F322504
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 212 | 147 | 195 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_101033258|Ga0070714_1010332581 |
| Length | 153 |
| Sequence | MTDKRLAPGDPAPDFTLPDADGNQVSLSSFRGRRVIVYFYPAAMTPGCTKQACDFRDNLDAIGAQVLGISPDAPARLAKFRDRDALTFPLLSDPDHAVGQAYGAYGEKKLYGKTTVGVIRSTFVIDADGVIEKAMYSVKATGHVARLMAEIGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 2 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 3 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 4 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 5 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 6 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 7 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 8 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 9 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 10 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 11 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 12 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 13 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 14 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 15 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 16 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 20 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 21 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 22 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 23 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 52 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 65 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 67 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 68 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 93 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 94 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 95 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 96 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 98 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 99 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 100 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 102 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 103 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 104 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 107 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 108 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 109 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 110 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 111 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 112 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 113 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 116 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 117 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 118 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 119 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 120 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 121 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 130 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 131 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 132 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 133 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 134 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 135 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 136 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 138 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 139 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 140 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 141 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 142 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 143 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 145 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 146 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 147 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.57 |
| Metatranscriptomes | 1.42 |
| Isolates | 8.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.83 |
| Nodule | 2.83 |
| Rhizoplane | 2.36 |
| Rhizosphere | 82.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.43 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c008752 | 3300000041 | Bacteria | 857 |
| 2 | JGI24740J21852_10008938 | 3300001979 | Bacteria | 3957 |
| 3 | JGI24739J22299_10009242 | 3300001989 | Bacteria | 3678 |
| 4 | JGI24737J22298_10005597 | 3300001990 | Bacteria | 4329 |
| 5 | JGI24735J21928_10006918 | 3300002067 | Bacteria | 3713 |
| 6 | JGI24735J21928_10028510 | 3300002067 | Bacteria | 1666 |
| 7 | JGI25151J46595_10053304 | 3300003187 | Bacteria | 1352 |
| 8 | JGI25406J46586_10002180 | 3300003203 | Bacteria | 9240 |
| 9 | Ga0065714_10104233 | 3300005288 | Bacteria | 1588 |
| 10 | Ga0070683_100134148 | 3300005329 | Bacteria | 2344 |
| 11 | Ga0070714_100002230 | 3300005435 | Bacteria | 14279 |
| 12 | Ga0070714_100002319 | 3300005435 | Bacteria | 13997 |
| 13 | Ga0070714_100007006 | 3300005435 | Bacteria | 8743 |
| 14 | Ga0070714_101033258 | 3300005435 | Bacteria | 800 |
| 15 | Ga0070713_100053779 | 3300005436 | Bacteria | 3338 |
| 16 | Ga0070713_100531781 | 3300005436 | Bacteria | 1112 |
| 17 | Ga0070708_100017884 | 3300005445 | Bacteria | 5923 |
| 18 | Ga0070708_100019918 | 3300005445 | Bacteria | 5646 |
| 19 | Ga0070708_100039540 | 3300005445 | Bacteria | 4127 |
| 20 | Ga0070708_100463348 | 3300005445 | Bacteria | 1196 |
| 21 | Ga0070681_10039297 | 3300005458 | Bacteria | 4744 |
| 22 | Ga0070706_100002257 | 3300005467 | Bacteria | 19521 |
| 23 | Ga0070706_100009744 | 3300005467 | Bacteria | 8927 |
| 24 | Ga0070707_100010799 | 3300005468 | Bacteria | 8503 |
| 25 | Ga0070707_101121823 | 3300005468 | Bacteria | 752 |
| 26 | Ga0070707_101444390 | 3300005468 | Bacteria | 654 |
| 27 | Ga0070698_100003200 | 3300005471 | Bacteria | 18039 |
| 28 | Ga0070698_100005829 | 3300005471 | Bacteria | 13474 |
| 29 | Ga0070698_100044667 | 3300005471 | Bacteria | 4535 |
| 30 | Ga0070698_101235758 | 3300005471 | Bacteria | 697 |
| 31 | Ga0070679_101375130 | 3300005530 | Bacteria | 652 |
| 32 | Ga0070697_100064523 | 3300005536 | Bacteria | 2991 |
| 33 | Ga0070665_100674733 | 3300005548 | Bacteria | 1046 |
| 34 | Ga0068857_100624801 | 3300005577 | Bacteria | 1019 |
| 35 | Ga0068856_100029473 | 3300005614 | Bacteria | 5361 |
| 36 | Ga0068866_10239132 | 3300005718 | Bacteria | 1105 |
| 37 | Ga0068861_100707309 | 3300005719 | Bacteria | 937 |
| 38 | Ga0081455_10022022 | 3300005937 | Bacteria | 5966 |
| 39 | Ga0081538_10269378 | 3300005981 | Bacteria | 638 |
| 40 | Ga0081539_10001360 | 3300005985 | Bacteria | 42450 |
| 41 | Ga0070717_10074131 | 3300006028 | Bacteria | 2845 |
| 42 | Ga0070712_100765133 | 3300006175 | Bacteria | 827 |
| 43 | Ga0075370_10082982 | 3300006353 | Bacteria | 1843 |
| 44 | Ga0075428_100013049 | 3300006844 | Bacteria | 9234 |
| 45 | Ga0075428_100029100 | 3300006844 | Bacteria | 6112 |
| 46 | Ga0075428_101610095 | 3300006844 | Bacteria | 679 |
| 47 | Ga0075430_100006683 | 3300006846 | Bacteria | 9730 |
| 48 | Ga0075431_100002651 | 3300006847 | Bacteria | 17323 |
| 49 | Ga0075431_101089521 | 3300006847 | Bacteria | 764 |
| 50 | Ga0075433_10104196 | 3300006852 | Bacteria | 2513 |
| 51 | Ga0075434_100216032 | 3300006871 | Bacteria | 1937 |
| 52 | Ga0075429_100001968 | 3300006880 | Bacteria | 17077 |
| 53 | Ga0068865_100745038 | 3300006881 | Bacteria | 841 |
| 54 | Ga0075436_100051797 | 3300006914 | Bacteria | 2832 |
| 55 | Ga0105240_10037820 | 3300009093 | Bacteria | 6198 |
| 56 | Ga0114129_10039724 | 3300009147 | Bacteria | 6636 |
| 57 | Ga0114129_11723699 | 3300009147 | Bacteria | 764 |
| 58 | Ga0105243_12111119 | 3300009148 | Bacteria | 599 |
| 59 | Ga0105237_10013003 | 3300009545 | Bacteria | 8741 |
| 60 | Ga0105249_10054478 | 3300009553 | Bacteria | 3658 |
| 61 | Ga0105249_13287064 | 3300009553 | Bacteria | 520 |
| 62 | Ga0105239_10025441 | 3300010375 | Bacteria | 6517 |
| 63 | Ga0105246_10068886 | 3300011119 | Bacteria | 2483 |
| 64 | Ga0157370_11503846 | 3300013104 | Bacteria | 605 |
| 65 | Ga0157372_10102587 | 3300013307 | Bacteria | 3268 |
| 66 | Ga0157380_10732692 | 3300014326 | Bacteria | 998 |
