F322455

General Info

Members Datasets Scaffolds Average Seq Length
212 135 212 129

Family's Representative Sequence

Representative Sequence 3300005343|Ga0070687_100144813|Ga0070687_1001448131
Length 130
Sequence MEDKVEKDPQSRANVLEERLIDFAVRIVRLSANLPRTAAGRHIAGQILRSGTSPAPNYGEARGAESQADFEHKLAIVVLEELNETSIWLRIIGRSEMLTDELIARLVQENNELCKILTASLKTARGRTVK

Samples

Sample ID Description Type Environment
1 2088090003 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
114 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
120 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJN_F7QKVOU01DIPN7 2088090003 Unclassified 506
2 Ga0065715_10019066 3300005293 Unclassified 2584
3 Ga0070690_100026210 3300005330 Bacteria 3594
4 Ga0070690_100029858 3300005330 Bacteria 3385
5 Ga0070690_100170468 3300005330 Unclassified 1497
6 Ga0070670_100000136 3300005331 Bacteria 68887
7 Ga0070670_100374346 3300005331 Bacteria 1254
8 Ga0070677_10199251 3300005333 Bacteria 965
9 Ga0068869_100015659 3300005334 Bacteria 5093
10 Ga0068869_100043791 3300005334 Bacteria 3217
11 Ga0068869_100066345 3300005334 Bacteria 2658
12 Ga0070666_10224466 3300005335 Bacteria 1325
13 Ga0070680_101334484 3300005336 Bacteria 621
14 Ga0070689_100080303 3300005340 Bacteria 2559
15 Ga0070691_10156134 3300005341 Unclassified 1173
16 Ga0070687_100144813 3300005343 Bacteria 1388
17 Ga0070687_100277563 3300005343 Bacteria 1053
18 Ga0070669_100001076 3300005353 Bacteria 20001
19 Ga0070669_100070096 3300005353 Unclassified 2591
20 Ga0070669_100332511 3300005353 Bacteria 1229
21 Ga0070669_100660196 3300005353 Unclassified 880
22 Ga0070675_100025794 3300005354 Bacteria 4712
23 Ga0070671_100742799 3300005355 Bacteria 853
24 Ga0070673_100332492 3300005364 Bacteria 1345
25 Ga0070688_100456202 3300005365 Bacteria 956
26 Ga0070667_101514414 3300005367 Unclassified 630
27 Ga0070705_100165016 3300005440 Bacteria 1485
28 Ga0070705_100676001 3300005440 Bacteria 808
29 Ga0070705_100838695 3300005440 Bacteria 734
30 Ga0070700_100193697 3300005441 Bacteria 1423
31 Ga0070700_100520735 3300005441 Bacteria 918
32 Ga0070700_100923517 3300005441 Unclassified 712
33 Ga0070694_100002173 3300005444 Bacteria 11626
34 Ga0070694_100023159 3300005444 Unclassified 3990
35 Ga0070694_100078413 3300005444 Unclassified 2291
36 Ga0070694_100144945 3300005444 Unclassified 1729
37 Ga0070694_100186731 3300005444 Bacteria 1537
38 Ga0070694_100194997 3300005444 Bacteria 1506
39 Ga0070694_100340578 3300005444 Bacteria 1159
40 Ga0070694_100434139 3300005444 Bacteria 1034
41 Ga0070694_101542033 3300005444 Bacteria 563
42 Ga0070708_100151957 3300005445 Bacteria 2153
43 Ga0070708_100170744 3300005445 Bacteria 2030
44 Ga0070662_100164360 3300005457 Unclassified 1738
45 Ga0068867_100017596 3300005459 Bacteria 5075
46 Ga0070685_10074162 3300005466 Bacteria 2024
47 Ga0070706_100253554 3300005467 Unclassified 1643
48 Ga0070706_100336712 3300005467 Bacteria 1407
49 Ga0070707_100461016 3300005468 Bacteria 1232
50 Ga0070698_100167457 3300005471 Bacteria 2139
51 Ga0070698_100303121 3300005471 Bacteria 1528
52 Ga0070698_101349234 3300005471 Unclassified 663
53 Ga0070699_100031915 3300005518 Bacteria 4548
