Ga0209129_1000028 Ga0209129_1000028127 155
162 3300025294 Ga0209025_1000112 Ga0209025_100011235 155
163 3300025303 Ga0209051_1041508 Ga0209051_10415082 155
164 3300025711 Ga0207696_1120287 Ga0207696_11202871 155
165 3300025899 Ga0207642_10560655 Ga0207642_105606551 155
166 3300025904 Ga0207647_10025020 Ga0207647_100250203 155
167 3300025914 Ga0207671_11036455 Ga0207671_110364551 155
168 3300025918 Ga0207662_10206686 Ga0207662_102066862 155
169 3300025929 Ga0207664_10003098 Ga0207664_1000309811 155
170 3300025961 Ga0207712_10117068 Ga0207712_101170682 155
171 3300025972 Ga0207668_10622650 Ga0207668_106226501 155
172 3300025986 Ga0207658_10040605 Ga0207658_100406053 155
173 3300026075 Ga0207708_10031011 Ga0207708_100310114 155
174 3300026118 Ga0207675_100081236 Ga0207675_1000812364 155
175 3300026121 Ga0207683_10831730 Ga0207683_108317301 155
176 3300030522 Ga0307512_10098572 Ga0307512_100985722 155
177 3300030735 Ga0316178_1039028 Ga0316178_10390283 155
178 3300031731 Ga0307405_10328673 Ga0307405_103286732 155
179 3300031852 Ga0307410_10255089 Ga0307410_102550891 155
180 3300031911 Ga0307412_10051199 Ga0307412_100511993 155
181 3300037312 Ga0395899_0296247 Ga0395899_0296247_253_738 155
182 3300037418 Ga0395900_0127588 Ga0395900_0127588_469_939 155
183 3300037418 Ga0395900_0159291 Ga0395900_0159291_1617_2102 155
184 3300037466 Ga0395898_0013187 Ga0395898_0013187_2050_2520 155
185 3300037466 Ga0395898_0088681 Ga0395898_0088681_398_883 155
186 3300037466 Ga0395898_0139953 Ga0395898_0139953_1678_2178 155
187 3300038443 Ga0395901_0016201 Ga0395901_0016201_2212_2697 155
188 3300038443 Ga0395901_0124421 Ga0395901_0124421_203_673 155
189 3300038443 Ga0395901_0366637 Ga0395901_0366637_225_710 155
190 3300038443 Ga0395901_1211701 Ga0395901_1211701_61_537 155
191 3300041491 Ga0451833_0806558 Ga0451833_0806558_20794_21270 155
192 3300041494 Ga0451837_0813642 Ga0451837_0813642_987_1454 155
193 3300042016 Ga0439463_125050 Ga0439463_125050_10_483 155
194 3300042138 Ga0450903_038715 Ga0450903_038715_31_498 155
195 3300044683 Ga0466965_0084243 Ga0466965_0084243_1075_1575 155
196 3300044693 Ga0466961_0017953 Ga0466961_0017953_3780_4265 155
197 3300044694 Ga0466963_0106058 Ga0466963_0106058_107_574 155
198 3300044694 Ga0466963_0310328 Ga0466963_0310328_604_1095 155
199 3300044842 Ga0466957_0491699 Ga0466957_0491699_328_795 155
200 3300044842 Ga0466957_1264874 Ga0466957_1264874_24_500 155
201 3300045976 Ga0466967_1804504 Ga0466967_1804504_60_551 155
202 3300046455 Ga0495603_0601894 Ga0495603_0601894_54_521 155
203 3300046660 Ga0495625_0130350 Ga0495625_0130350_843_1310 155
204 3300047315 Ga0495581_0120941 Ga0495581_0120941_1018_1485 155
205 3300048905 Ga0496102_0589430 Ga0496102_0589430_300_767 155
206 3300048911 Ga0496108_0195047 Ga0496108_0195047_440_919 155
207 3300048912 Ga0496109_0450148 Ga0496109_0450148_618_1085 155
208 3300049822 Ga0501035_0570192 Ga0501035_0570192_411_878 155
209 3300050507 nmdc:mga05p37_16007_c1 nmdc:mga05p37_16007_c1_6462_6929 155
210 3300050509 nmdc:mga0qj67_100677_c1 nmdc:mga0qj67_100677_c1_486_953 155
211 3300053083 Ga0495655_0001936 Ga0495655_0001936_723_1280 155
212 3300061734 Ga0530510_0996480 Ga0530510_0996480_69_560 155

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

8

134

0.97

PF08534

Redoxin

Redoxin

7

150

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.9312 3 154
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.9291 10 154
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.9227 4 153
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9197 6 154
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.909 5 154
ID Description Score Start End Superfamily
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9946 5 155 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.988 5 155 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9633 5 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9475 6 154 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9414 6 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4P8STB5-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9995 1 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A317CZZ0-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.998 14 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A0L6CGQ7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9978 4 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A4R9AYD8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9969 2 154 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A6G3HNR1-F1-model_v4 deleted 0.9942 3 99

Feature Viewer

pLDDT pTM Quality
94.31 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map