F322455
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 212 | 135 | 212 | 129 |
Family's Representative Sequence
| Representative Sequence | 3300005343|Ga0070687_100144813|Ga0070687_1001448131 |
| Length | 130 |
| Sequence | MEDKVEKDPQSRANVLEERLIDFAVRIVRLSANLPRTAAGRHIAGQILRSGTSPAPNYGEARGAESQADFEHKLAIVVLEELNETSIWLRIIGRSEMLTDELIARLVQENNELCKILTASLKTARGRTVK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090003 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 112 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 114 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 117 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 118 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 120 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 121 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 122 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 126 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 129 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 133 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 134 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 135 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.42 |
| Rhizosphere | 98.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJN_F7QKVOU01DIPN7 | 2088090003 | Unclassified | 506 |
| 2 | Ga0065715_10019066 | 3300005293 | Unclassified | 2584 |
| 3 | Ga0070690_100026210 | 3300005330 | Bacteria | 3594 |
| 4 | Ga0070690_100029858 | 3300005330 | Bacteria | 3385 |
| 5 | Ga0070690_100170468 | 3300005330 | Unclassified | 1497 |
| 6 | Ga0070670_100000136 | 3300005331 | Bacteria | 68887 |
| 7 | Ga0070670_100374346 | 3300005331 | Bacteria | 1254 |
| 8 | Ga0070677_10199251 | 3300005333 | Bacteria | 965 |
| 9 | Ga0068869_100015659 | 3300005334 | Bacteria | 5093 |
| 10 | Ga0068869_100043791 | 3300005334 | Bacteria | 3217 |
| 11 | Ga0068869_100066345 | 3300005334 | Bacteria | 2658 |
| 12 | Ga0070666_10224466 | 3300005335 | Bacteria | 1325 |
| 13 | Ga0070680_101334484 | 3300005336 | Bacteria | 621 |
| 14 | Ga0070689_100080303 | 3300005340 | Bacteria | 2559 |
| 15 | Ga0070691_10156134 | 3300005341 | Unclassified | 1173 |
| 16 | Ga0070687_100144813 | 3300005343 | Bacteria | 1388 |
| 17 | Ga0070687_100277563 | 3300005343 | Bacteria | 1053 |
| 18 | Ga0070669_100001076 | 3300005353 | Bacteria | 20001 |
| 19 | Ga0070669_100070096 | 3300005353 | Unclassified | 2591 |
| 20 | Ga0070669_100332511 | 3300005353 | Bacteria | 1229 |
| 21 | Ga0070669_100660196 | 3300005353 | Unclassified | 880 |
| 22 | Ga0070675_100025794 | 3300005354 | Bacteria | 4712 |
| 23 | Ga0070671_100742799 | 3300005355 | Bacteria | 853 |
| 24 | Ga0070673_100332492 | 3300005364 | Bacteria | 1345 |
| 25 | Ga0070688_100456202 | 3300005365 | Bacteria | 956 |
| 26 | Ga0070667_101514414 | 3300005367 | Unclassified | 630 |
| 27 | Ga0070705_100165016 | 3300005440 | Bacteria | 1485 |
| 28 | Ga0070705_100676001 | 3300005440 | Bacteria | 808 |
| 29 | Ga0070705_100838695 | 3300005440 | Bacteria | 734 |
| 30 | Ga0070700_100193697 | 3300005441 | Bacteria | 1423 |
| 31 | Ga0070700_100520735 | 3300005441 | Bacteria | 918 |
| 32 | Ga0070700_100923517 | 3300005441 | Unclassified | 712 |
| 33 | Ga0070694_100002173 | 3300005444 | Bacteria | 11626 |
| 34 | Ga0070694_100023159 | 3300005444 | Unclassified | 3990 |
| 35 | Ga0070694_100078413 | 3300005444 | Unclassified | 2291 |
| 36 | Ga0070694_100144945 | 3300005444 | Unclassified | 1729 |
| 37 | Ga0070694_100186731 | 3300005444 | Bacteria | 1537 |
| 38 | Ga0070694_100194997 | 3300005444 | Bacteria | 1506 |
| 39 | Ga0070694_100340578 | 3300005444 | Bacteria | 1159 |
| 40 | Ga0070694_100434139 | 3300005444 | Bacteria | 1034 |
| 41 | Ga0070694_101542033 | 3300005444 | Bacteria | 563 |
| 42 | Ga0070708_100151957 | 3300005445 | Bacteria | 2153 |
| 43 | Ga0070708_100170744 | 3300005445 | Bacteria | 2030 |