54 Ga0070699_100257652 3300005518 Bacteria 1560
55 Ga0070684_102076275 3300005535 Unclassified 536
56 Ga0070697_100030480 3300005536 Bacteria 4333
57 Ga0070697_100474565 3300005536 Bacteria 1092
58 Ga0070697_100726780 3300005536 Unclassified 877
59 Ga0070697_100980348 3300005536 Unclassified 751
60 Ga0070686_100643681 3300005544 Bacteria 840
61 Ga0070695_100074601 3300005545 Unclassified 2229
62 Ga0070695_100309452 3300005545 Bacteria 1170
63 Ga0070695_101509904 3300005545 Unclassified 559
64 Ga0070696_100033132 3300005546 Bacteria 3548
65 Ga0070696_100341995 3300005546 Bacteria 1156
66 Ga0070696_100378627 3300005546 Bacteria 1102
67 Ga0070696_100395639 3300005546 Bacteria 1080
68 Ga0070696_100488596 3300005546 Bacteria 977
69 Ga0070693_100311344 3300005547 Bacteria 1065
70 Ga0070704_100182115 3300005549 Unclassified 1681
71 Ga0070704_100233452 3300005549 Bacteria 1502
72 Ga0070704_100238477 3300005549 Unclassified 1487
73 Ga0070664_100510200 3300005564 Unclassified 1109
74 Ga0070664_100546160 3300005564 Bacteria 1071
75 Ga0068857_100467265 3300005577 Bacteria 1181
76 Ga0068857_101668799 3300005577 Bacteria 623
77 Ga0068854_100607694 3300005578 Unclassified 934
78 Ga0068856_100353307 3300005614 Unclassified 1488
79 Ga0070702_100340055 3300005615 Bacteria 1053
80 Ga0068852_101109907 3300005616 Unclassified 811
81 Ga0068859_100467143 3300005617 Bacteria 1357
82 Ga0068864_100679837 3300005618 Bacteria 1004
83 Ga0068864_100725438 3300005618 Bacteria 972
84 Ga0068861_100071240 3300005719 Bacteria 2694
85 Ga0068861_100072499 3300005719 Bacteria 2672
86 Ga0068863_100742285 3300005841 Unclassified 977
87 Ga0068858_101358659 3300005842 Bacteria 700
88 Ga0068860_101305494 3300005843 Unclassified 746
89 Ga0068862_100138830 3300005844 Unclassified 2156
90 Ga0081540_1047718 3300005983 Bacteria 2151
91 Ga0097621_100080456 3300006237 Bacteria 2710
92 Ga0068871_100527107 3300006358 Bacteria 1067
93 Ga0075428_100773624 3300006844 Unclassified 1021
94 Ga0075431_101991987 3300006847 Bacteria 536
95 Ga0075431_102015421 3300006847 Bacteria 532
96 Ga0075433_10474048 3300006852 Bacteria 1103
97 Ga0075433_11503425 3300006852 Unclassified 582
98 Ga0075434_100174303 3300006871 Unclassified 2171
99 Ga0075429_100152021 3300006880 Bacteria 2027
100 Ga0068865_101792375 3300006881 Unclassified 554
101 Ga0075436_101081367 3300006914 Unclassified 603
102 Ga0097620_100467157 3300006931 Bacteria 1357
103 Ga0075435_100553987 3300007076 Bacteria 996
104 Ga0075435_101065577 3300007076 Unclassified 706
105 Ga0111539_10142720 3300009094 Bacteria 2803
106 Ga0111539_11228022 3300009094 Unclassified 870
107 Ga0105245_11469334 3300009098 Bacteria 732
108 Ga0114129_10094312 3300009147 Bacteria 4145
109 Ga0114129_10121107 3300009147 Bacteria 3601
110 Ga0105243_10049910 3300009148 Bacteria 3303
111 Ga0105243_10054582 3300009148 Bacteria 3173
112 Ga0105243_10122267 3300009148 Bacteria 2196
113 Ga0105243_10452559 3300009148 Bacteria 1205
114 Ga0105243_11914704 3300009148 Unclassified 626
115 Ga0105241_10304568 3300009174 Bacteria 1369
116 Ga0105241_10332210 3300009174 Bacteria 1314
117 Ga0105241_10766352 3300009174 Bacteria 886
118 Ga0105242_11891780 3300009176 Unclassified 637
119 Ga0105248_10026013 3300009177 Bacteria 6509
120 Ga0105237_10037543 3300009545 Bacteria 4896
121 Ga0105238_10613946 3300009551 Bacteria 1096
122 Ga0105249_10012414 3300009553 Bacteria 7510
123 Ga0105249_13125991 3300009553 Bacteria 532
124 Ga0105239_11046686 3300010375 Bacteria 939
125 Ga0105246_10212994 3300011119 Bacteria 1509
126 Ga0105246_11062430 3300011119 Bacteria 737
127 Ga0105246_12596879 3300011119 Bacteria 500
128 Ga0157373_10017669 3300013100 Bacteria 5192
129 Ga0157378_10312235 3300013297 Unclassified 1525
130 Ga0157378_10644519 3300013297 Unclassified 1074
131 Ga0163162_10602028 3300013306 Bacteria 1225
132 Ga0157372_10022004 3300013307 Bacteria 6893
133 Ga0163163_10068898 3300014325 Unclassified 3522
134 Ga0163163_11030103 3300014325 Bacteria 886
135 Ga0157380_10223965 3300014326 Unclassified 1684
136 Ga0157380_11341179 3300014326 Bacteria 764
137 Ga0157377_10001943 3300014745 Bacteria 9041
138 Ga0163161_10012275 3300017792 Bacteria 5945
139 Ga0207643_10084994 3300025908 Bacteria 1837
140 Ga0207684_10217873 3300025910 Unclassified 1647
141 Ga0207684_10483478 3300025910 Bacteria 1062
142 Ga0207654_10249103 3300025911 Bacteria 1190
143 Ga0207654_10336617 3300025911 Unclassified 1036
144 Ga0207695_10052868 3300025913 Bacteria 4252
145 Ga0207660_10731141 3300025917 Unclassified 807
146 Ga0207662_10700353 3300025918 Bacteria 710
147 Ga0207646_10188805 3300025922 Bacteria 1861
148 Ga0207646_11387755 3300025922 Bacteria 611
149 Ga0207681_10001089 3300025923 Bacteria 17622
150 Ga0207681_10066060 3300025923 Unclassified 2503
151 Ga0207681_10143076 3300025923 Bacteria 1783
152 Ga0207681_10722793 3300025923 Bacteria 829
153 Ga0207681_11085037 3300025923 Unclassified 672
154 Ga0207659_10264668 3300025926 Bacteria 1400
155 Ga0207706_10480244 3300025933 Unclassified 1074
156 Ga0207686_10666672 3300025934 Bacteria 824
157 Ga0207686_10965973 3300025934 Bacteria 690
158 Ga0207709_10190020 3300025935 Bacteria 1458
159 Ga0207709_10385941 3300025935 Unclassified 1067
160 Ga0207670_10005882 3300025936 Bacteria 6768
161 Ga0207704_10149653 3300025938 Bacteria 1645
162 Ga0207704_11052974 3300025938 Bacteria 690
163 Ga0207691_10054515 3300025940 Bacteria 3647
164 Ga0207689_10035904 3300025942 Bacteria 4115
165 Ga0207689_10064299 3300025942 Bacteria 3019
166 Ga0207689_10161750 3300025942 Bacteria 1845
167 Ga0207679_10375155 3300025945 Unclassified 1246
168 Ga0207679_10562293 3300025945 Bacteria 1024
169 Ga0207651_10163009 3300025960 Bacteria 1750
170 Ga0207651_11508534 3300025960 Bacteria 605
171 Ga0207712_11373679 3300025961 Bacteria 632
172 Ga0207640_10209608 3300025981 Unclassified 1483
173 Ga0207658_10145552 3300025986 Bacteria 1924
174 Ga0207677_10660866 3300026023 Bacteria 923
175 Ga0207708_10602105 3300026075 Unclassified 931
176 Ga0207702_10029830 3300026078 Bacteria 4541
177 Ga0207641_10110686 3300026088 Bacteria 2434
178 Ga0207648_10015231 3300026089 Bacteria 7074
179 Ga0207676_10877893 3300026095 Bacteria 878
180 Ga0207674_10262292 3300026116 Unclassified 1675
181 Ga0207675_100058931 3300026118 Bacteria 3583