| 67 | Ga0206353_11035191 | 3300020082 | Bacteria | 971 |
| 68 | Ga0213875_10240897 | 3300021388 | Bacteria | 852 |
| 69 | Ga0224712_10490675 | 3300022467 | Bacteria | 593 |
| 70 | Ga0224571_106415 | 3300022734 | Bacteria | 784 |
| 71 | Ga0224572_1000609 | 3300024225 | Bacteria | 4437 |
| 72 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 73 | Ga0209025_1000112 | 3300025294 | Bacteria | 218958 |
| 74 | Ga0209051_1041508 | 3300025303 | Bacteria | 1636 |
| 75 | Ga0207696_1120287 | 3300025711 | Bacteria | 708 |
| 76 | Ga0207642_10560655 | 3300025899 | Bacteria | 706 |
| 77 | Ga0207647_10025020 | 3300025904 | Bacteria | 3930 |
| 78 | Ga0207684_10038181 | 3300025910 | Bacteria | 4075 |
| 79 | Ga0207684_10060072 | 3300025910 | Bacteria | 3228 |
| 80 | Ga0207684_10095016 | 3300025910 | Bacteria | 2543 |
| 81 | Ga0207695_10080017 | 3300025913 | Bacteria | 3310 |
| 82 | Ga0207671_10067497 | 3300025914 | Bacteria | 2663 |
| 83 | Ga0207671_11036455 | 3300025914 | Bacteria | 646 |
| 84 | Ga0207693_10424237 | 3300025915 | Bacteria | 1040 |
| 85 | Ga0207693_10537196 | 3300025915 | Bacteria | 912 |
| 86 | Ga0207662_10206686 | 3300025918 | Bacteria | 1273 |
| 87 | Ga0207652_11029459 | 3300025921 | Bacteria | 723 |
| 88 | Ga0207646_10018915 | 3300025922 | Bacteria | 6413 |
| 89 | Ga0207646_10021231 | 3300025922 | Bacteria | 6002 |
| 90 | Ga0207646_10137040 | 3300025922 | Bacteria | 2204 |
| 91 | Ga0207646_11055670 | 3300025922 | Bacteria | 716 |
| 92 | Ga0207700_10022915 | 3300025928 | Bacteria | 4293 |
| 93 | Ga0207700_10064054 | 3300025928 | Bacteria | 2799 |
| 94 | Ga0207664_10003098 | 3300025929 | Bacteria | 11047 |
| 95 | Ga0207664_10011277 | 3300025929 | Bacteria | 6341 |
| 96 | Ga0207664_10219992 | 3300025929 | Bacteria | 1646 |
| 97 | Ga0207664_11572645 | 3300025929 | Bacteria | 579 |
| 98 | Ga0207661_11395666 | 3300025944 | Bacteria | 643 |
| 99 | Ga0207712_10117068 | 3300025961 | Bacteria | 2009 |
| 100 | Ga0207668_10622650 | 3300025972 | Bacteria | 942 |
| 101 | Ga0207658_10040605 | 3300025986 | Bacteria | 3365 |
| 102 | Ga0207708_10031011 | 3300026075 | Bacteria | 4057 |
| 103 | Ga0207702_10013133 | 3300026078 | Bacteria | 6886 |
| 104 | Ga0207675_100081236 | 3300026118 | Bacteria | 3039 |
| 105 | Ga0207683_10831730 | 3300026121 | Bacteria | 857 |
| 106 | Ga0268266_10797019 | 3300028379 | Bacteria | 912 |
| 107 | Ga0307512_10098572 | 3300030522 | Bacteria | 1994 |
| 108 | Ga0316178_1039028 | 3300030735 | Bacteria | 934 |
| 109 | Ga0307405_10328673 | 3300031731 | Bacteria | 1171 |
| 110 | Ga0307410_10255089 | 3300031852 | Bacteria | 1365 |
| 111 | Ga0307412_10051199 | 3300031911 | Bacteria | 2728 |
| 112 | Ga0307409_101518401 | 3300031995 | Bacteria | 697 |
| 113 | Ga0307416_100536297 | 3300032002 | Bacteria | 1241 |
| 114 | Ga0372808_009608 | 3300036459 | Bacteria | 1353 |
| 115 | Ga0373925_0273095 | 3300037068 | Bacteria | 1360 |
| 116 | Ga0395899_0296247 | 3300037312 | Bacteria | 1096 |
| 117 | Ga0395900_0127588 | 3300037418 | Bacteria | 2608 |
| 118 | Ga0395900_0159291 | 3300037418 | Bacteria | 2303 |
| 119 | Ga0395898_0013187 | 3300037466 | Bacteria | 8514 |
| 120 | Ga0395898_0088681 | 3300037466 | Bacteria | 2977 |
| 121 | Ga0395898_0139953 | 3300037466 | Bacteria | 2317 |
| 122 | Ga0436364_0096222 | 3300037853 | Bacteria | 855 |
| 123 | Ga0436364_0223555 | 3300037853 | Bacteria | 5358 |
| 124 | Ga0436364_0332993 | 3300037853 | Bacteria | 815 |
| 125 | Ga0436364_0508410 | 3300037853 | Bacteria | 1220 |
| 126 | Ga0395901_0016201 | 3300038443 | Bacteria | 7594 |
| 127 | Ga0395901_0124421 | 3300038443 | Bacteria | 2709 |
| 128 | Ga0395901_0366637 | 3300038443 | Bacteria | 1484 |
| 129 | Ga0395901_1211701 | 3300038443 | Bacteria | 720 |
| 130 | Ga0436363_0532768 | 3300039450 | Bacteria | 2532 |
| 131 | Ga0436363_1359725 | 3300039450 | Bacteria | 3420 |
| 132 | Ga0451833_0806558 | 3300041491 | Bacteria | 35180 |
| 133 | Ga0451837_0813642 | 3300041494 | Bacteria | 1725 |
| 134 | Ga0439463_125050 | 3300042016 | Unclassified | 665 |
| 135 | Ga0450903_038715 | 3300042138 | Bacteria | 708 |
| 136 | Ga0466972_0013346 | 3300044658 | Bacteria | 4125 |