| 44 | Ga0070662_100164360 | 3300005457 | Unclassified | 1738 |
| 45 | Ga0068867_100017596 | 3300005459 | Bacteria | 5075 |
| 46 | Ga0070685_10074162 | 3300005466 | Bacteria | 2024 |
| 47 | Ga0070706_100253554 | 3300005467 | Unclassified | 1643 |
| 48 | Ga0070706_100336712 | 3300005467 | Bacteria | 1407 |
| 49 | Ga0070707_100461016 | 3300005468 | Bacteria | 1232 |
| 50 | Ga0070698_100167457 | 3300005471 | Bacteria | 2139 |
| 51 | Ga0070698_100303121 | 3300005471 | Bacteria | 1528 |
| 52 | Ga0070698_101349234 | 3300005471 | Unclassified | 663 |
| 53 | Ga0070699_100031915 | 3300005518 | Bacteria | 4548 |
| 54 | Ga0070699_100257652 | 3300005518 | Bacteria | 1560 |
| 55 | Ga0070684_102076275 | 3300005535 | Unclassified | 536 |
| 56 | Ga0070697_100030480 | 3300005536 | Bacteria | 4333 |
| 57 | Ga0070697_100474565 | 3300005536 | Bacteria | 1092 |
| 58 | Ga0070697_100726780 | 3300005536 | Unclassified | 877 |
| 59 | Ga0070697_100980348 | 3300005536 | Unclassified | 751 |
| 60 | Ga0070686_100643681 | 3300005544 | Bacteria | 840 |
| 61 | Ga0070695_100074601 | 3300005545 | Unclassified | 2229 |
| 62 | Ga0070695_100309452 | 3300005545 | Bacteria | 1170 |
| 63 | Ga0070695_101509904 | 3300005545 | Unclassified | 559 |
| 64 | Ga0070696_100033132 | 3300005546 | Bacteria | 3548 |
| 65 | Ga0070696_100341995 | 3300005546 | Bacteria | 1156 |
| 66 | Ga0070696_100378627 | 3300005546 | Bacteria | 1102 |
| 67 | Ga0070696_100395639 | 3300005546 | Bacteria | 1080 |
| 68 | Ga0070696_100488596 | 3300005546 | Bacteria | 977 |
| 69 | Ga0070693_100311344 | 3300005547 | Bacteria | 1065 |
| 70 | Ga0070704_100182115 | 3300005549 | Unclassified | 1681 |
| 71 | Ga0070704_100233452 | 3300005549 | Bacteria | 1502 |
| 72 | Ga0070704_100238477 | 3300005549 | Unclassified | 1487 |
| 73 | Ga0070664_100510200 | 3300005564 | Unclassified | 1109 |
| 74 | Ga0070664_100546160 | 3300005564 | Bacteria | 1071 |
| 75 | Ga0068857_100467265 | 3300005577 | Bacteria | 1181 |
| 76 | Ga0068857_101668799 | 3300005577 | Bacteria | 623 |
| 77 | Ga0068854_100607694 | 3300005578 | Unclassified | 934 |
| 78 | Ga0068856_100353307 | 3300005614 | Unclassified | 1488 |
| 79 | Ga0070702_100340055 | 3300005615 | Bacteria | 1053 |
| 80 | Ga0068852_101109907 | 3300005616 | Unclassified | 811 |
| 81 | Ga0068859_100467143 | 3300005617 | Bacteria | 1357 |
| 82 | Ga0068864_100679837 | 3300005618 | Bacteria | 1004 |
| 83 | Ga0068864_100725438 | 3300005618 | Bacteria | 972 |
| 84 | Ga0068861_100071240 | 3300005719 | Bacteria | 2694 |
| 85 | Ga0068861_100072499 | 3300005719 | Bacteria | 2672 |
| 86 | Ga0068863_100742285 | 3300005841 | Unclassified | 977 |
| 87 | Ga0068858_101358659 | 3300005842 | Bacteria | 700 |
| 88 | Ga0068860_101305494 | 3300005843 | Unclassified | 746 |
| 89 | Ga0068862_100138830 | 3300005844 | Unclassified | 2156 |
| 90 | Ga0081540_1047718 | 3300005983 | Bacteria | 2151 |
| 91 | Ga0097621_100080456 | 3300006237 | Bacteria | 2710 |
| 92 | Ga0068871_100527107 | 3300006358 | Bacteria | 1067 |
| 93 | Ga0075428_100773624 | 3300006844 | Unclassified | 1021 |
| 94 | Ga0075431_101991987 | 3300006847 | Bacteria | 536 |
| 95 | Ga0075431_102015421 | 3300006847 | Bacteria | 532 |
| 96 | Ga0075433_10474048 | 3300006852 | Bacteria | 1103 |
| 97 | Ga0075433_11503425 | 3300006852 | Unclassified | 582 |
| 98 | Ga0075434_100174303 | 3300006871 | Unclassified | 2171 |
| 99 | Ga0075429_100152021 | 3300006880 | Bacteria | 2027 |
| 100 | Ga0068865_101792375 | 3300006881 | Unclassified | 554 |
| 101 | Ga0075436_101081367 | 3300006914 | Unclassified | 603 |
| 102 | Ga0097620_100467157 | 3300006931 | Bacteria | 1357 |
| 103 | Ga0075435_100553987 | 3300007076 | Bacteria | 996 |
| 104 | Ga0075435_101065577 | 3300007076 | Unclassified | 706 |
| 105 | Ga0111539_10142720 | 3300009094 | Bacteria | 2803 |
| 106 | Ga0111539_11228022 | 3300009094 | Unclassified | 870 |
| 107 | Ga0105245_11469334 | 3300009098 | Bacteria | 732 |