182 Ga0207675_101488706 3300026118 Bacteria 698
183 Ga0207683_10061144 3300026121 Bacteria 3314
184 Ga0207428_10354468 3300027907 Bacteria 1079
185 Ga0268265_10981964 3300028380 Unclassified 833
186 Ga0265319_1026635 3300028563 Bacteria 2057
187 Ga0265318_10019040 3300028577 Bacteria 2790
188 Ga0265331_10031938 3300031250 Bacteria 2613
189 Ga0265316_10026234 3300031344 Bacteria 4852
190 Ga0265314_10358581 3300031711 Bacteria 800
191 Ga0265342_10066896 3300031712 Bacteria 2104
192 Ga0242420_002218 3300038996 Bacteria 2745
193 Ga0439434_0007515 3300042435 Bacteria 3194
194 Ga0451576_1719702 3300045051 Bacteria 649
195 Ga0495663_0000613 3300046525 Bacteria 12401
196 Ga0495621_0020245 3300046539 Bacteria 2181
197 Ga0495621_0035251 3300046539 Bacteria 1732
198 Ga0495672_0042414 3300047320 Bacteria 2744
199 Ga0496102_0195365 3300048905 Bacteria 1907
200 Ga0496104_0244681 3300048907 Unclassified 1706
201 Ga0496106_0169834 3300048909 Bacteria 1728
202 Ga0501225_0032021 3300049705 Bacteria 1446
203 nmdc:mga05p37_159947_c1 3300050507 Unclassified 2751
204 nmdc:mga05p37_397567_c1 3300050507 Bacteria 1610
205 nmdc:mga09592_709833_c2 3300050508 Bacteria 528
206 nmdc:mga08y16_1410111_c1 3300050511 Bacteria 660
207 nmdc:mga08y16_611352_c1 3300050511 Bacteria 1098
208 nmdc:mga0n895_361962_c1 3300050512 Bacteria 1469
209 nmdc:mga0rr50_1019179_c1 3300050513 Unclassified 705
210 nmdc:mga0rr50_509713_c1 3300050513 Bacteria 1023
211 nmdc:mga08x19_285496_c1 3300050514 Bacteria 1144
212 nmdc:mga0a205_310520_c1 3300050515 Unclassified 1449

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100510200 Ga0070664_1005102002 120
2 3300005616 Ga0068852_101109907 Ga0068852_1011099071 120
3 3300005841 Ga0068863_100742285 Ga0068863_1007422852 120
4 3300025945 Ga0207679_10562293 Ga0207679_105622932 120
5 3300026078 Ga0207702_10029830 Ga0207702_100298303 120
6 3300048905 Ga0496102_0195365 Ga0496102_0195365_199_564 120
7 3300048907 Ga0496104_0244681 Ga0496104_0244681_189_554 120
8 3300005334 Ga0068869_100015659 Ga0068869_1000156594 121
9 3300025922 Ga0207646_11387755 Ga0207646_113877551 121
10 3300025942 Ga0207689_10035904 Ga0207689_100359043 121
11 3300050507 nmdc:mga05p37_159947_c1 nmdc:mga05p37_159947_c1_2264_2701 121
12 3300005983 Ga0081540_1047718 Ga0081540_10477182 122
13 3300005330 Ga0070690_100026210 Ga0070690_1000262103 123
14 3300005364 Ga0070673_100332492 Ga0070673_1003324921 123
15 3300005367 Ga0070667_101514414 Ga0070667_1015144141 123
16 3300005466 Ga0070685_10074162 Ga0070685_100741622 123
17 3300005536 Ga0070697_100980348 Ga0070697_1009803481 123
18 3300005618 Ga0068864_100725438 Ga0068864_1007254382 123
19 3300005842 Ga0068858_101358659 Ga0068858_1013586592 123
20 3300006237 Ga0097621_100080456 Ga0097621_1000804561 123
21 3300006358 Ga0068871_100527107 Ga0068871_1005271072 123
22 3300009174 Ga0105241_10766352 Ga0105241_107663521 123
23 3300013306 Ga0163162_10602028 Ga0163162_106020282 123
24 3300025940 Ga0207691_10054515 Ga0207691_100545154 123
25 3300025960 Ga0207651_11508534 Ga0207651_115085341 123
26 3300025986 Ga0207658_10145552 Ga0207658_101455522 123
27 3300026023 Ga0207677_10660866 Ga0207677_106608662 123
28 3300026118 Ga0207675_100058931 Ga0207675_1000589314 123
29 3300005444 Ga0070694_100186731 Ga0070694_1001867312 124
30 3300005536 Ga0070697_100726780 Ga0070697_1007267801 125
31 3300026118 Ga0207675_101488706 Ga0207675_1014887061 125
32 3300005331 Ga0070670_100374346 Ga0070670_1003743462 126
33 3300005355 Ga0070671_100742799 Ga0070671_1007427992 126
34 3300005444 Ga0070694_100078413 Ga0070694_1000784132 126
35 3300005444 Ga0070694_100340578 Ga0070694_1003405782 126
36 3300005471 Ga0070698_100303121 Ga0070698_1003031211 126
37 3300005518 Ga0070699_100257652 Ga0070699_1002576522 126
38 3300005546 Ga0070696_100395639 Ga0070696_1003956391 126
39 3300009174 Ga0105241_10332210 Ga0105241_103322101 126
40 3300009553 Ga0105249_13125991 Ga0105249_131259911 126
41 3300011119 Ga0105246_10212994 Ga0105246_102129942 126
42 3300013100 Ga0157373_10017669 Ga0157373_100176696 126
43 3300017792 Ga0163161_10012275 Ga0163161_100122755 126
44 3300025908 Ga0207643_10084994 Ga0207643_100849942 126
45 3300025911 Ga0207654_10249103 Ga0207654_102491032 126
46 3300025942 Ga0207689_10161750 Ga0207689_101617502 126
47 3300005330 Ga0070690_100170468 Ga0070690_1001704682 127
48 3300005333 Ga0070677_10199251 Ga0070677_101992512 127
49 3300005343 Ga0070687_100144813 Ga0070687_1001448131 127
50 3300005353 Ga0070669_100070096 Ga0070669_1000700963 127
51 3300005353 Ga0070669_100332511 Ga0070669_1003325112 127
52 3300005440 Ga0070705_100838695 Ga0070705_1008386952 127
53 3300005441 Ga0070700_100193697 Ga0070700_1001936972 127
54 3300005441 Ga0070700_100520735 Ga0070700_1005207352 127
55 3300005457 Ga0070662_100164360 Ga0070662_1001643602 127
56 3300005549 Ga0070704_100182115 Ga0070704_1001821152 127
57 3300005577 Ga0068857_101668799 Ga0068857_1016687992 127
58 3300005578 Ga0068854_100607694 Ga0068854_1006076942 127
59 3300005843 Ga0068860_101305494 Ga0068860_1013054942 127
60 3300005844 Ga0068862_100138830 Ga0068862_1001388302 127
61 3300006847 Ga0075431_101991987 Ga0075431_1019919871 127
62 3300006852 Ga0075433_11503425 Ga0075433_115034251 127
63 3300006914 Ga0075436_101081367 Ga0075436_1010813672 127
64 3300007076 Ga0075435_101065577 Ga0075435_1010655772 127
65 3300009094 Ga0111539_11228022 Ga0111539_112280222 127
66 3300009147 Ga0114129_10121107 Ga0114129_101211074 127
67 3300014326 Ga0157380_10223965 Ga0157380_102239652 127
68 3300025923 Ga0207681_10066060 Ga0207681_100660603 127
69 3300025923 Ga0207681_11085037 Ga0207681_110850372 127
70 3300025933 Ga0207706_10480244 Ga0207706_104802442 127
71 3300025981 Ga0207640_10209608 Ga0207640_102096082 127
72 3300026075 Ga0207708_10602105 Ga0207708_106021052 127
73 3300028380 Ga0268265_10981964 Ga0268265_109819642 127
74 3300050511 nmdc:mga08y16_1410111_c1 nmdc:mga08y16_1410111_c1_110_493 127
75 3300050513 nmdc:mga0rr50_1019179_c1 nmdc:mga0rr50_1019179_c1_108_557 127
76 3300005293 Ga0065715_10019066 Ga0065715_100190661 128
77 3300005334 Ga0068869_100043791 Ga0068869_1000437912 128
78 3300005335 Ga0070666_10224466 Ga0070666_102244661 128
79 3300005336 Ga0070680_101334484 Ga0070680_1013344841 128
80 3300005340 Ga0070689_100080303 Ga0070689_1000803032 128
81 3300005341 Ga0070691_10156134 Ga0070691_101561342 128
82 3300005353 Ga0070669_100001076 Ga0070669_1000010765 128
83 3300005354 Ga0070675_100025794 Ga0070675_1000257944 128
84 3300005365 Ga0070688_100456202 Ga0070688_1004562022 128
85 3300005440 Ga0070705_100165016 Ga0070705_1001650162 128
86 3300005440 Ga0070705_100676001 Ga0070705_1006760012 128
87 3300005441 Ga0070700_100923517 Ga0070700_1009235171 128
88 3300005444 Ga0070694_100023159 Ga0070694_1000231594 128
89 3300005444 Ga0070694_100144945 Ga0070694_1001449452 128
90 3300005444 Ga0070694_100194997 Ga0070694_1001949972 128
91 3300005444 Ga0070694_100434139 Ga0070694_1004341392 128
92 3300005459 Ga0068867_100017596 Ga0068867_1000175965 128
93 3300005468 Ga0070707_100461016 Ga0070707_1004610161 128
94 3300005471 Ga0070698_100167457 Ga0070698_1001674571 128
95 3300005518 Ga0070699_100031915 Ga0070699_1000319152 128
96 3300005535 Ga0070684_102076275 Ga0070684_1020762751 128
97 3300005536 Ga0070697_100474565 Ga0070697_1004745652 128
98 3300005545 Ga0070695_100074601 Ga0070695_1000746012 128
99 3300005545 Ga0070695_100309452 Ga0070695_1003094522 128
100 3300005546 Ga0070696_100033132 Ga0070696_1000331322 128
101 3300005546 Ga0070696_100341995 Ga0070696_1003419952 128
102 3300005546 Ga0070696_100378627 Ga0070696_1003786271 128
103 3300005547 Ga0070693_100311344 Ga0070693_1003113442 128
104 3300005549 Ga0070704_100233452 Ga0070704_1002334522 128
105 3300005549 Ga0070704_100238477 Ga0070704_1002384772 128
106 3300005614 Ga0068856_100353307 Ga0068856_1003533072 128
107 3300005615 Ga0070702_100340055 Ga0070702_1003400552 128
108 3300005617 Ga0068859_100467143 Ga0068859_1004671432 128
109 3300005719 Ga0068861_100072499 Ga0068861_1000724994 128
110 3300006852 Ga0075433_10474048 Ga0075433_104740481 128
111 3300006931 Ga0097620_100467157 Ga0097620_1004671572 128
112 3300009098 Ga0105245_11469334 Ga0105245_114693341 128
113 3300009147 Ga0114129_10094312 Ga0114129_100943124 128
114 3300009148 Ga0105243_10054582 Ga0105243_100545824 128
115 3300009148 Ga0105243_10452559 Ga0105243_104525592 128
116 3300009148 Ga0105243_11914704 Ga0105243_119147041 128
117 3300009174 Ga0105241_10304568 Ga0105241_103045682 128
118 3300009177 Ga0105248_10026013 Ga0105248_100260133 128
119 3300009545 Ga0105237_10037543 Ga0105237_100375432 128
120 3300009551 Ga0105238_10613946 Ga0105238_106139461 128
121 3300009553 Ga0105249_10012414 Ga0105249_100124147 128
122 3300010375 Ga0105239_11046686 Ga0105239_110466862 128
123 3300011119 Ga0105246_12596879 Ga0105246_125968791 128
124 3300013297 Ga0157378_10312235 Ga0157378_103122352 128
125 3300014325 Ga0163163_10068898 Ga0163163_100688983 128
126 3300014745 Ga0157377_10001943 Ga0157377_100019435 128
127 3300025911 Ga0207654_10336617 Ga0207654_103366172 128
128 3300025917 Ga0207660_10731141 Ga0207660_107311412 128
129 3300025922 Ga0207646_10188805 Ga0207646_101888053 128
130 3300025923 Ga0207681_10001089 Ga0207681_1000108917 128
131 3300025923 Ga0207681_10143076 Ga0207681_101430763 128
132 3300025926 Ga0207659_10264668 Ga0207659_102646681 128
133 3300025934 Ga0207686_10666672 Ga0207686_106666722 128
134 3300025934 Ga0207686_10965973 Ga0207686_109659732 128
135 3300025935 Ga0207709_10190020 Ga0207709_101900202 128
136 3300025936 Ga0207670_10005882 Ga0207670_100058823 128
137 3300025938 Ga0207704_11052974 Ga0207704_110529741 128
138 3300025960 Ga0207651_10163009 Ga0207651_101630092 128
139 3300025961 Ga0207712_11373679 Ga0207712_113736791 128
140 3300026088 Ga0207641_10110686 Ga0207641_101106863 128
141 3300026089 Ga0207648_10015231 Ga0207648_100152314 128
142 3300026095 Ga0207676_10877893 Ga0207676_108778932 128
143 3300026121 Ga0207683_10061144 Ga0207683_100611442 128
144 3300038996 Ga0242420_002218 Ga0242420_002218_1822_2217 128
145 3300045051 Ga0451576_1719702 Ga0451576_1719702_131_526 128
146 3300048909 Ga0496106_0169834 Ga0496106_0169834_490_885 128
147 3300050507 nmdc:mga05p37_397567_c1 nmdc:mga05p37_397567_c1_457_843 128
148 3300050508 nmdc:mga09592_709833_c2 nmdc:mga09592_709833_c2_54_446 128
149 3300050515 nmdc:mga0a205_310520_c1 nmdc:mga0a205_310520_c1_61_447 128
150 3300005334 Ga0068869_100066345 Ga0068869_1000663452 129
151 3300005343 Ga0070687_100277563 Ga0070687_1002775632 129
152 3300005444 Ga0070694_100002173 Ga0070694_1000021735 129
153 3300005445 Ga0070708_100170744 Ga0070708_1001707443 129
154 3300005467 Ga0070706_100253554 Ga0070706_1002535541 129
155 3300005467 Ga0070706_100336712 Ga0070706_1003367122 129
156 3300005471 Ga0070698_101349234 Ga0070698_1013492341 129
157 3300005544 Ga0070686_100643681 Ga0070686_1006436812 129
158 3300005546 Ga0070696_100488596 Ga0070696_1004885962 129
159 3300005564 Ga0070664_100546160 Ga0070664_1005461602 129
160 3300005618 Ga0068864_100679837 Ga0068864_1006798372 129
161 3300005719 Ga0068861_100071240 Ga0068861_1000712403 129
162 3300006844 Ga0075428_100773624 Ga0075428_1007736242 129
163 3300006847 Ga0075431_102015421 Ga0075431_1020154212 129
164 3300006871 Ga0075434_100174303 Ga0075434_1001743032 129
165 3300006880 Ga0075429_100152021 Ga0075429_1001520213 129
166 3300006881 Ga0068865_101792375 Ga0068865_1017923751 129
167 3300007076 Ga0075435_100553987 Ga0075435_1005539871 129
168 3300014325 Ga0163163_11030103 Ga0163163_110301031 129
169 3300014326 Ga0157380_11341179 Ga0157380_113411791 129
170 3300025910 Ga0207684_10483478 Ga0207684_104834781 129
171 3300025938 Ga0207704_10149653 Ga0207704_101496531 129
172 3300025942 Ga0207689_10064299 Ga0207689_100642992 129
173 3300025945 Ga0207679_10375155 Ga0207679_103751552 129
174 3300026116 Ga0207674_10262292 Ga0207674_102622922 129
175 3300028563 Ga0265319_1026635 Ga0265319_10266353 129
176 3300028577 Ga0265318_10019040 Ga0265318_100190403 129
177 3300031250 Ga0265331_10031938 Ga0265331_100319383 129
178 3300031344 Ga0265316_10026234 Ga0265316_100262347 129
179 3300031711 Ga0265314_10358581 Ga0265314_103585811 129
180 3300031712 Ga0265342_10066896 Ga0265342_100668962 129
181 3300050512 nmdc:mga0n895_361962_c1 nmdc:mga0n895_361962_c1_976_1368 129
182 3300050513 nmdc:mga0rr50_509713_c1 nmdc:mga0rr50_509713_c1_183_575 129
183 3300050514 nmdc:mga08x19_285496_c1 nmdc:mga08x19_285496_c1_256_648 129
184 3300013307 Ga0157372_10022004 Ga0157372_100220042 130
185 3300025913 Ga0207695_10052868 Ga0207695_100528685 130
186 3300025918 Ga0207662_10700353 Ga0207662_107003532 130
187 3300049705 Ga0501225_0032021 Ga0501225_0032021_601_993 130
188 3300005353 Ga0070669_100660196 Ga0070669_1006601961 131
189 3300005536 Ga0070697_100030480 Ga0070697_1000304804 131
190 3300005545 Ga0070695_101509904 Ga0070695_1015099041 131
191 3300009148 Ga0105243_10122267 Ga0105243_101222672 131
192 3300009176 Ga0105242_11891780 Ga0105242_118917802 131
193 3300013297 Ga0157378_10644519 Ga0157378_106445191 131
194 3300025923 Ga0207681_10722793 Ga0207681_107227932 131
195 3300046539 Ga0495621_0035251 Ga0495621_0035251_492_887 131
196 3300005330 Ga0070690_100029858 Ga0070690_1000298584 132
197 3300005444 Ga0070694_101542033 Ga0070694_1015420331 132
198 3300005577 Ga0068857_100467265 Ga0068857_1004672652 132
199 3300009094 Ga0111539_10142720 Ga0111539_101427201 132
200 3300027907 Ga0207428_10354468 Ga0207428_103544681 132
201 3300050511 nmdc:mga08y16_611352_c1 nmdc:mga08y16_611352_c1_635_1054 132
202 3300005445 Ga0070708_100151957 Ga0070708_1001519572 134
203 3300042435 Ga0439434_0007515 Ga0439434_0007515_1694_2101 134
204 3300046525 Ga0495663_0000613 Ga0495663_0000613_5843_6247 134
205 3300046539 Ga0495621_0020245 Ga0495621_0020245_1624_2028 134
206 3300005331 Ga0070670_100000136 Ga0070670_10000013625 136
207 3300009148 Ga0105243_10049910 Ga0105243_100499103 136
208 3300011119 Ga0105246_11062430 Ga0105246_110624302 136
209 3300025910 Ga0207684_10217873 Ga0207684_102178732 136
210 3300025935 Ga0207709_10385941 Ga0207709_103859412 136
211 3300047320 Ga0495672_0042414 Ga0495672_0042414_489_899 136
212 2088090003 LJN_F7QKVOU01DIPN7 LJN_02527620 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05635

23S_rRNA_IVP

23S rRNA-intervening sequence protein

14

119

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9336 18 122
2rld-assembly1.cif.gz_D crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9233 15 119
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.9204 14 122
2gsc-assembly1.cif.gz_C crystal structure of the conserved hypothetical cytosolic protein xcc0516 from xanthomonas campestris 0.9052 18 123
2rld-assembly1.cif.gz_A crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.905 11 121
ID Description Score Start End Superfamily
af_X1WEV5_108_185_1.10.287.660 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.961 66 126 1.10.287.660
2rldE00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9244 18 122 1.20.1440.60
2rldC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.91 12 122 1.20.1440.60
2rldB00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9098 14 122 1.20.1440.60
2gscC00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.9052 18 123 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A2V8PSU0-F1-model_v4 Four helix bundle protein 1.003 13 128
AF-A0A2V9M7I8-F1-model_v4 Four helix bundle protein 1.001 9 127
AF-A0A2V8LM23-F1-model_v4 Four helix bundle protein 0.9998 14 120
AF-A0A2V8QG55-F1-model_v4 Four helix bundle protein 0.9992 14 128
AF-A0A7V3GUB4-F1-model_v4 Four helix bundle protein 0.998 14 113

Feature Viewer

pLDDT pTM Quality
89.33 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map