| 137 | Ga0466972_0139976 | 3300044658 | Bacteria | 1139 |
| 138 | Ga0466965_0084243 | 3300044683 | Bacteria | 1610 |
| 139 | Ga0466966_0324173 | 3300044684 | Bacteria | 925 |
| 140 | Ga0466961_0010000 | 3300044693 | Bacteria | 6044 |
| 141 | Ga0466961_0012063 | 3300044693 | Bacteria | 5523 |
| 142 | Ga0466961_0017953 | 3300044693 | Bacteria | 4549 |
| 143 | Ga0466961_0018119 | 3300044693 | Bacteria | 4528 |
| 144 | Ga0466961_0021578 | 3300044693 | Bacteria | 4144 |
| 145 | Ga0466963_0005875 | 3300044694 | Bacteria | 7234 |
| 146 | Ga0466963_0024170 | 3300044694 | Bacteria | 3867 |
| 147 | Ga0466963_0068245 | 3300044694 | Bacteria | 2388 |
| 148 | Ga0466963_0106058 | 3300044694 | Bacteria | 1926 |
| 149 | Ga0466963_0217326 | 3300044694 | Bacteria | 1338 |
| 150 | Ga0466963_0272186 | 3300044694 | Bacteria | 1190 |
| 151 | Ga0466963_0310328 | 3300044694 | Bacteria | 1110 |
| 152 | Ga0466964_0002057 | 3300044706 | Bacteria | 7078 |
| 153 | Ga0466964_0350138 | 3300044706 | Bacteria | 759 |
| 154 | Ga0466971_0023712 | 3300044719 | Bacteria | 2735 |
| 155 | Ga0466968_0100296 | 3300044735 | Bacteria | 1292 |
| 156 | Ga0466968_0293171 | 3300044735 | Bacteria | 781 |
| 157 | Ga0466970_0103540 | 3300044765 | Bacteria | 1551 |
| 158 | Ga0466957_0013051 | 3300044842 | Bacteria | 4814 |
| 159 | Ga0466957_0045660 | 3300044842 | Bacteria | 2657 |
| 160 | Ga0466957_0491699 | 3300044842 | Bacteria | 850 |
| 161 | Ga0466957_1264874 | 3300044842 | Bacteria | 535 |
| 162 | Ga0466960_0007707 | 3300044901 | Bacteria | 4386 |
| 163 | Ga0466960_0426243 | 3300044901 | Bacteria | 768 |
| 164 | Ga0466959_0088429 | 3300045049 | Bacteria | 2227 |
| 165 | Ga0466958_0026006 | 3300045836 | Bacteria | 3456 |
| 166 | Ga0466958_0065888 | 3300045836 | Bacteria | 2210 |
| 167 | Ga0466958_0486160 | 3300045836 | Bacteria | 801 |
| 168 | Ga0466967_0002478 | 3300045976 | Bacteria | 11516 |
| 169 | Ga0466967_0625368 | 3300045976 | Bacteria | 1063 |
| 170 | Ga0466967_1188397 | 3300045976 | Bacteria | 760 |
| 171 | Ga0466967_1804504 | 3300045976 | Bacteria | 609 |
| 172 | Ga0495603_0601894 | 3300046455 | Bacteria | 629 |
| 173 | Ga0495668_0000476 | 3300046616 | Bacteria | 50569 |
| 174 | Ga0495625_0130350 | 3300046660 | Bacteria | 1704 |
| 175 | Ga0495581_0120941 | 3300047315 | Bacteria | 1524 |
| 176 | Ga0496102_0589430 | 3300048905 | Bacteria | 1035 |
| 177 | Ga0496103_0207572 | 3300048906 | Bacteria | 1260 |
| 178 | Ga0496108_0160685 | 3300048911 | Bacteria | 1941 |
| 179 | Ga0496108_0195047 | 3300048911 | Bacteria | 1756 |
| 180 | Ga0496109_0450148 | 3300048912 | Bacteria | 1216 |
| 181 | Ga0496125_0048088 | 3300048928 | Bacteria | 3560 |
| 182 | Ga0496126_0292396 | 3300048929 | Bacteria | 1347 |
| 183 | Ga0501214_059015 | 3300049659 | Bacteria | 602 |
| 184 | Ga0501035_0570192 | 3300049822 | Bacteria | 925 |
| 185 | nmdc:mga03n38_63071_c1 | 3300050490 | Bacteria | 1693 |
| 186 | nmdc:mga05p37_16007_c1 | 3300050507 | Bacteria | 9024 |
| 187 | nmdc:mga0qj67_100677_c1 | 3300050509 | Bacteria | 2330 |
| 188 | nmdc:mga0rr50_22857_c1 | 3300050513 | Bacteria | 4300 |
| 189 | nmdc:mga08x19_9868_c1 | 3300050514 | Bacteria | 5723 |
| 190 | nmdc:mga0a205_2543_c1 | 3300050515 | Bacteria | 13172 |
| 191 | Ga0495655_0001936 | 3300053083 | Bacteria | 3229 |
| 192 | Ga0495655_0076465 | 3300053083 | Bacteria | 948 |
| 193 | Ga0466962_0055122 | 3300061719 | Bacteria | 1899 |
| 194 | Ga0466962_0290904 | 3300061719 | Bacteria | 807 |
| 195 | Ga0530510_0996480 | 3300061734 | Bacteria | 641 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8054920844 | 8054922360 | 149 |
| 2 | 3300005288 | Ga0065714_10104233 | Ga0065714_101042331 | 150 |
| 3 | 3300005435 | Ga0070714_101033258 | Ga0070714_1010332581 | 151 |
| 4 | 3300006175 | Ga0070712_100765133 | Ga0070712_1007651332 | 151 |
| 5 | 3300025915 | Ga0207693_10424237 | Ga0207693_104242372 | 151 |
| 6 | 3300025929 | Ga0207664_11572645 | Ga0207664_115726452 | 151 |
| 7 | 3300045976 | Ga0466967_1188397 | Ga0466967_1188397_125_586 | 151 |
| 8 | 3300048911 | Ga0496108_0160685 | Ga0496108_0160685_839_1294 | 151 |
| 9 | iso_pu_bacteria | 2816332119 | 2816424142 | 151 |
| 10 | iso_pu_bacteria | 2844849076 | 2844849358 | 151 |
| 11 | iso_pu_bacteria | 2905926851 | 2905927412 | 151 |
| 12 | 3300031995 | Ga0307409_101518401 | Ga0307409_1015184012 | 152 |
| 13 | 3300049659 | Ga0501214_059015 | Ga0501214_059015_24_500 | 152 |
| 14 | iso_pu_bacteria | 2585427649 | 2586058661 | 152 |
| 15 | iso_pu_bacteria | 2565956761 | 2566995412 | 153 |
| 16 | iso_pu_bacteria | 2751185725 | 2753035336 | 153 |
| 17 | iso_pu_bacteria | 2751185792 | 2753323853 | 153 |
| 18 | iso_pu_bacteria | 2904535858 | 2904539680 | 153 |
| 19 | iso_pu_bacteria | 2922554459 | 2922557692 | 153 |
| 20 | 3300005329 | Ga0070683_100134148 | Ga0070683_1001341483 | 154 |
| 21 | 3300005435 | Ga0070714_100002230 | Ga0070714_1000022307 | 154 |
| 22 | 3300005435 | Ga0070714_100007006 | Ga0070714_1000070067 | 154 |
| 23 | 3300005436 | Ga0070713_100053779 | Ga0070713_1000537796 | 154 |
| 24 | 3300005436 | Ga0070713_100531781 | Ga0070713_1005317812 | 154 |
| 25 | 3300005445 | Ga0070708_100017884 | Ga0070708_1000178844 | 154 |
| 26 | 3300005445 | Ga0070708_100019918 | Ga0070708_1000199186 | 154 |
| 27 | 3300005445 | Ga0070708_100039540 | Ga0070708_1000395405 | 154 |
| 28 | 3300005445 | Ga0070708_100463348 | Ga0070708_1004633482 | 154 |
| 29 | 3300005458 | Ga0070681_10039297 | Ga0070681_100392973 | 154 |
| 30 | 3300005467 | Ga0070706_100002257 | Ga0070706_1000022575 | 154 |
| 31 | 3300005467 | Ga0070706_100009744 | Ga0070706_1000097447 | 154 |
| 32 | 3300005468 | Ga0070707_100010799 | Ga0070707_1000107996 | 154 |
| 33 | 3300005468 | Ga0070707_101121823 | Ga0070707_1011218231 | 154 |
| 34 | 3300005468 | Ga0070707_101444390 | Ga0070707_1014443901 | 154 |
| 35 | 3300005471 | Ga0070698_100003200 | Ga0070698_1000032001 | 154 |
| 36 | 3300005471 | Ga0070698_100005829 | Ga0070698_1000058299 | 154 |
| 37 | 3300005471 | Ga0070698_100044667 | Ga0070698_1000446673 | 154 |
| 38 | 3300005471 | Ga0070698_101235758 | Ga0070698_1012357582 | 154 |
| 39 | 3300005530 | Ga0070679_101375130 | Ga0070679_1013751301 | 154 |
| 40 | 3300005536 | Ga0070697_100064523 | Ga0070697_1000645233 | 154 |
| 41 | 3300005548 | Ga0070665_100674733 | Ga0070665_1006747332 | 154 |
| 42 | 3300005614 | Ga0068856_100029473 | Ga0068856_1000294734 | 154 |
| 43 | 3300006028 | Ga0070717_10074131 | Ga0070717_100741313 | 154 |
| 44 | 3300006353 | Ga0075370_10082982 | Ga0075370_100829824 | 154 |
| 45 | 3300006852 | Ga0075433_10104196 | Ga0075433_101041963 | 154 |
| 46 | 3300006871 | Ga0075434_100216032 | Ga0075434_1002160322 | 154 |
| 47 | 3300006914 | Ga0075436_100051797 | Ga0075436_1000517974 | 154 |
| 48 | 3300009093 | Ga0105240_10037820 | Ga0105240_100378208 | 154 |
| 49 | 3300009545 | Ga0105237_10013003 | Ga0105237_100130038 | 154 |
| 50 | 3300009553 | Ga0105249_13287064 | Ga0105249_132870641 | 154 |
| 51 | 3300010375 | Ga0105239_10025441 | Ga0105239_100254414 | 154 |
| 52 | 3300020082 | Ga0206353_11035191 | Ga0206353_110351913 | 154 |
| 53 | 3300021388 | Ga0213875_10240897 | Ga0213875_102408971 | 154 |
| 54 | 3300022467 | Ga0224712_10490675 | Ga0224712_104906751 | 154 |
| 55 | 3300022734 | Ga0224571_106415 | Ga0224571_1064151 | 154 |
| 56 | 3300024225 | Ga0224572_1000609 | Ga0224572_10006093 | 154 |
| 57 | 3300025910 | Ga0207684_10038181 | Ga0207684_100381815 | 154 |
| 58 | 3300025910 | Ga0207684_10060072 | Ga0207684_100600724 | 154 |
| 59 | 3300025910 | Ga0207684_10095016 | Ga0207684_100950162 | 154 |
| 60 | 3300025913 | Ga0207695_10080017 | Ga0207695_100800174 | 154 |
| 61 | 3300025914 | Ga0207671_10067497 | Ga0207671_100674974 | 154 |
| 62 | 3300025915 | Ga0207693_10537196 | Ga0207693_105371963 | 154 |
| 63 | 3300025921 | Ga0207652_11029459 | Ga0207652_110294591 | 154 |
| 64 | 3300025922 | Ga0207646_10018915 | Ga0207646_100189159 | 154 |
| 65 | 3300025922 | Ga0207646_10021231 | Ga0207646_100212314 | 154 |
| 66 | 3300025922 | Ga0207646_10137040 | Ga0207646_101370403 | 154 |
| 67 | 3300025922 | Ga0207646_11055670 | Ga0207646_110556701 | 154 |
| 68 | 3300025928 | Ga0207700_10022915 | Ga0207700_100229155 | 154 |
| 69 | 3300025928 | Ga0207700_10064054 | Ga0207700_100640542 | 154 |
| 70 | 3300025929 | Ga0207664_10011277 | Ga0207664_100112777 | 154 |
| 71 | 3300025929 | Ga0207664_10219992 | Ga0207664_102199923 | 154 |
| 72 | 3300025944 | Ga0207661_11395666 | Ga0207661_113956661 | 154 |
| 73 | 3300026078 | Ga0207702_10013133 | Ga0207702_100131333 | 154 |
| 74 | 3300028379 | Ga0268266_10797019 | Ga0268266_107970191 | 154 |
| 75 | 3300032002 | Ga0307416_100536297 | Ga0307416_1005362973 | 154 |
| 76 | 3300036459 | Ga0372808_009608 | Ga0372808_009608_748_1218 | 154 |
| 77 | 3300037068 | Ga0373925_0273095 | Ga0373925_0273095_470_934 | 154 |
| 78 | 3300037853 | Ga0436364_0096222 | Ga0436364_0096222_89_562 | 154 |
| 79 | 3300037853 | Ga0436364_0223555 | Ga0436364_0223555_4735_5205 | 154 |
| 80 | 3300037853 | Ga0436364_0332993 | Ga0436364_0332993_256_720 | 154 |
| 81 | 3300037853 | Ga0436364_0508410 | Ga0436364_0508410_463_933 | 154 |
| 82 | 3300039450 | Ga0436363_0532768 | Ga0436363_0532768_340_810 | 154 |
| 83 | 3300039450 | Ga0436363_1359725 | Ga0436363_1359725_368_832 | 154 |
| 84 | 3300044658 | Ga0466972_0013346 | Ga0466972_0013346_290_757 | 154 |
| 85 | 3300044658 | Ga0466972_0139976 | Ga0466972_0139976_333_800 | 154 |
| 86 | 3300044684 | Ga0466966_0324173 | Ga0466966_0324173_378_845 | 154 |
| 87 | 3300044693 | Ga0466961_0010000 | Ga0466961_0010000_2341_2808 | 154 |
| 88 | 3300044693 | Ga0466961_0012063 | Ga0466961_0012063_3384_3851 | 154 |
| 89 | 3300044693 | Ga0466961_0018119 | Ga0466961_0018119_3320_3787 | 154 |
| 90 | 3300044693 | Ga0466961_0021578 | Ga0466961_0021578_3546_4013 | 154 |
| 91 | 3300044694 | Ga0466963_0005875 | Ga0466963_0005875_981_1448 | 154 |
| 92 | 3300044694 | Ga0466963_0024170 | Ga0466963_0024170_1700_2173 | 154 |
| 93 | 3300044694 | Ga0466963_0068245 | Ga0466963_0068245_1525_1992 | 154 |
| 94 | 3300044694 | Ga0466963_0217326 | Ga0466963_0217326_720_1187 | 154 |
| 95 | 3300044694 | Ga0466963_0272186 | Ga0466963_0272186_315_779 | 154 |
| 96 | 3300044706 | Ga0466964_0002057 | Ga0466964_0002057_3703_4170 | 154 |
| 97 | 3300044706 | Ga0466964_0350138 | Ga0466964_0350138_58_531 | 154 |
| 98 | 3300044719 | Ga0466971_0023712 | Ga0466971_0023712_1288_1755 | 154 |
| 99 | 3300044735 | Ga0466968_0100296 | Ga0466968_0100296_650_1117 | 154 |
| 100 | 3300044735 | Ga0466968_0293171 | Ga0466968_0293171_141_608 | 154 |
| 101 | 3300044765 | Ga0466970_0103540 | Ga0466970_0103540_263_730 | 154 |
| 102 | 3300044842 | Ga0466957_0013051 | Ga0466957_0013051_1789_2256 | 154 |
| 103 | 3300044842 | Ga0466957_0045660 | Ga0466957_0045660_1323_1790 | 154 |
| 104 | 3300044901 | Ga0466960_0007707 | Ga0466960_0007707_718_1185 | 154 |
| 105 | 3300044901 | Ga0466960_0426243 | Ga0466960_0426243_244_711 | 154 |
| 106 | 3300045049 | Ga0466959_0088429 | Ga0466959_0088429_1543_2007 | 154 |
| 107 | 3300045836 | Ga0466958_0026006 | Ga0466958_0026006_2145_2612 | 154 |
| 108 | 3300045836 | Ga0466958_0065888 | Ga0466958_0065888_1611_2078 | 154 |
| 109 | 3300045836 | Ga0466958_0486160 | Ga0466958_0486160_259_726 | 154 |
| 110 | 3300045976 | Ga0466967_0002478 | Ga0466967_0002478_3867_4340 | 154 |
| 111 | 3300045976 | Ga0466967_0625368 | Ga0466967_0625368_383_850 | 154 |
| 112 | 3300046616 | Ga0495668_0000476 | Ga0495668_0000476_25400_25873 | 154 |
| 113 | 3300048906 | Ga0496103_0207572 | Ga0496103_0207572_593_1060 | 154 |
| 114 | 3300048928 | Ga0496125_0048088 | Ga0496125_0048088_92_565 | 154 |
| 115 | 3300048929 | Ga0496126_0292396 | Ga0496126_0292396_412_885 | 154 |
| 116 | 3300050490 | nmdc:mga03n38_63071_c1 | nmdc:mga03n38_63071_c1_673_1146 | 154 |
| 117 | 3300050513 | nmdc:mga0rr50_22857_c1 | nmdc:mga0rr50_22857_c1_1280_1744 | 154 |
| 118 | 3300050514 | nmdc:mga08x19_9868_c1 | nmdc:mga08x19_9868_c1_2992_3456 | 154 |
| 119 | 3300050515 | nmdc:mga0a205_2543_c1 | nmdc:mga0a205_2543_c1_3713_4177 | 154 |
| 120 | 3300053083 | Ga0495655_0076465 | Ga0495655_0076465_180_650 | 154 |
| 121 | 3300061719 | Ga0466962_0055122 | Ga0466962_0055122_892_1359 | 154 |
| 122 | 3300061719 | Ga0466962_0290904 | Ga0466962_0290904_123_590 | 154 |
| 123 | iso_pu_bacteria | 2579778521 | 2579853757 | 154 |
| 124 | iso_pu_bacteria | 2619618881 | 2619854521 | 154 |
| 125 | iso_pu_bacteria | 2619619003 | 2620348487 | 154 |
| 126 | iso_pu_bacteria | 2626541554 | 2626639329 | 154 |
| 127 | iso_pu_bacteria | 2671180195 | 2671837807 | 154 |
| 128 | iso_pu_bacteria | 2773857922 | 2774855963 | 154 |
| 129 | iso_pu_bacteria | 8054913762 | 8054915831 | 154 |
| 130 | 3300000041 | ARcpr5oldR_c008752 | ARcpr5oldR_0087522 | 155 |
| 131 | 3300001979 | JGI24740J21852_10008938 | JGI24740J21852_100089382 | 155 |
| 132 | 3300001989 | JGI24739J22299_10009242 | JGI24739J22299_100092423 | 155 |
| 133 | 3300001990 | JGI24737J22298_10005597 | JGI24737J22298_100055972 | 155 |
| 134 | 3300002067 | JGI24735J21928_10006918 | JGI24735J21928_100069182 | 155 |
| 135 | 3300002067 | JGI24735J21928_10028510 | JGI24735J21928_100285102 | 155 |
| 136 | 3300003187 | JGI25151J46595_10053304 | JGI25151J46595_100533042 | 155 |
| 137 | 3300003203 | JGI25406J46586_10002180 | JGI25406J46586_100021809 | 155 |
| 138 | 3300005435 | Ga0070714_100002319 | Ga0070714_10000231913 | 155 |
| 139 | 3300005577 | Ga0068857_100624801 | Ga0068857_1006248011 | 155 |
| 140 | 3300005718 | Ga0068866_10239132 | Ga0068866_102391322 | 155 |
| 141 | 3300005719 | Ga0068861_100707309 | Ga0068861_1007073092 | 155 |
| 142 | 3300005937 | Ga0081455_10022022 | Ga0081455_100220222 | 155 |
| 143 | 3300005981 | Ga0081538_10269378 | Ga0081538_102693781 | 155 |
| 144 | 3300005985 | Ga0081539_10001360 | Ga0081539_1000136023 | 155 |
| 145 | 3300006844 | Ga0075428_100013049 | Ga0075428_1000130497 | 155 |
| 146 | 3300006844 | Ga0075428_100029100 | Ga0075428_1000291004 | 155 |
| 147 | 3300006844 | Ga0075428_101610095 | Ga0075428_1016100951 | 155 |
| 148 | 3300006846 | Ga0075430_100006683 | Ga0075430_1000066838 | 155 |
| 149 | 3300006847 | Ga0075431_100002651 | Ga0075431_1000026519 | 155 |
| 150 | 3300006847 | Ga0075431_101089521 | Ga0075431_1010895211 | 155 |
| 151 | 3300006880 | Ga0075429_100001968 | Ga0075429_1000019688 | 155 |
| 152 | 3300006881 | Ga0068865_100745038 | Ga0068865_1007450382 | 155 |
| 153 | 3300009147 | Ga0114129_10039724 | Ga0114129_100397249 | 155 |
| 154 | 3300009147 | Ga0114129_11723699 | Ga0114129_117236992 | 155 |
| 155 | 3300009148 | Ga0105243_12111119 | Ga0105243_121111191 | 155 |
| 156 | 3300009553 | Ga0105249_10054478 | Ga0105249_100544782 | 155 |
| 157 | 3300011119 | Ga0105246_10068886 | Ga0105246_100688863 | 155 |
| 158 | 3300013104 | Ga0157370_11503846 | Ga0157370_115038461 | 155 |
| 159 | 3300013307 | Ga0157372_10102587 | Ga0157372_101025872 | 155 |
| 160 | 3300014326 | Ga0157380_10732692 | Ga0157380_107326922 | 155 |
| 161 | 3300025258 | Ga0209129_1000028 | Ga0209129_1000028127 | 155 |
| 162 | 3300025294 | Ga0209025_1000112 | Ga0209025_100011235 | 155 |
| 163 | 3300025303 | Ga0209051_1041508 | Ga0209051_10415082 | 155 |
| 164 | 3300025711 | Ga0207696_1120287 | Ga0207696_11202871 | 155 |
| 165 | 3300025899 | Ga0207642_10560655 | Ga0207642_105606551 | 155 |
| 166 | 3300025904 | Ga0207647_10025020 | Ga0207647_100250203 | 155 |
| 167 | 3300025914 | Ga0207671_11036455 | Ga0207671_110364551 | 155 |
| 168 | 3300025918 | Ga0207662_10206686 | Ga0207662_102066862 | 155 |
| 169 | 3300025929 | Ga0207664_10003098 | Ga0207664_1000309811 | 155 |
| 170 | 3300025961 | Ga0207712_10117068 | Ga0207712_101170682 | 155 |
| 171 | 3300025972 | Ga0207668_10622650 | Ga0207668_106226501 | 155 |
| 172 | 3300025986 | Ga0207658_10040605 | Ga0207658_100406053 | 155 |
| 173 | 3300026075 | Ga0207708_10031011 | Ga0207708_100310114 | 155 |
| 174 | 3300026118 | Ga0207675_100081236 | Ga0207675_1000812364 | 155 |
| 175 | 3300026121 | Ga0207683_10831730 | Ga0207683_108317301 | 155 |
| 176 | 3300030522 | Ga0307512_10098572 | Ga0307512_100985722 | 155 |
| 177 | 3300030735 | Ga0316178_1039028 | Ga0316178_10390283 | 155 |
| 178 | 3300031731 | Ga0307405_10328673 | Ga0307405_103286732 | 155 |
| 179 | 3300031852 | Ga0307410_10255089 | Ga0307410_102550891 | 155 |
| 180 | 3300031911 | Ga0307412_10051199 | Ga0307412_100511993 | 155 |
| 181 | 3300037312 | Ga0395899_0296247 | Ga0395899_0296247_253_738 | 155 |
| 182 | 3300037418 | Ga0395900_0127588 | Ga0395900_0127588_469_939 | 155 |
| 183 | 3300037418 | Ga0395900_0159291 | Ga0395900_0159291_1617_2102 | 155 |
| 184 | 3300037466 | Ga0395898_0013187 | Ga0395898_0013187_2050_2520 | 155 |
| 185 | 3300037466 | Ga0395898_0088681 | Ga0395898_0088681_398_883 | 155 |
| 186 | 3300037466 | Ga0395898_0139953 | Ga0395898_0139953_1678_2178 | 155 |
| 187 | 3300038443 | Ga0395901_0016201 | Ga0395901_0016201_2212_2697 | 155 |
| 188 | 3300038443 | Ga0395901_0124421 | Ga0395901_0124421_203_673 | 155 |
| 189 | 3300038443 | Ga0395901_0366637 | Ga0395901_0366637_225_710 | 155 |
| 190 | 3300038443 | Ga0395901_1211701 | Ga0395901_1211701_61_537 | 155 |
| 191 | 3300041491 | Ga0451833_0806558 | Ga0451833_0806558_20794_21270 | 155 |
| 192 | 3300041494 | Ga0451837_0813642 | Ga0451837_0813642_987_1454 | 155 |
| 193 | 3300042016 | Ga0439463_125050 | Ga0439463_125050_10_483 | 155 |
| 194 | 3300042138 | Ga0450903_038715 | Ga0450903_038715_31_498 | 155 |
| 195 | 3300044683 | Ga0466965_0084243 | Ga0466965_0084243_1075_1575 | 155 |
| 196 | 3300044693 | Ga0466961_0017953 | Ga0466961_0017953_3780_4265 | 155 |
| 197 | 3300044694 | Ga0466963_0106058 | Ga0466963_0106058_107_574 | 155 |
| 198 | 3300044694 | Ga0466963_0310328 | Ga0466963_0310328_604_1095 | 155 |
| 199 | 3300044842 | Ga0466957_0491699 | Ga0466957_0491699_328_795 | 155 |
| 200 | 3300044842 | Ga0466957_1264874 | Ga0466957_1264874_24_500 | 155 |
| 201 | 3300045976 | Ga0466967_1804504 | Ga0466967_1804504_60_551 | 155 |
| 202 | 3300046455 | Ga0495603_0601894 | Ga0495603_0601894_54_521 | 155 |
| 203 | 3300046660 | Ga0495625_0130350 | Ga0495625_0130350_843_1310 | 155 |
| 204 | 3300047315 | Ga0495581_0120941 | Ga0495581_0120941_1018_1485 | 155 |
| 205 | 3300048905 | Ga0496102_0589430 | Ga0496102_0589430_300_767 | 155 |
| 206 | 3300048911 | Ga0496108_0195047 | Ga0496108_0195047_440_919 | 155 |
| 207 | 3300048912 | Ga0496109_0450148 | Ga0496109_0450148_618_1085 | 155 |
| 208 | 3300049822 | Ga0501035_0570192 | Ga0501035_0570192_411_878 | 155 |
| 209 | 3300050507 | nmdc:mga05p37_16007_c1 | nmdc:mga05p37_16007_c1_6462_6929 | 155 |
| 210 | 3300050509 | nmdc:mga0qj67_100677_c1 | nmdc:mga0qj67_100677_c1_486_953 | 155 |
| 211 | 3300053083 | Ga0495655_0001936 | Ga0495655_0001936_723_1280 | 155 |
| 212 | 3300061734 | Ga0530510_0996480 | Ga0530510_0996480_69_560 | 155 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ixr-assembly1.cif.gz_A | crystal structure of xylella fastidiosa prxq c47s mutant | 0.9312 | 3 | 154 |
| 4eo3-assembly1.cif.gz_B | peroxiredoxin nitroreductase fusion enzyme | 0.9291 | 10 | 154 |
| 5enu-assembly2.cif.gz_B | crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria | 0.9227 | 4 | 153 |
| 3gkm-assembly1.cif.gz_A | insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures | 0.9197 | 6 | 154 |
| 3gkn-assembly1.cif.gz_A | insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures | 0.909 | 5 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIE1_7_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9946 | 5 | 155 | 3.40.30.10 |
| af_P9WIE1_7_157_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.988 | 5 | 155 | 3.40.30.10 |
| af_P0AE52_4_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9633 | 5 | 154 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9475 | 6 | 154 | 3.40.30.10 |
| af_Q2G280_3_151_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9414 | 6 | 154 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4P8STB5-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9995 | 1 | 154 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A317CZZ0-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.998 | 14 | 154 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A0L6CGQ7-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9978 | 4 | 154 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A4R9AYD8-F1-model_v4 | thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) | 0.9969 | 2 | 154 |
GO:0005737
GO:0008379 GO:0034599 GO:0045454 |
| AF-A0A6G3HNR1-F1-model_v4 | deleted | 0.9942 | 3 | 99 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar