F322488

General Info

Members Datasets Scaffolds Average Seq Length
212 147 424 247

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10010485|Ga0070709_100104852
Length 281
Sequence MHDASDIYGESYHHASGKAEEGRPSPRLIRSAKLGSMRARADQLLVDRGLAESRSRAQALILAGKVFSGERRIAKAGDALPSDAALEVRGQDHPWVSRGGQKLDHALRHFGLSPAGRICLDIGASTGGFTDVLLAHGAARVHAVDVGHGQLAWKLRSDPRVVAHEKTNARYLTRETIADPITALVCDASFIGLATLLPAPLALCAPSAWAIALIKPQFEAGPDAVGSKGVVRDPDVHQTVCDRISAWWSGLPDWHVLGITESPIRGPEGNREFLIAATKHS

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
36 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
64 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
67 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
68 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
69 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
70 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
71 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
78 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
79 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
87 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
137 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
138 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
139 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
140 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
141 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
142 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
143 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
144 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
145 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
146 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
147 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.81
Metatranscriptomes 0
Isolates 5.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 1.89
Rhizoplane 0
Rhizosphere 85.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10010485 3300005434 Bacteria 5134
2 Ga0065704_10007894 3300005289 Bacteria 3635
3 Ga0070680_100129009 3300005336 Bacteria 2114
4 Ga0070669_100074603 3300005353 Bacteria 2515
5 Ga0070674_100001318 3300005356 Bacteria 13044
6 Ga0070673_100172981 3300005364 Bacteria 1844
7 Ga0070709_10075172 3300005434 Bacteria 2191
8 Ga0070714_100218485 3300005435 Bacteria 1750
9 Ga0070713_100094363 3300005436 Bacteria 2579
10 Ga0070713_100205915 3300005436 Bacteria 1779
11 Ga0070713_100279171 3300005436 Bacteria 1532
12 Ga0070713_100738556 3300005436 Bacteria 941
13 Ga0070711_100150914 3300005439 Bacteria 1752
14 Ga0070678_100153598 3300005456 Bacteria 1857
15 Ga0070706_100124047 3300005467 Bacteria 2408
16 Ga0070698_100070259 3300005471 Bacteria 3514
17 Ga0070679_100127554 3300005530 Bacteria 2526
18 Ga0070679_100249140 3300005530 Bacteria 1733
19 Ga0068855_100367840 3300005563 Bacteria 1581
20 Ga0068852_100155028 3300005616 Bacteria 2133
21 Ga0068863_100172786 3300005841 Bacteria 2073
22 Ga0068858_100274599 3300005842 Bacteria 1604
23 Ga0081455_10137741 3300005937 Bacteria 1899
24 Ga0081538_10025130 3300005981 Bacteria 4214
25 Ga0081539_10000101 3300005985 Bacteria 198612
26 Ga0070717_10116534 3300006028 Bacteria 2284
27 Ga0070715_10123746 3300006163 Bacteria 1236
28 Ga0070712_100475808 3300006175 Bacteria 1043
29 Ga0075428_100160922 3300006844 Bacteria 2437
30 Ga0075430_100265939 3300006846 Bacteria 1420
31 Ga0075431_100343958 3300006847 Bacteria 1500
32 Ga0079104_1000112 3300006946 Bacteria 116581
33 Ga0079104_1001547 3300006946 Bacteria 15116
34 Ga0079104_1014078 3300006946 Bacteria 2430
35 Ga0105240_10176314 3300009093 Bacteria 2527
36 Ga0111539_10000375 3300009094 Bacteria 55326
37 Ga0105245_10139755 3300009098 Bacteria 2280
38 Ga0114129_10210554 3300009147 Bacteria 2628
39 Ga0105248_10941752 3300009177 Bacteria 975
40 Ga0105238_10003317 3300009551 Bacteria 16071
41 Ga0105239_10143346 3300010375 Bacteria 2663
42 Ga0157379_10345952 3300014968 Bacteria 1360
43 Ga0213872_10000936 3300021361 Bacteria 20522
44 Ga0213872_10001069 3300021361 Bacteria 18916
45 Ga0213872_10007857 3300021361 Bacteria 5211
46 Ga0213872_10008500 3300021361 Bacteria 4967
47 Ga0213872_10027754 3300021361 Bacteria 2597
48 Ga0213872_10112642 3300021361 Bacteria 1207
49 Ga0213872_10152831 3300021361 Bacteria 1007
50 Ga0213876_10059283 3300021384 Bacteria 2020
51 Ga0213875_10002098 3300021388 Bacteria 12228
52 Ga0213875_10032460 3300021388 Bacteria 2468
53 Ga0213875_10040435 3300021388 Bacteria 2195
54 Ga0213875_10051555 3300021388 Bacteria 1927
55 Ga0213875_10159409 3300021388 Bacteria 1058
56 Ga0209148_1000581 3300025254 Bacteria 33684
57 Ga0207692_10010137 3300025898 Bacteria 3960
58 Ga0207642_10018215 3300025899 Bacteria 2690
59 Ga0207685_10112183 3300025905 Bacteria 1183
60 Ga0207699_10059752 3300025906 Bacteria 2286
61 Ga0207684_10057705 3300025910 Bacteria 3294
62 Ga0207654_10510443 3300025911 Bacteria 850
63 Ga0207695_10138381 3300025913 Bacteria 2386
64 Ga0207693_10008979 3300025915 Bacteria 8156
65 Ga0207652_10775748 3300025921 Bacteria 852
66 Ga0207681_10191674 3300025923 Bacteria 1564
67 Ga0207687_10077005 3300025927 Bacteria 2397
68 Ga0207700_10211950 3300025928 Bacteria 1638
69 Ga0207669_10003261 3300025937 Bacteria 7019
70 Ga0207704_10221141 3300025938 Bacteria 1401
71 Ga0207711_10779555 3300025941 Bacteria 891
72 Ga0207679_10123503 3300025945 Bacteria 2065
73 Ga0207667_10104356 3300025949 Bacteria 2924
74 Ga0207651_10172565 3300025960 Bacteria 1707
75 Ga0207703_10279445 3300026035 Bacteria 1516
76 Ga0207702_10058059 3300026078 Bacteria 3292
77 Ga0207683_10166610 3300026121 Bacteria 1994
78 Ga0207428_10000057 3300027907 Bacteria 158615
79 Ga0268264_10526796 3300028381 Bacteria 1156
80 Ga0265337_1010849 3300028556 Bacteria 3169
81 Ga0265319_1053199 3300028563 Bacteria 1331
82 Ga0265338_10004795 3300028800 Bacteria 18074
83 Ga0265332_10111305 3300031238 Bacteria 1153
84 Ga0265328_10009422 3300031239 Bacteria 3977
85 Ga0265331_10000147 3300031250 Bacteria 90993
86 Ga0265316_10049648 3300031344 Bacteria 3304
87 Ga0307408_100108760 3300031548 Bacteria 2126
88 Ga0265313_10004037 3300031595 Bacteria 11444
89 Ga0265313_10060857 3300031595 Bacteria 1769
90 Ga0265314_10005645 3300031711 Bacteria 11236
91 Ga0265314_10230684 3300031711 Bacteria 1074
92 Ga0307406_10626254 3300031901 Bacteria 890
93 Ga0307409_100033803 3300031995 Bacteria 3726
94 Ga0373926_0028756 3300035083 Bacteria 1952
95 Ga0373923_0264119 3300035111 Bacteria 808
96 Ga0373936_0094484 3300035113 Bacteria 1256
97 Ga0373953_0004459 3300035117 Bacteria 4467
98 Ga0373954_0058972 3300035118 Bacteria 1809
99 Ga0373956_0082627 3300035119 Bacteria 1475
100 Ga0373946_0045927 3300035171 Bacteria 1809
101 Ga0373955_0032725 3300035172 Bacteria 2732
102 Ga0373955_0154635 3300035172 Bacteria 1351
103 Ga0373924_0041683 3300035410 Bacteria 1881
104 Ga0373935_0109406 3300035692 Bacteria 1832
105 Ga0373935_0381639 3300035692 Bacteria 1009
106 Ga0373927_0153075 3300035695 Bacteria 1510
107 Ga0373947_0025852 3300035725 Bacteria 3425
108 Ga0373937_0022918 3300036401 Bacteria 5615
109 Ga0373937_0041435 3300036401 Bacteria 4200
110 Ga0373937_0247776 3300036401 Bacteria 1679
111 Ga0373937_0319653 3300036401 Bacteria 1468
112 Ga0373937_0673223 3300036401 Bacteria 981
113 Ga0373925_0110470 3300037068 Bacteria 2123
114 Ga0373925_0155188 3300037068 Bacteria 1800
115 Ga0436364_0232073 3300037853 Bacteria 5755
116 Ga0436364_0388005 3300037853 Bacteria 6780
117 Ga0436364_0388602 3300037853 Bacteria 922
118 Ga0436364_0512657 3300037853 Bacteria 42864
119 Ga0436364_0804308 3300037853 Bacteria 2738
120 Ga0436364_0827508 3300037853 Bacteria 1624
121 Ga0436364_1121906 3300037853 Bacteria 2096
122 Ga0436364_1468280 3300037853 Bacteria 60501
123 Ga0436360_0302312 3300039438 Bacteria 2011
124 Ga0436361_0242926 3300039447 Bacteria 32751
125 Ga0436361_0286247 3300039447 Bacteria 49551
126 Ga0436361_0586998 3300039447 Bacteria 1798
127 Ga0436361_0828286 3300039447 Bacteria 2888
128 Ga0436361_0831534 3300039447 Bacteria 2134
129 Ga0436361_0887253 3300039447 Bacteria 913
130 Ga0436361_0888601 3300039447 Bacteria 2344
131 Ga0436361_0944196 3300039447 Bacteria 2251
132 Ga0436361_0960314 3300039447 Bacteria 3799
133 Ga0436361_1171883 3300039447 Bacteria 3284
134 Ga0436363_0428713 3300039450 Bacteria 2500
135 Ga0436363_1529152 3300039450 Bacteria 2044
136 Ga0436362_1156505 3300039453 Bacteria 2141
137 Ga0451577_0362193 3300042876 Bacteria 1315
138 Ga0466966_0122343 3300044684 Bacteria 1598
139 Ga0453684_0000062 3300044712 Bacteria 487590
140 Ga0453684_0000071 3300044712 Bacteria 448904
141 Ga0453684_0053496 3300044712 Bacteria 5269
142 Ga0453684_0062920 3300044712 Bacteria 4750
143 Ga0466971_0066894 3300044719 Bacteria 1629
144 Ga0451576_0000040 3300045051 Bacteria 349778
145 Ga0451576_0000493 3300045051 Bacteria 87000
146 Ga0451576_0001652 3300045051 Bacteria 37060
147 Ga0451576_0069938 3300045051 Bacteria 3653
148 Ga0451576_0406259 3300045051 Bacteria 1428
149 Ga0451576_0434066 3300045051 Bacteria 1378
150 Ga0451576_0661600 3300045051 Bacteria 1098
151 Ga0466958_0011407 3300045836 Bacteria 5005
152 Ga0466958_0137382 3300045836 Bacteria 1538
153 Ga0495629_0073596 3300046459 Bacteria 2386
154 Ga0495651_0075550 3300046462 Bacteria 2554
155 Ga0495662_0198105 3300046476 Bacteria 990
156 Ga0495664_0001365 3300046477 Bacteria 12892
157 Ga0495608_0153160 3300046511 Bacteria 1468
158 Ga0495620_0068433 3300046515 Bacteria 1458
159 Ga0495652_0155141 3300046529 Bacteria 1784
160 Ga0495652_0304519 3300046529 Bacteria 1157
161 Ga0495640_0102821 3300046533 Bacteria 1874
162 Ga0495587_0012418 3300046536 Bacteria 5360
163 Ga0495667_0021280 3300046559 Bacteria 4376
164 Ga0495635_0079487 3300046663 Bacteria 2244
165 Ga0495635_0250711 3300046663 Bacteria 1193
166 Ga0495657_0075256 3300046675 Bacteria 2195
167 Ga0495657_0288432 3300046675 Bacteria 981
168 Ga0495599_0015902 3300046678 Bacteria 4670
169 Ga0495599_0141180 3300046678 Bacteria 1494
170 Ga0495600_0063927 3300046809 Bacteria 2405
171 Ga0495674_0028547 3300047319 Bacteria 5085
172 Ga0495674_0087906 3300047319 Bacteria 2659
173 Ga0495674_0549795 3300047319 Bacteria 919
174 Ga0495672_0010173 3300047320 Bacteria 6724
175 Ga0495680_0050782 3300047322 Bacteria 3241
176 Ga0495684_0113711 3300047471 Bacteria 2041
177 Ga0495684_0127665 3300047471 Bacteria 1912
178 Ga0495602_0121678 3300048088 Bacteria 2099
179 Ga0495602_0175011 3300048088 Bacteria 1661
180 Ga0496126_0000431 3300048929 Bacteria 84583
181 Ga0496126_0541864 3300048929 Bacteria 925
182 Ga0501033_0256258 3300049570 Bacteria 1239
183 Ga0501034_0163690 3300049571 Bacteria 2194
184 Ga0501036_0115388 3300049572 Bacteria 2269
185 Ga0501036_0383846 3300049572 Bacteria 1172
186 Ga0501070_0105252 3300049586 Bacteria 2332
187 Ga0501071_0062638 3300049587 Bacteria 2695
188 Ga0501075_0004765 3300049591 Bacteria 9223
189 Ga0501077_0022106 3300049593 Bacteria 4028
190 Ga0501079_0037645 3300049741 Bacteria 3729
191 Ga0501080_0304335 3300049742 Bacteria 1445
192 Ga0501045_0111782 3300049824 Bacteria 2026
193 nmdc:mga06r32_239922_c1 3300050510 Bacteria 1800
194 nmdc:mga08y16_60_c1 3300050511 Bacteria 93360
195 Ga0495601_0014228 3300053077 Bacteria 4794
196 Ga0495601_0250333 3300053077 Bacteria 1157
197 Ga0495601_0341098 3300053077 Bacteria 975
198 Ga0495612_0000471 3300053078 Bacteria 16213
199 Ga0495619_0021347 3300053085 Bacteria 4132
200 Ga0501084_0049423 3300054114 Bacteria 3521
201 Ga0530510_0010333 3300061734 Bacteria 6543
202 2512035083 2511231221 Bacteria 6846400
203 2524611827 2524023250 Bacteria 5457705
204 2599106011 2597490356 Bacteria 7030811
205 2842335063 2842333319 Bacteria 8899485
206 2846955802 2846952575 Bacteria 6587527
207 2848862094 2848858292 Bacteria 7391279
208 2883577302 2883577096 Bacteria 4709178
209 2897805894 2897803580 Bacteria 7000062
210 641335805 641228493 Bacteria 3999591
211 643389617 643348555 Bacteria 3914947
212 8054009296 8054002106 Bacteria 7987183
213 Ga0070709_10010485
214 Ga0065704_10007894
215 Ga0070680_100129009
216 Ga0070669_100074603
217 Ga0070674_100001318
218 Ga0070673_100172981
219 Ga0070709_10075172
220 Ga0070714_100218485
221 Ga0070713_100094363
222 Ga0070713_100205915
223 Ga0070713_100279171
224 Ga0070713_100738556
225 Ga0070711_100150914
226 Ga0070678_100153598
227 Ga0070706_100124047
228 Ga0070698_100070259
229 Ga0070679_100127554
230 Ga0070679_100249140
231 Ga0068855_100367840
232 Ga0068852_100155028
233 Ga0068863_100172786
234 Ga0068858_100274599
235 Ga0081455_10137741
236 Ga0081538_10025130
237 Ga0081539_10000101
238 Ga0070717_10116534
239 Ga0070715_10123746
240 Ga0070712_100475808
241 Ga0075428_100160922
242 Ga0075430_100265939
243 Ga0075431_100343958
244 Ga0079104_1000112
245 Ga0079104_1001547
246 Ga0079104_1014078
247 Ga0105240_10176314
248 Ga0111539_10000375
249 Ga0105245_10139755
250 Ga0114129_10210554
251 Ga0105248_10941752
252 Ga0105238_10003317
253 Ga0105239_10143346
254 Ga0157379_10345952
255 Ga0213872_10000936
256 Ga0213872_10001069
257 Ga0213872_10007857
258 Ga0213872_10008500
259 Ga0213872_10027754
260 Ga0213872_10112642
261 Ga0213872_10152831
262 Ga0213876_10059283
263 Ga0213875_10002098
264 Ga0213875_10032460
265 Ga0213875_10040435
266 Ga0213875_10051555
267 Ga0213875_10159409
268 Ga0209148_1000581
269 Ga0207692_10010137
270 Ga0207642_10018215
271 Ga0207685_10112183
272 Ga0207699_10059752
273 Ga0207684_10057705
274 Ga0207654_10510443
275 Ga0207695_10138381
276 Ga0207693_10008979
277 Ga0207652_10775748
278 Ga0207681_10191674
279 Ga0207687_10077005
280 Ga0207700_10211950
281 Ga0207669_10003261
282 Ga0207704_10221141
283 Ga0207711_10779555
284 Ga0207679_10123503
285 Ga0207667_10104356
286 Ga0207651_10172565
287 Ga0207703_10279445
288 Ga0207702_10058059
289 Ga0207683_10166610
290 Ga0207428_10000057
291 Ga0268264_10526796
292 Ga0265337_1010849
293 Ga0265319_1053199
294 Ga0265338_10004795
295 Ga0265332_10111305
296 Ga0265328_10009422
297 Ga0265331_10000147
298 Ga0265316_10049648
299 Ga0307408_100108760
300 Ga0265313_10004037
301 Ga0265313_10060857
302 Ga0265314_10005645
303 Ga0265314_10230684
304 Ga0307406_10626254
305 Ga0307409_100033803
306 Ga0373926_0028756
307 Ga0373923_0264119
308 Ga0373936_0094484
309 Ga0373953_0004459
310 Ga0373954_0058972
311 Ga0373956_0082627
312 Ga0373946_0045927
313 Ga0373955_0032725
314 Ga0373955_0154635
315 Ga0373924_0041683
316 Ga0373935_0109406
317 Ga0373935_0381639
318 Ga0373927_0153075
319 Ga0373947_0025852
320 Ga0373937_0022918
321 Ga0373937_0041435
322 Ga0373937_0247776
323 Ga0373937_0319653
324 Ga0373937_0673223
325 Ga0373925_0110470
326 Ga0373925_0155188
327 Ga0436364_0232073
328 Ga0436364_0388005
329 Ga0436364_0388602
330 Ga0436364_0512657
331 Ga0436364_0804308
332 Ga0436364_0827508
333 Ga0436364_1121906
334 Ga0436364_1468280
335 Ga0436360_0302312
336 Ga0436361_0242926
337 Ga0436361_0286247
338 Ga0436361_0586998
339 Ga0436361_0828286
340 Ga0436361_0831534
341 Ga0436361_0887253
342 Ga0436361_0888601
343 Ga0436361_0944196
344 Ga0436361_0960314
345 Ga0436361_1171883
346 Ga0436363_0428713
347 Ga0436363_1529152
348 Ga0436362_1156505
349 Ga0451577_0362193
350 Ga0466966_0122343
351 Ga0453684_0000062
352 Ga0453684_0000071
353 Ga0453684_0053496
354 Ga0453684_0062920
355 Ga0466971_0066894
356 Ga0451576_0000040
357 Ga0451576_0000493
358 Ga0451576_0001652
359 Ga0451576_0069938
360 Ga0451576_0406259
361 Ga0451576_0434066
362 Ga0451576_0661600
363 Ga0466958_0011407
364 Ga0466958_0137382
365 Ga0495629_0073596
366 Ga0495651_0075550
367 Ga0495662_0198105
368 Ga0495664_0001365
369 Ga0495608_0153160
370 Ga0495620_0068433
371 Ga0495652_0155141
372 Ga0495652_0304519
373 Ga0495640_0102821
374 Ga0495587_0012418
375 Ga0495667_0021280
376 Ga0495635_0079487
377 Ga0495635_0250711
378 Ga0495657_0075256
379 Ga0495657_0288432
380 Ga0495599_0015902
381 Ga0495599_0141180
382 Ga0495600_0063927
383 Ga0495674_0028547
384 Ga0495674_0087906
385 Ga0495674_0549795
386 Ga0495672_0010173
387 Ga0495680_0050782
388 Ga0495684_0113711
389 Ga0495684_0127665
390 Ga0495602_0121678
391 Ga0495602_0175011
392 Ga0496126_0000431
393 Ga0496126_0541864
394 Ga0501033_0256258
395 Ga0501034_0163690
396 Ga0501036_0115388
397 Ga0501036_0383846
398 Ga0501070_0105252
399 Ga0501071_0062638
400 Ga0501075_0004765
401 Ga0501077_0022106
402 Ga0501079_0037645
403 Ga0501080_0304335
404 Ga0501045_0111782
405 nmdc:mga06r32_239922_c1
406 nmdc:mga08y16_60_c1
407 Ga0495601_0014228
408 Ga0495601_0250333
409 Ga0495601_0341098
410 Ga0495612_0000471
411 Ga0495619_0021347
412 Ga0501084_0049423
413 Ga0530510_0010333
414 2512035083
415 2524611827
416 2599106011
417 2842335063
418 2846955802
419 2848862094
420 2883577302
421 2897805894
422 641335805
423 643389617
424 8054009296

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01728

FtsJ

FtsJ-like methyltransferase

95

279

0.95

PF01479

S4

S4 domain

39

84

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3opn-assembly1.cif.gz_A the crystal structure of a putative hemolysin from lactococcus lactis 0.9653 60 245
5eov-assembly1.cif.gz_A c-terminal domain of the 16s/23s rrna (cytidine-2'-o)-methyltransferase tlya. 0.9373 62 249
5xyi-assembly1.cif.gz_J small subunit of trichomonas vaginalis ribosome 0.9279 5 53
7r81-assembly1.cif.gz_K2 structure of the translating neurospora crassa ribosome arrested by cycloheximide 0.9269 5 53
8d8k-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 2) 0.9117 5 54
ID Description Score Start End Superfamily
3opnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9645 60 245 3.40.50.150
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9403 67 249 3.40.50.150
5eovA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9373 62 249 3.40.50.150
af_C0P590_106_292_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9012 67 249 3.40.50.150
2istA01 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.8954 3 53 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A5A7N5S3-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.9991 67 245 GO:0008168
GO:0032259
AF-A0A2E8QZR8-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9934 121 245 GO:0008168
GO:0032259
AF-A0A849HJT4-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9924 177 245 GO:0008168
GO:0032259
AF-A0A357V0D7-F1-model_v4 TlyA family rRNA (Cytidine-2'-O)-methyltransferase 0.9861 54 244 GO:0008168
GO:0032259
AF-A0A258AED2-F1-model_v4 Ribosomal RNA methyltransferase FtsJ domain-containing protein 0.986 82 245 GO:0008168
GO:0032259

Map