| 108 | Ga0114129_10094312 | 3300009147 | Bacteria | 4145 |
| 109 | Ga0114129_10121107 | 3300009147 | Bacteria | 3601 |
| 110 | Ga0105243_10049910 | 3300009148 | Bacteria | 3303 |
| 111 | Ga0105243_10054582 | 3300009148 | Bacteria | 3173 |
| 112 | Ga0105243_10122267 | 3300009148 | Bacteria | 2196 |
| 113 | Ga0105243_10452559 | 3300009148 | Bacteria | 1205 |
| 114 | Ga0105243_11914704 | 3300009148 | Unclassified | 626 |
| 115 | Ga0105241_10304568 | 3300009174 | Bacteria | 1369 |
| 116 | Ga0105241_10332210 | 3300009174 | Bacteria | 1314 |
| 117 | Ga0105241_10766352 | 3300009174 | Bacteria | 886 |
| 118 | Ga0105242_11891780 | 3300009176 | Unclassified | 637 |
| 119 | Ga0105248_10026013 | 3300009177 | Bacteria | 6509 |
| 120 | Ga0105237_10037543 | 3300009545 | Bacteria | 4896 |
| 121 | Ga0105238_10613946 | 3300009551 | Bacteria | 1096 |
| 122 | Ga0105249_10012414 | 3300009553 | Bacteria | 7510 |
| 123 | Ga0105249_13125991 | 3300009553 | Bacteria | 532 |
| 124 | Ga0105239_11046686 | 3300010375 | Bacteria | 939 |
| 125 | Ga0105246_10212994 | 3300011119 | Bacteria | 1509 |
| 126 | Ga0105246_11062430 | 3300011119 | Bacteria | 737 |
| 127 | Ga0105246_12596879 | 3300011119 | Bacteria | 500 |
| 128 | Ga0157373_10017669 | 3300013100 | Bacteria | 5192 |
| 129 | Ga0157378_10312235 | 3300013297 | Unclassified | 1525 |
| 130 | Ga0157378_10644519 | 3300013297 | Unclassified | 1074 |
| 131 | Ga0163162_10602028 | 3300013306 | Bacteria | 1225 |
| 132 | Ga0157372_10022004 | 3300013307 | Bacteria | 6893 |
| 133 | Ga0163163_10068898 | 3300014325 | Unclassified | 3522 |
| 134 | Ga0163163_11030103 | 3300014325 | Bacteria | 886 |
| 135 | Ga0157380_10223965 | 3300014326 | Unclassified | 1684 |
| 136 | Ga0157380_11341179 | 3300014326 | Bacteria | 764 |
| 137 | Ga0157377_10001943 | 3300014745 | Bacteria | 9041 |
| 138 | Ga0163161_10012275 | 3300017792 | Bacteria | 5945 |
| 139 | Ga0207643_10084994 | 3300025908 | Bacteria | 1837 |
| 140 | Ga0207684_10217873 | 3300025910 | Unclassified | 1647 |
| 141 | Ga0207684_10483478 | 3300025910 | Bacteria | 1062 |
| 142 | Ga0207654_10249103 | 3300025911 | Bacteria | 1190 |
| 143 | Ga0207654_10336617 | 3300025911 | Unclassified | 1036 |
| 144 | Ga0207695_10052868 | 3300025913 | Bacteria | 4252 |
| 145 | Ga0207660_10731141 | 3300025917 | Unclassified | 807 |
| 146 | Ga0207662_10700353 | 3300025918 | Bacteria | 710 |
| 147 | Ga0207646_10188805 | 3300025922 | Bacteria | 1861 |
| 148 | Ga0207646_11387755 | 3300025922 | Bacteria | 611 |
| 149 | Ga0207681_10001089 | 3300025923 | Bacteria | 17622 |
| 150 | Ga0207681_10066060 | 3300025923 | Unclassified | 2503 |
| 151 | Ga0207681_10143076 | 3300025923 | Bacteria | 1783 |
| 152 | Ga0207681_10722793 | 3300025923 | Bacteria | 829 |
| 153 | Ga0207681_11085037 | 3300025923 | Unclassified | 672 |
| 154 | Ga0207659_10264668 | 3300025926 | Bacteria | 1400 |
| 155 | Ga0207706_10480244 | 3300025933 | Unclassified | 1074 |
| 156 | Ga0207686_10666672 | 3300025934 | Bacteria | 824 |
| 157 | Ga0207686_10965973 | 3300025934 | Bacteria | 690 |
| 158 | Ga0207709_10190020 | 3300025935 | Bacteria | 1458 |
| 159 | Ga0207709_10385941 | 3300025935 | Unclassified | 1067 |
| 160 | Ga0207670_10005882 | 3300025936 | Bacteria | 6768 |
| 161 | Ga0207704_10149653 | 3300025938 | Bacteria | 1645 |
| 162 | Ga0207704_11052974 | 3300025938 | Bacteria | 690 |
| 163 | Ga0207691_10054515 | 3300025940 | Bacteria | 3647 |
| 164 | Ga0207689_10035904 | 3300025942 | Bacteria | 4115 |
| 165 | Ga0207689_10064299 | 3300025942 | Bacteria | 3019 |
| 166 | Ga0207689_10161750 | 3300025942 | Bacteria | 1845 |
| 167 | Ga0207679_10375155 | 3300025945 | Unclassified | 1246 |
| 168 | Ga0207679_10562293 | 3300025945 | Bacteria | 1024 |
| 169 | Ga0207651_10163009 | 3300025960 | Bacteria | 1750 |
| 170 | Ga0207651_11508534 | 3300025960 | Bacteria | 605 |
| 171 | Ga0207712_11373679 | 3300025961 | Bacteria | 632 |
| 172 | Ga0207640_10209608 | 3300025981 | Unclassified | 1483 |
| 173 | Ga0207658_10145552 | 3300025986 | Bacteria | 1924 |
| 174 | Ga0207677_10660866 | 3300026023 | Bacteria | 923 |
| 175 | Ga0207708_10602105 | 3300026075 | Unclassified | 931 |
| 176 | Ga0207702_10029830 | 3300026078 | Bacteria | 4541 |
| 177 | Ga0207641_10110686 | 3300026088 | Bacteria | 2434 |
| 178 | Ga0207648_10015231 | 3300026089 | Bacteria | 7074 |
| 179 | Ga0207676_10877893 | 3300026095 | Bacteria | 878 |
| 180 | Ga0207674_10262292 | 3300026116 | Unclassified | 1675 |
| 181 | Ga0207675_100058931 | 3300026118 | Bacteria | 3583 |
| 182 | Ga0207675_101488706 | 3300026118 | Bacteria | 698 |
| 183 | Ga0207683_10061144 | 3300026121 | Bacteria | 3314 |
| 184 | Ga0207428_10354468 | 3300027907 | Bacteria | 1079 |
| 185 | Ga0268265_10981964 | 3300028380 | Unclassified | 833 |
| 186 | Ga0265319_1026635 | 3300028563 | Bacteria | 2057 |
| 187 | Ga0265318_10019040 | 3300028577 | Bacteria | 2790 |
| 188 | Ga0265331_10031938 | 3300031250 | Bacteria | 2613 |
| 189 | Ga0265316_10026234 | 3300031344 | Bacteria | 4852 |
| 190 | Ga0265314_10358581 | 3300031711 | Bacteria | 800 |
| 191 | Ga0265342_10066896 | 3300031712 | Bacteria | 2104 |
| 192 | Ga0242420_002218 | 3300038996 | Bacteria | 2745 |
| 193 | Ga0439434_0007515 | 3300042435 | Bacteria | 3194 |
| 194 | Ga0451576_1719702 | 3300045051 | Bacteria | 649 |
| 195 | Ga0495663_0000613 | 3300046525 | Bacteria | 12401 |
| 196 | Ga0495621_0020245 | 3300046539 | Bacteria | 2181 |
| 197 | Ga0495621_0035251 | 3300046539 | Bacteria | 1732 |
| 198 | Ga0495672_0042414 | 3300047320 | Bacteria | 2744 |
| 199 | Ga0496102_0195365 | 3300048905 | Bacteria | 1907 |
| 200 | Ga0496104_0244681 | 3300048907 | Unclassified | 1706 |
| 201 | Ga0496106_0169834 | 3300048909 | Bacteria | 1728 |
| 202 | Ga0501225_0032021 | 3300049705 | Bacteria | 1446 |
| 203 | nmdc:mga05p37_159947_c1 | 3300050507 | Unclassified | 2751 |
| 204 | nmdc:mga05p37_397567_c1 | 3300050507 | Bacteria | 1610 |
| 205 | nmdc:mga09592_709833_c2 | 3300050508 | Bacteria | 528 |
| 206 | nmdc:mga08y16_1410111_c1 | 3300050511 | Bacteria | 660 |
| 207 | nmdc:mga08y16_611352_c1 | 3300050511 | Bacteria | 1098 |
| 208 | nmdc:mga0n895_361962_c1 | 3300050512 | Bacteria | 1469 |
| 209 | nmdc:mga0rr50_1019179_c1 | 3300050513 | Unclassified | 705 |
| 210 | nmdc:mga0rr50_509713_c1 | 3300050513 | Bacteria | 1023 |
| 211 | nmdc:mga08x19_285496_c1 | 3300050514 | Bacteria | 1144 |
| 212 | nmdc:mga0a205_310520_c1 | 3300050515 | Unclassified | 1449 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005564 | Ga0070664_100510200 | Ga0070664_1005102002 | 120 |
| 2 | 3300005616 | Ga0068852_101109907 | Ga0068852_1011099071 | 120 |
| 3 | 3300005841 | Ga0068863_100742285 | Ga0068863_1007422852 | 120 |
| 4 | 3300025945 | Ga0207679_10562293 | Ga0207679_105622932 | 120 |
| 5 | 3300026078 | Ga0207702_10029830 | Ga0207702_100298303 | 120 |
| 6 | 3300048905 | Ga0496102_0195365 | Ga0496102_0195365_199_564 | 120 |
| 7 | 3300048907 | Ga0496104_0244681 | Ga0496104_0244681_189_554 | 120 |
| 8 | 3300005334 | Ga0068869_100015659 | Ga0068869_1000156594 | 121 |
| 9 | 3300025922 | Ga0207646_11387755 | Ga0207646_113877551 | 121 |
| 10 | 3300025942 | Ga0207689_10035904 | Ga0207689_100359043 | 121 |
| 11 | 3300050507 | nmdc:mga05p37_159947_c1 | nmdc:mga05p37_159947_c1_2264_2701 | 121 |
| 12 | 3300005983 | Ga0081540_1047718 | Ga0081540_10477182 | 122 |
| 13 | 3300005330 | Ga0070690_100026210 | Ga0070690_1000262103 | 123 |
| 14 | 3300005364 | Ga0070673_100332492 | Ga0070673_1003324921 | 123 |
| 15 | 3300005367 | Ga0070667_101514414 | Ga0070667_1015144141 | 123 |
| 16 | 3300005466 | Ga0070685_10074162 | Ga0070685_100741622 | 123 |
| 17 | 3300005536 | Ga0070697_100980348 | Ga0070697_1009803481 | 123 |
| 18 | 3300005618 | Ga0068864_100725438 | Ga0068864_1007254382 | 123 |
| 19 | 3300005842 | Ga0068858_101358659 | Ga0068858_1013586592 | 123 |
| 20 | 3300006237 | Ga0097621_100080456 | Ga0097621_1000804561 | 123 |
| 21 | 3300006358 | Ga0068871_100527107 | Ga0068871_1005271072 | 123 |
| 22 | 3300009174 | Ga0105241_10766352 | Ga0105241_107663521 | 123 |
| 23 | 3300013306 | Ga0163162_10602028 | Ga0163162_106020282 | 123 |
| 24 | 3300025940 | Ga0207691_10054515 | Ga0207691_100545154 | 123 |
| 25 | 3300025960 | Ga0207651_11508534 | Ga0207651_115085341 | 123 |
| 26 | 3300025986 | Ga0207658_10145552 | Ga0207658_101455522 | 123 |
| 27 | 3300026023 | Ga0207677_10660866 | Ga0207677_106608662 | 123 |
| 28 | 3300026118 | Ga0207675_100058931 | Ga0207675_1000589314 | 123 |
| 29 | 3300005444 | Ga0070694_100186731 | Ga0070694_1001867312 | 124 |
| 30 | 3300005536 | Ga0070697_100726780 | Ga0070697_1007267801 | 125 |
| 31 | 3300026118 | Ga0207675_101488706 | Ga0207675_1014887061 | 125 |
| 32 | 3300005331 | Ga0070670_100374346 | Ga0070670_1003743462 | 126 |
| 33 | 3300005355 | Ga0070671_100742799 | Ga0070671_1007427992 | 126 |
| 34 | 3300005444 | Ga0070694_100078413 | Ga0070694_1000784132 | 126 |
| 35 | 3300005444 | Ga0070694_100340578 | Ga0070694_1003405782 | 126 |
| 36 | 3300005471 | Ga0070698_100303121 | Ga0070698_1003031211 | 126 |
| 37 | 3300005518 | Ga0070699_100257652 | Ga0070699_1002576522 | 126 |
| 38 | 3300005546 | Ga0070696_100395639 | Ga0070696_1003956391 | 126 |
| 39 | 3300009174 | Ga0105241_10332210 | Ga0105241_103322101 | 126 |
| 40 | 3300009553 | Ga0105249_13125991 | Ga0105249_131259911 | 126 |
| 41 | 3300011119 | Ga0105246_10212994 | Ga0105246_102129942 | 126 |
| 42 | 3300013100 | Ga0157373_10017669 | Ga0157373_100176696 | 126 |
| 43 | 3300017792 | Ga0163161_10012275 | Ga0163161_100122755 | 126 |
| 44 | 3300025908 | Ga0207643_10084994 | Ga0207643_100849942 | 126 |
| 45 | 3300025911 | Ga0207654_10249103 | Ga0207654_102491032 | 126 |
| 46 | 3300025942 | Ga0207689_10161750 | Ga0207689_101617502 | 126 |
| 47 | 3300005330 | Ga0070690_100170468 | Ga0070690_1001704682 | 127 |
| 48 | 3300005333 | Ga0070677_10199251 | Ga0070677_101992512 | 127 |
| 49 | 3300005343 | Ga0070687_100144813 | Ga0070687_1001448131 | 127 |
| 50 | 3300005353 | Ga0070669_100070096 | Ga0070669_1000700963 | 127 |
| 51 | 3300005353 | Ga0070669_100332511 | Ga0070669_1003325112 | 127 |
| 52 | 3300005440 | Ga0070705_100838695 | Ga0070705_1008386952 | 127 |
| 53 | 3300005441 | Ga0070700_100193697 | Ga0070700_1001936972 | 127 |
| 54 | 3300005441 | Ga0070700_100520735 | Ga0070700_1005207352 | 127 |
| 55 | 3300005457 | Ga0070662_100164360 | Ga0070662_1001643602 | 127 |
| 56 | 3300005549 | Ga0070704_100182115 | Ga0070704_1001821152 | 127 |
| 57 | 3300005577 | Ga0068857_101668799 | Ga0068857_1016687992 | 127 |
| 58 | 3300005578 | Ga0068854_100607694 | Ga0068854_1006076942 | 127 |
| 59 | 3300005843 | Ga0068860_101305494 | Ga0068860_1013054942 | 127 |
| 60 | 3300005844 | Ga0068862_100138830 | Ga0068862_1001388302 | 127 |
| 61 | 3300006847 | Ga0075431_101991987 | Ga0075431_1019919871 | 127 |
| 62 | 3300006852 | Ga0075433_11503425 | Ga0075433_115034251 | 127 |
| 63 | 3300006914 | Ga0075436_101081367 | Ga0075436_1010813672 | 127 |
| 64 | 3300007076 | Ga0075435_101065577 | Ga0075435_1010655772 | 127 |
| 65 | 3300009094 | Ga0111539_11228022 | Ga0111539_112280222 | 127 |
| 66 | 3300009147 | Ga0114129_10121107 | Ga0114129_101211074 | 127 |
| 67 | 3300014326 | Ga0157380_10223965 | Ga0157380_102239652 | 127 |
| 68 | 3300025923 | Ga0207681_10066060 | Ga0207681_100660603 | 127 |
| 69 | 3300025923 | Ga0207681_11085037 | Ga0207681_110850372 | 127 |
| 70 | 3300025933 | Ga0207706_10480244 | Ga0207706_104802442 | 127 |
| 71 | 3300025981 | Ga0207640_10209608 | Ga0207640_102096082 | 127 |
| 72 | 3300026075 | Ga0207708_10602105 | Ga0207708_106021052 | 127 |
| 73 | 3300028380 | Ga0268265_10981964 | Ga0268265_109819642 | 127 |
| 74 | 3300050511 | nmdc:mga08y16_1410111_c1 | nmdc:mga08y16_1410111_c1_110_493 | 127 |
| 75 | 3300050513 | nmdc:mga0rr50_1019179_c1 | nmdc:mga0rr50_1019179_c1_108_557 | 127 |
| 76 | 3300005293 | Ga0065715_10019066 | Ga0065715_100190661 | 128 |
| 77 | 3300005334 | Ga0068869_100043791 | Ga0068869_1000437912 | 128 |
| 78 | 3300005335 | Ga0070666_10224466 | Ga0070666_102244661 | 128 |
| 79 | 3300005336 | Ga0070680_101334484 | Ga0070680_1013344841 | 128 |
| 80 | 3300005340 | Ga0070689_100080303 | Ga0070689_1000803032 | 128 |
| 81 | 3300005341 | Ga0070691_10156134 | Ga0070691_101561342 | 128 |
| 82 | 3300005353 | Ga0070669_100001076 | Ga0070669_1000010765 | 128 |
| 83 | 3300005354 | Ga0070675_100025794 | Ga0070675_1000257944 | 128 |
| 84 | 3300005365 | Ga0070688_100456202 | Ga0070688_1004562022 | 128 |
| 85 | 3300005440 | Ga0070705_100165016 | Ga0070705_1001650162 | 128 |
| 86 | 3300005440 | Ga0070705_100676001 | Ga0070705_1006760012 | 128 |
| 87 | 3300005441 | Ga0070700_100923517 | Ga0070700_1009235171 | 128 |
| 88 | 3300005444 | Ga0070694_100023159 | Ga0070694_1000231594 | 128 |
| 89 | 3300005444 | Ga0070694_100144945 | Ga0070694_1001449452 | 128 |
| 90 | 3300005444 | Ga0070694_100194997 | Ga0070694_1001949972 | 128 |
| 91 | 3300005444 | Ga0070694_100434139 | Ga0070694_1004341392 | 128 |
| 92 | 3300005459 | Ga0068867_100017596 | Ga0068867_1000175965 | 128 |
| 93 | 3300005468 | Ga0070707_100461016 | Ga0070707_1004610161 | 128 |
| 94 | 3300005471 | Ga0070698_100167457 | Ga0070698_1001674571 | 128 |
| 95 | 3300005518 | Ga0070699_100031915 | Ga0070699_1000319152 | 128 |
| 96 | 3300005535 | Ga0070684_102076275 | Ga0070684_1020762751 | 128 |
| 97 | 3300005536 | Ga0070697_100474565 | Ga0070697_1004745652 | 128 |
| 98 | 3300005545 | Ga0070695_100074601 | Ga0070695_1000746012 | 128 |
| 99 | 3300005545 | Ga0070695_100309452 | Ga0070695_1003094522 | 128 |
| 100 | 3300005546 | Ga0070696_100033132 | Ga0070696_1000331322 | 128 |
| 101 | 3300005546 | Ga0070696_100341995 | Ga0070696_1003419952 | 128 |
| 102 | 3300005546 | Ga0070696_100378627 | Ga0070696_1003786271 | 128 |
| 103 | 3300005547 | Ga0070693_100311344 | Ga0070693_1003113442 | 128 |
| 104 | 3300005549 | Ga0070704_100233452 | Ga0070704_1002334522 | 128 |
| 105 | 3300005549 | Ga0070704_100238477 | Ga0070704_1002384772 | 128 |
| 106 | 3300005614 | Ga0068856_100353307 | Ga0068856_1003533072 | 128 |
| 107 | 3300005615 | Ga0070702_100340055 | Ga0070702_1003400552 | 128 |
| 108 | 3300005617 | Ga0068859_100467143 | Ga0068859_1004671432 | 128 |
| 109 | 3300005719 | Ga0068861_100072499 | Ga0068861_1000724994 | 128 |
| 110 | 3300006852 | Ga0075433_10474048 | Ga0075433_104740481 | 128 |
| 111 | 3300006931 | Ga0097620_100467157 | Ga0097620_1004671572 | 128 |
| 112 | 3300009098 | Ga0105245_11469334 | Ga0105245_114693341 | 128 |
| 113 | 3300009147 | Ga0114129_10094312 | Ga0114129_100943124 | 128 |
| 114 | 3300009148 | Ga0105243_10054582 | Ga0105243_100545824 | 128 |
| 115 | 3300009148 | Ga0105243_10452559 | Ga0105243_104525592 | 128 |
| 116 | 3300009148 | Ga0105243_11914704 | Ga0105243_119147041 | 128 |
| 117 | 3300009174 | Ga0105241_10304568 | Ga0105241_103045682 | 128 |
| 118 | 3300009177 | Ga0105248_10026013 | Ga0105248_100260133 | 128 |
| 119 | 3300009545 | Ga0105237_10037543 | Ga0105237_100375432 | 128 |
| 120 | 3300009551 | Ga0105238_10613946 | Ga0105238_106139461 | 128 |
| 121 | 3300009553 | Ga0105249_10012414 | Ga0105249_100124147 | 128 |
| 122 | 3300010375 | Ga0105239_11046686 | Ga0105239_110466862 | 128 |
| 123 | 3300011119 | Ga0105246_12596879 | Ga0105246_125968791 | 128 |
| 124 | 3300013297 | Ga0157378_10312235 | Ga0157378_103122352 | 128 |
| 125 | 3300014325 | Ga0163163_10068898 | Ga0163163_100688983 | 128 |
| 126 | 3300014745 | Ga0157377_10001943 | Ga0157377_100019435 | 128 |
| 127 | 3300025911 | Ga0207654_10336617 | Ga0207654_103366172 | 128 |
| 128 | 3300025917 | Ga0207660_10731141 | Ga0207660_107311412 | 128 |
| 129 | 3300025922 | Ga0207646_10188805 | Ga0207646_101888053 | 128 |
| 130 | 3300025923 | Ga0207681_10001089 | Ga0207681_1000108917 | 128 |
| 131 | 3300025923 | Ga0207681_10143076 | Ga0207681_101430763 | 128 |
| 132 | 3300025926 | Ga0207659_10264668 | Ga0207659_102646681 | 128 |
| 133 | 3300025934 | Ga0207686_10666672 | Ga0207686_106666722 | 128 |
| 134 | 3300025934 | Ga0207686_10965973 | Ga0207686_109659732 | 128 |
| 135 | 3300025935 | Ga0207709_10190020 | Ga0207709_101900202 | 128 |
| 136 | 3300025936 | Ga0207670_10005882 | Ga0207670_100058823 | 128 |
| 137 | 3300025938 | Ga0207704_11052974 | Ga0207704_110529741 | 128 |
| 138 | 3300025960 | Ga0207651_10163009 | Ga0207651_101630092 | 128 |
| 139 | 3300025961 | Ga0207712_11373679 | Ga0207712_113736791 | 128 |
| 140 | 3300026088 | Ga0207641_10110686 | Ga0207641_101106863 | 128 |
| 141 | 3300026089 | Ga0207648_10015231 | Ga0207648_100152314 | 128 |
| 142 | 3300026095 | Ga0207676_10877893 | Ga0207676_108778932 | 128 |
| 143 | 3300026121 | Ga0207683_10061144 | Ga0207683_100611442 | 128 |
| 144 | 3300038996 | Ga0242420_002218 | Ga0242420_002218_1822_2217 | 128 |
| 145 | 3300045051 | Ga0451576_1719702 | Ga0451576_1719702_131_526 | 128 |
| 146 | 3300048909 | Ga0496106_0169834 | Ga0496106_0169834_490_885 | 128 |
| 147 | 3300050507 | nmdc:mga05p37_397567_c1 | nmdc:mga05p37_397567_c1_457_843 | 128 |
| 148 | 3300050508 | nmdc:mga09592_709833_c2 | nmdc:mga09592_709833_c2_54_446 | 128 |
| 149 | 3300050515 | nmdc:mga0a205_310520_c1 | nmdc:mga0a205_310520_c1_61_447 | 128 |
| 150 | 3300005334 | Ga0068869_100066345 | Ga0068869_1000663452 | 129 |
| 151 | 3300005343 | Ga0070687_100277563 | Ga0070687_1002775632 | 129 |
| 152 | 3300005444 | Ga0070694_100002173 | Ga0070694_1000021735 | 129 |
| 153 | 3300005445 | Ga0070708_100170744 | Ga0070708_1001707443 | 129 |
| 154 | 3300005467 | Ga0070706_100253554 | Ga0070706_1002535541 | 129 |
| 155 | 3300005467 | Ga0070706_100336712 | Ga0070706_1003367122 | 129 |
| 156 | 3300005471 | Ga0070698_101349234 | Ga0070698_1013492341 | 129 |
| 157 | 3300005544 | Ga0070686_100643681 | Ga0070686_1006436812 | 129 |
| 158 | 3300005546 | Ga0070696_100488596 | Ga0070696_1004885962 | 129 |
| 159 | 3300005564 | Ga0070664_100546160 | Ga0070664_1005461602 | 129 |
| 160 | 3300005618 | Ga0068864_100679837 | Ga0068864_1006798372 | 129 |
| 161 | 3300005719 | Ga0068861_100071240 | Ga0068861_1000712403 | 129 |
| 162 | 3300006844 | Ga0075428_100773624 | Ga0075428_1007736242 | 129 |
| 163 | 3300006847 | Ga0075431_102015421 | Ga0075431_1020154212 | 129 |
| 164 | 3300006871 | Ga0075434_100174303 | Ga0075434_1001743032 | 129 |
| 165 | 3300006880 | Ga0075429_100152021 | Ga0075429_1001520213 | 129 |
| 166 | 3300006881 | Ga0068865_101792375 | Ga0068865_1017923751 | 129 |
| 167 | 3300007076 | Ga0075435_100553987 | Ga0075435_1005539871 | 129 |
| 168 | 3300014325 | Ga0163163_11030103 | Ga0163163_110301031 | 129 |
| 169 | 3300014326 | Ga0157380_11341179 | Ga0157380_113411791 | 129 |
| 170 | 3300025910 | Ga0207684_10483478 | Ga0207684_104834781 | 129 |
| 171 | 3300025938 | Ga0207704_10149653 | Ga0207704_101496531 | 129 |
| 172 | 3300025942 | Ga0207689_10064299 | Ga0207689_100642992 | 129 |
| 173 | 3300025945 | Ga0207679_10375155 | Ga0207679_103751552 | 129 |
| 174 | 3300026116 | Ga0207674_10262292 | Ga0207674_102622922 | 129 |
| 175 | 3300028563 | Ga0265319_1026635 | Ga0265319_10266353 | 129 |
| 176 | 3300028577 | Ga0265318_10019040 | Ga0265318_100190403 | 129 |
| 177 | 3300031250 | Ga0265331_10031938 | Ga0265331_100319383 | 129 |
| 178 | 3300031344 | Ga0265316_10026234 | Ga0265316_100262347 | 129 |
| 179 | 3300031711 | Ga0265314_10358581 | Ga0265314_103585811 | 129 |
| 180 | 3300031712 | Ga0265342_10066896 | Ga0265342_100668962 | 129 |
| 181 | 3300050512 | nmdc:mga0n895_361962_c1 | nmdc:mga0n895_361962_c1_976_1368 | 129 |
| 182 | 3300050513 | nmdc:mga0rr50_509713_c1 | nmdc:mga0rr50_509713_c1_183_575 | 129 |
| 183 | 3300050514 | nmdc:mga08x19_285496_c1 | nmdc:mga08x19_285496_c1_256_648 | 129 |
| 184 | 3300013307 | Ga0157372_10022004 | Ga0157372_100220042 | 130 |
| 185 | 3300025913 | Ga0207695_10052868 | Ga0207695_100528685 | 130 |
| 186 | 3300025918 | Ga0207662_10700353 | Ga0207662_107003532 | 130 |
| 187 | 3300049705 | Ga0501225_0032021 | Ga0501225_0032021_601_993 | 130 |
| 188 | 3300005353 | Ga0070669_100660196 | Ga0070669_1006601961 | 131 |
| 189 | 3300005536 | Ga0070697_100030480 | Ga0070697_1000304804 | 131 |
| 190 | 3300005545 | Ga0070695_101509904 | Ga0070695_1015099041 | 131 |
| 191 | 3300009148 | Ga0105243_10122267 | Ga0105243_101222672 | 131 |
| 192 | 3300009176 | Ga0105242_11891780 | Ga0105242_118917802 | 131 |
| 193 | 3300013297 | Ga0157378_10644519 | Ga0157378_106445191 | 131 |
| 194 | 3300025923 | Ga0207681_10722793 | Ga0207681_107227932 | 131 |
| 195 | 3300046539 | Ga0495621_0035251 | Ga0495621_0035251_492_887 | 131 |
| 196 | 3300005330 | Ga0070690_100029858 | Ga0070690_1000298584 | 132 |
| 197 | 3300005444 | Ga0070694_101542033 | Ga0070694_1015420331 | 132 |
| 198 | 3300005577 | Ga0068857_100467265 | Ga0068857_1004672652 | 132 |
| 199 | 3300009094 | Ga0111539_10142720 | Ga0111539_101427201 | 132 |
| 200 | 3300027907 | Ga0207428_10354468 | Ga0207428_103544681 | 132 |
| 201 | 3300050511 | nmdc:mga08y16_611352_c1 | nmdc:mga08y16_611352_c1_635_1054 | 132 |
| 202 | 3300005445 | Ga0070708_100151957 | Ga0070708_1001519572 | 134 |
| 203 | 3300042435 | Ga0439434_0007515 | Ga0439434_0007515_1694_2101 | 134 |
| 204 | 3300046525 | Ga0495663_0000613 | Ga0495663_0000613_5843_6247 | 134 |
| 205 | 3300046539 | Ga0495621_0020245 | Ga0495621_0020245_1624_2028 | 134 |
| 206 | 3300005331 | Ga0070670_100000136 | Ga0070670_10000013625 | 136 |
| 207 | 3300009148 | Ga0105243_10049910 | Ga0105243_100499103 | 136 |
| 208 | 3300011119 | Ga0105246_11062430 | Ga0105246_110624302 | 136 |
| 209 | 3300025910 | Ga0207684_10217873 | Ga0207684_102178732 | 136 |
| 210 | 3300025935 | Ga0207709_10385941 | Ga0207709_103859412 | 136 |
| 211 | 3300047320 | Ga0495672_0042414 | Ga0495672_0042414_489_899 | 136 |
| 212 | 2088090003 | LJN_F7QKVOU01DIPN7 | LJN_02527620 | 137 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rld-assembly1.cif.gz_E | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.9336 | 18 | 122 |
| 2rld-assembly1.cif.gz_D | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.9233 | 15 | 119 |
| 2rld-assembly1.cif.gz_B | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.9204 | 14 | 122 |
| 2gsc-assembly1.cif.gz_C | crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris | 0.9052 | 18 | 123 |
| 2rld-assembly1.cif.gz_A | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.905 | 11 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_X1WEV5_108_185_1.10.287.660 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.961 | 66 | 126 | 1.10.287.660 |
| 2rldE00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.9244 | 18 | 122 | 1.20.1440.60 |
| 2rldC00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.91 | 12 | 122 | 1.20.1440.60 |
| 2rldB00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.9098 | 14 | 122 | 1.20.1440.60 |
| 2gscC00 | Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence | 0.9052 | 18 | 123 | 1.20.1440.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8PSU0-F1-model_v4 | Four helix bundle protein | 1.003 | 13 | 128 |
|
| AF-A0A2V9M7I8-F1-model_v4 | Four helix bundle protein | 1.001 | 9 | 127 |
|
| AF-A0A2V8LM23-F1-model_v4 | Four helix bundle protein | 0.9998 | 14 | 120 |
|
| AF-A0A2V8QG55-F1-model_v4 | Four helix bundle protein | 0.9992 | 14 | 128 |
|
| AF-A0A7V3GUB4-F1-model_v4 | Four helix bundle protein | 0.998 | 14 | 113 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar