F322396

General Info

Members Datasets Scaffolds Average Seq Length
212 131 424 174

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100666317|Ga0070683_1006663172
Length 175
Sequence MKDKNDKQRELEELKKTLAENKNFFVTNYEKLTVRQDFQLRKTVRDAGGNYRVVKNNLAAKASEGTPASDLLGDLKGMTSLAYTAKDPVALAKALTKYSKENAQFTFKAGMVEGRVIDIKAIGDLAAMPPKEEIYAKLLYLINATATRLVTSINGVGRNLAVVLDQATKEGKFQQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
46 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
51 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
121 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.94
Rhizosphere 79.25
Stem 0
Stem Tuber 0
Unclassified 15.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100666317 3300005329 Unclassified 996
2 Ga0070682_100612944 3300005337 Unclassified 861
3 Ga0070660_100307120 3300005339 Bacteria 1301
4 Ga0070674_100274302 3300005356 Bacteria 1334
5 Ga0070659_100106823 3300005366 Bacteria 2257
6 Ga0070659_100400210 3300005366 Bacteria 1159
7 Ga0070667_101081759 3300005367 Unclassified 749
8 Ga0070714_100022737 3300005435 Bacteria 5144
9 Ga0070714_100176600 3300005435 Bacteria 1941
10 Ga0070714_100267983 3300005435 Unclassified 1583
11 Ga0070714_101141600 3300005435 Bacteria 760
12 Ga0070713_100018979 3300005436 Bacteria 5237
13 Ga0070711_100024070 3300005439 Bacteria 3968
14 Ga0070700_101463692 3300005441 Bacteria 579
15 Ga0070708_100138995 3300005445 Bacteria 2252
16 Ga0070663_100040667 3300005455 Bacteria 3257
17 Ga0070663_100545878 3300005455 Unclassified 968
18 Ga0070678_100030897 3300005456 Bacteria 3688
19 Ga0070678_100040475 3300005456 Bacteria 3298
20 Ga0070662_100117147 3300005457 Bacteria 2037
21 Ga0070707_100005296 3300005468 Bacteria 12074
22 Ga0070707_100148635 3300005468 Bacteria 2281
23 Ga0070699_100022206 3300005518 Bacteria 5466
24 Ga0070679_100302493 3300005530 Bacteria 1550
25 Ga0068853_100010353 3300005539 Bacteria 7544
26 Ga0068853_101443519 3300005539 Unclassified 666
27 Ga0070665_100084338 3300005548 Bacteria 3182
28 Ga0070665_100245299 3300005548 Bacteria 1792
29 Ga0070665_100418706 3300005548 Bacteria 1348
30 Ga0068855_100133139 3300005563 Bacteria 2837
31 Ga0068855_101097066 3300005563 Unclassified 832
32 Ga0070664_100182335 3300005564 Bacteria 1866
33 Ga0068854_100564901 3300005578 Bacteria 967
34 Ga0068856_100009352 3300005614 Bacteria 9518
35 Ga0068856_100035729 3300005614 Bacteria 4870
36 Ga0068856_100036938 3300005614 Bacteria 4791
37 Ga0068856_101196315 3300005614 Bacteria 776
38 Ga0068861_100446979 3300005719 Unclassified 1157
39 Ga0068862_101377176 3300005844 Unclassified 708
40 Ga0081455_10044013 3300005937 Bacteria 3900
41 Ga0070717_10021412 3300006028 Bacteria 5094
42 Ga0070717_10049261 3300006028 Bacteria 3458
43 Ga0070712_100540314 3300006175 Unclassified 981
44 Ga0097621_100310785 3300006237 Bacteria 1394
45 Ga0068871_100145108 3300006358 Bacteria 2020
46 Ga0075428_100316231 3300006844 Bacteria 1678
47 Ga0075428_101012494 3300006844 Unclassified 879
48 Ga0075431_100014086 3300006847 Bacteria 8084
49 Ga0105241_11071621 3300009174 Unclassified 757
50 Ga0105237_10113623 3300009545 Bacteria 2700
51 Ga0105238_10011237 3300009551 Bacteria 9010
52 Ga0157373_10394341 3300013100 Bacteria 991
53 Ga0157370_10141193 3300013104 Bacteria 2244
54 Ga0157370_10292721 3300013104 Bacteria 1504
55 Ga0157370_10479516 3300013104 Unclassified 1143
56 Ga0157369_10055205 3300013105 Bacteria 4288
57 Ga0157369_10862971 3300013105 Bacteria 929
58 Ga0157374_10010273 3300013296 Bacteria 8049
59 Ga0157374_10017445 3300013296 Bacteria 6321
60 Ga0157378_10227685 3300013297 Bacteria 1775
61 Ga0163162_11606354 3300013306 Unclassified 742
62 Ga0157372_10450869 3300013307 Bacteria 1499
63 Ga0157372_11894090 3300013307 Unclassified 685
64 Ga0157380_10076648 3300014326 Bacteria 2722
65 Ga0157376_10134260 3300014969 Bacteria 2213
66 Ga0157376_11318178 3300014969 Bacteria 752
67 Ga0206355_1065393 3300020076 Unclassified 849
68 Ga0213872_10000793 3300021361 Bacteria 23055
69 Ga0213874_10165404 3300021377 Bacteria 779
70 Ga0213876_10002309 3300021384 Bacteria 11252
71 Ga0213876_10027791 3300021384 Bacteria 2983
72 Ga0213876_10199360 3300021384 Unclassified 1064
73 Ga0213876_10237198 3300021384 Bacteria 969
74 Ga0213876_10269874 3300021384 Bacteria 904
75 Ga0213876_10464306 3300021384 Bacteria 673
76 Ga0213875_10000062 3300021388 Bacteria 130710
77 Ga0213875_10000196 3300021388 Bacteria 61973
78 Ga0213875_10003480 3300021388 Bacteria 8962
79 Ga0213875_10053354 3300021388 Bacteria 1893
80 Ga0213875_10096490 3300021388 Bacteria 1379
81 Ga0213875_10098207 3300021388 Bacteria 1366
82 Ga0213875_10148755 3300021388 Unclassified 1097
83 Ga0213875_10380327 3300021388 Unclassified 672
84 Ga0213871_10201154 3300021441 Bacteria 622
85 Ga0224572_1060129 3300024225 Bacteria 704
86 Ga0207647_10208582 3300025904 Bacteria 1129
87 Ga0207699_10656369 3300025906 Bacteria 766
88 Ga0207705_10282684 3300025909 Bacteria 1270
89 Ga0207654_10664213 3300025911 Unclassified 747
90 Ga0207695_10040693 3300025913 Bacteria 4980
91 Ga0207671_10344047 3300025914 Bacteria 1182
92 Ga0207693_10137722 3300025915 Bacteria 1919
93 Ga0207663_10021944 3300025916 Bacteria 3642
94 Ga0207657_10224471 3300025919 Bacteria 1504
95 Ga0207649_10394800 3300025920 Unclassified 1034
96 Ga0207652_10415352 3300025921 Bacteria 1214
97 Ga0207646_10001176 3300025922 Bacteria 33023
98 Ga0207646_10124327 3300025922 Bacteria 2319
99 Ga0207681_10014486 3300025923 Bacteria 4901
100 Ga0207694_10055481 3300025924 Bacteria 3075
101 Ga0207700_10215679 3300025928 Bacteria 1624
102 Ga0207664_10004267 3300025929 Bacteria 9673
103 Ga0207664_10104571 3300025929 Bacteria 2345
104 Ga0207664_10464764 3300025929 Bacteria 1130
105 Ga0207664_11397766 3300025929 Unclassified 620
106 Ga0207690_10019604 3300025932 Bacteria 4169
107 Ga0207690_10257805 3300025932 Bacteria 1350
108 Ga0207706_10283498 3300025933 Bacteria 1444
109 Ga0207704_10460957 3300025938 Bacteria 1016
110 Ga0207661_10661384 3300025944 Unclassified 960
111 Ga0207667_11121617 3300025949 Unclassified 769
112 Ga0207639_10008731 3300026041 Bacteria 6958
113 Ga0207678_10443406 3300026067 Bacteria 1128
114 Ga0207678_10756165 3300026067 Unclassified 857
115 Ga0207702_10008855 3300026078 Bacteria 8482
116 Ga0207702_10025205 3300026078 Bacteria 4935
117 Ga0207702_10309108 3300026078 Bacteria 1502
118 Ga0207675_101161754 3300026118 Unclassified 792
119 Ga0207683_10160600 3300026121 Bacteria 2031
120 Ga0268266_10060028 3300028379 Bacteria 3277
121 Ga0268266_10160400 3300028379 Bacteria 2034
122 Ga0268265_10552502 3300028380 Bacteria 1093
123 Ga0268265_11037118 3300028380 Unclassified 812
124 Ga0265325_10027317 3300031241 Bacteria 3085
125 Ga0265325_10081692 3300031241 Bacteria 1605
126 Ga0265313_10069326 3300031595 Bacteria 1627
127 Ga0373953_0069167 3300035117 Bacteria 1454
128 Ga0373935_0016392 3300035692 Bacteria 4483
129 Ga0373935_0029628 3300035692 Bacteria 3388
130 Ga0373935_0399249 3300035692 Bacteria 987
131 Ga0373927_0154416 3300035695 Bacteria 1503
132 Ga0373927_0340132 3300035695 Bacteria 988
133 Ga0373927_0612374 3300035695 Bacteria 720
134 Ga0373947_0076918 3300035725 Bacteria 2058
135 Ga0373947_0617354 3300035725 Bacteria 739
136 Ga0373937_0020063 3300036401 Bacteria 5988
137 Ga0373925_0087535 3300037068 Bacteria 2378
138 Ga0436364_0124008 3300037853 Bacteria 10700
139 Ga0436364_0143236 3300037853 Bacteria 13683
140 Ga0436364_0168901 3300037853 Unclassified 1147
141 Ga0436364_0278774 3300037853 Bacteria 400541
142 Ga0436364_0282669 3300037853 Unclassified 968
143 Ga0436364_0701726 3300037853 Bacteria 16000
144 Ga0436364_0833072 3300037853 Bacteria 4882
145 Ga0436364_0878418 3300037853 Bacteria 2444
146 Ga0436364_0904430 3300037853 Bacteria 3115
147 Ga0436364_1000018 3300037853 Bacteria 1605
148 Ga0436364_1051089 3300037853 Bacteria 2035
149 Ga0436364_1057142 3300037853 Bacteria 818
150 Ga0436364_1128344 3300037853 Bacteria 1512
151 Ga0436364_1184587 3300037853 Bacteria 12424
152 Ga0436364_1430661 3300037853 Bacteria 3099
153 Ga0436364_1500043 3300037853 Bacteria 6270
154 Ga0436365_0358163 3300039437 Bacteria 1310
155 Ga0436365_0974186 3300039437 Bacteria 1177
156 Ga0436365_1129027 3300039437 Bacteria 4047
157 Ga0436365_1174477 3300039437 Bacteria 1239
158 Ga0436365_1298602 3300039437 Bacteria 2581
159 Ga0436365_1466116 3300039437 Bacteria 2652
160 Ga0436365_1742949 3300039437 Bacteria 4244
161 Ga0436360_0978629 3300039438 Bacteria 10643
162 Ga0436360_1094466 3300039438 Bacteria 1768
163 Ga0436361_0391722 3300039447 Bacteria 3821
164 Ga0436361_0555745 3300039447 Bacteria 31905
165 Ga0436363_0111965 3300039450 Bacteria 1877
166 Ga0436363_0549959 3300039450 Unclassified 811
167 Ga0436363_1172081 3300039450 Bacteria 1839
168 Ga0436363_1500563 3300039450 Bacteria 2666
169 Ga0436362_0015578 3300039453 Unclassified 1219
170 Ga0436362_0357568 3300039453 Bacteria 2277
171 Ga0466963_0270367 3300044694 Bacteria 1194
172 Ga0466959_0176819 3300045049 Bacteria 1495
173 Ga0466967_0333773 3300045976 Bacteria 1465
174 Ga0495580_0312901 3300046472 Bacteria 1068
175 Ga0495580_0571345 3300046472 Bacteria 749
176 Ga0495667_0568159 3300046559 Bacteria 708
177 Ga0495674_0968853 3300047319 Unclassified 653
178 Ga0496109_0802905 3300048912 Bacteria 879
179 Ga0496112_0058046 3300048915 Bacteria 3811
180 Ga0501031_0001622 3300049568 Bacteria 14072
181 Ga0501032_0001099 3300049569 Bacteria 21613
182 Ga0501033_0037029 3300049570 Bacteria 3653
183 Ga0501034_0039284 3300049571 Bacteria 4793
184 Ga0501036_0000561 3300049572 Bacteria 26699
185 Ga0501037_0006208 3300049573 Bacteria 8737
186 Ga0501038_0021280 3300049574 Bacteria 5823
187 Ga0501039_0002798 3300049575 Bacteria 13032
188 Ga0501042_0295072 3300049578 Bacteria 1171
189 Ga0501043_0004434 3300049579 Bacteria 11403
190 Ga0501046_0005265 3300049580 Bacteria 11570
191 Ga0501047_0005108 3300049581 Bacteria 12312
192 Ga0501047_0090968 3300049581 Bacteria 2929
193 Ga0501048_0011269 3300049582 Bacteria 6668
194 Ga0501067_0002114 3300049583 Bacteria 10943
195 Ga0501068_0001839 3300049584 Bacteria 11260
196 Ga0501069_0017423 3300049585 Bacteria 3865
197 Ga0501070_0013775 3300049586 Bacteria 6809
198 Ga0501072_0001190 3300049588 Bacteria 19398
199 Ga0501073_0003700 3300049589 Bacteria 11487
200 Ga0501074_0002880 3300049590 Bacteria 12059
201 Ga0501076_0064105 3300049592 Bacteria 2928
202 Ga0501079_0000591 3300049741 Bacteria 24006
203 Ga0501080_0000011 3300049742 Bacteria 113928
204 Ga0501083_0055648 3300049744 Bacteria 2651
205 Ga0501035_0015846 3300049822 Bacteria 6955
206 Ga0501044_0006421 3300049823 Bacteria 12994
207 Ga0501044_0025552 3300049823 Bacteria 6261
208 Ga0501044_0642792 3300049823 Bacteria 950
209 nmdc:mga06r32_11200_c1 3300050510 Bacteria 8080
210 Ga0501084_0005184 3300054114 Bacteria 10658
211 Ga0501082_0055663 3300060353 Bacteria 3406
212 Ga0530510_0096099 3300061734 Bacteria 2165
213 Ga0070683_100666317
214 Ga0070682_100612944
215 Ga0070660_100307120
216 Ga0070674_100274302
217 Ga0070659_100106823
218 Ga0070659_100400210
219 Ga0070667_101081759
220 Ga0070714_100022737
221 Ga0070714_100176600
222 Ga0070714_100267983
223 Ga0070714_101141600
224 Ga0070713_100018979
225 Ga0070711_100024070
226 Ga0070700_101463692
227 Ga0070708_100138995
228 Ga0070663_100040667
229 Ga0070663_100545878
230 Ga0070678_100030897
231 Ga0070678_100040475
232 Ga0070662_100117147
233 Ga0070707_100005296
234 Ga0070707_100148635
235 Ga0070699_100022206
236 Ga0070679_100302493
237 Ga0068853_100010353
238 Ga0068853_101443519
239 Ga0070665_100084338
240 Ga0070665_100245299
241 Ga0070665_100418706
242 Ga0068855_100133139
243 Ga0068855_101097066
244 Ga0070664_100182335
245 Ga0068854_100564901
246 Ga0068856_100009352
247 Ga0068856_100035729
248 Ga0068856_100036938
249 Ga0068856_101196315
250 Ga0068861_100446979
251 Ga0068862_101377176
252 Ga0081455_10044013
253 Ga0070717_10021412
254 Ga0070717_10049261
255 Ga0070712_100540314
256 Ga0097621_100310785
257 Ga0068871_100145108
258 Ga0075428_100316231
259 Ga0075428_101012494
260 Ga0075431_100014086
261 Ga0105241_11071621
262 Ga0105237_10113623
263 Ga0105238_10011237
264 Ga0157373_10394341
265 Ga0157370_10141193
266 Ga0157370_10292721
267 Ga0157370_10479516
268 Ga0157369_10055205
269 Ga0157369_10862971
270 Ga0157374_10010273
271 Ga0157374_10017445
272 Ga0157378_10227685
273 Ga0163162_11606354
274 Ga0157372_10450869
275 Ga0157372_11894090
276 Ga0157380_10076648
277 Ga0157376_10134260
278 Ga0157376_11318178
279 Ga0206355_1065393
280 Ga0213872_10000793
281 Ga0213874_10165404
282 Ga0213876_10002309
283 Ga0213876_10027791
284 Ga0213876_10199360
285 Ga0213876_10237198
286 Ga0213876_10269874
287 Ga0213876_10464306
288 Ga0213875_10000062
289 Ga0213875_10000196
290 Ga0213875_10003480
291 Ga0213875_10053354
292 Ga0213875_10096490
293 Ga0213875_10098207
294 Ga0213875_10148755
295 Ga0213875_10380327
296 Ga0213871_10201154
297 Ga0224572_1060129
298 Ga0207647_10208582
299 Ga0207699_10656369
300 Ga0207705_10282684
301 Ga0207654_10664213
302 Ga0207695_10040693
303 Ga0207671_10344047
304 Ga0207693_10137722
305 Ga0207663_10021944
306 Ga0207657_10224471
307 Ga0207649_10394800
308 Ga0207652_10415352
309 Ga0207646_10001176
310 Ga0207646_10124327
311 Ga0207681_10014486
312 Ga0207694_10055481
313 Ga0207700_10215679
314 Ga0207664_10004267
315 Ga0207664_10104571
316 Ga0207664_10464764
317 Ga0207664_11397766
318 Ga0207690_10019604
319 Ga0207690_10257805
320 Ga0207706_10283498
321 Ga0207704_10460957
322 Ga0207661_10661384
323 Ga0207667_11121617
324 Ga0207639_10008731
325 Ga0207678_10443406
326 Ga0207678_10756165
327 Ga0207702_10008855
328 Ga0207702_10025205
329 Ga0207702_10309108
330 Ga0207675_101161754
331 Ga0207683_10160600
332 Ga0268266_10060028
333 Ga0268266_10160400
334 Ga0268265_10552502
335 Ga0268265_11037118
336 Ga0265325_10027317
337 Ga0265325_10081692
338 Ga0265313_10069326
339 Ga0373953_0069167
340 Ga0373935_0016392
341 Ga0373935_0029628
342 Ga0373935_0399249
343 Ga0373927_0154416
344 Ga0373927_0340132
345 Ga0373927_0612374
346 Ga0373947_0076918
347 Ga0373947_0617354
348 Ga0373937_0020063
349 Ga0373925_0087535
350 Ga0436364_0124008
351 Ga0436364_0143236
352 Ga0436364_0168901
353 Ga0436364_0278774
354 Ga0436364_0282669
355 Ga0436364_0701726
356 Ga0436364_0833072
357 Ga0436364_0878418
358 Ga0436364_0904430
359 Ga0436364_1000018
360 Ga0436364_1051089
361 Ga0436364_1057142
362 Ga0436364_1128344
363 Ga0436364_1184587
364 Ga0436364_1430661
365 Ga0436364_1500043
366 Ga0436365_0358163
367 Ga0436365_0974186
368 Ga0436365_1129027
369 Ga0436365_1174477
370 Ga0436365_1298602
371 Ga0436365_1466116
372 Ga0436365_1742949
373 Ga0436360_0978629
374 Ga0436360_1094466
375 Ga0436361_0391722
376 Ga0436361_0555745
377 Ga0436363_0111965
378 Ga0436363_0549959
379 Ga0436363_1172081
380 Ga0436363_1500563
381 Ga0436362_0015578
382 Ga0436362_0357568
383 Ga0466963_0270367
384 Ga0466959_0176819
385 Ga0466967_0333773
386 Ga0495580_0312901
387 Ga0495580_0571345
388 Ga0495667_0568159
389 Ga0495674_0968853
390 Ga0496109_0802905
391 Ga0496112_0058046
392 Ga0501031_0001622
393 Ga0501032_0001099
394 Ga0501033_0037029
395 Ga0501034_0039284
396 Ga0501036_0000561
397 Ga0501037_0006208
398 Ga0501038_0021280
399 Ga0501039_0002798
400 Ga0501042_0295072
401 Ga0501043_0004434
402 Ga0501046_0005265
403 Ga0501047_0005108
404 Ga0501047_0090968
405 Ga0501048_0011269
406 Ga0501067_0002114
407 Ga0501068_0001839
408 Ga0501069_0017423
409 Ga0501070_0013775
410 Ga0501072_0001190
411 Ga0501073_0003700
412 Ga0501074_0002880
413 Ga0501076_0064105
414 Ga0501079_0000591
415 Ga0501080_0000011
416 Ga0501083_0055648
417 Ga0501035_0015846
418 Ga0501044_0006421
419 Ga0501044_0025552
420 Ga0501044_0642792
421 nmdc:mga06r32_11200_c1
422 Ga0501084_0005184
423 Ga0501082_0055663
424 Ga0530510_0096099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00466

Ribosomal_L10

Ribosomal protein L10

2

100

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ug7-assembly1.cif.gz_LJ 70s ribosome complex in an intermediate state of translocation bound to ef-g(gdp) stalled by argyrin b 0.9241 3 128
7as8-assembly1.cif.gz_L bacillus subtilis ribosome quality control complex state b. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.9204 7 126
8phj-assembly1.cif.gz_5 ca4-bound cami1 in complex with 70s ribosome 0.9113 1 129
5zeb-assembly1.cif.gz_I m. smegmatis p/p state 70s ribosome structure 0.9101 2 128
5gad-assembly1.cif.gz_I rnc-srp-sr complex early state 0.9074 1 124
ID Description Score Start End Superfamily
af_Q9VPL3_26_196_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.896 1 128 3.30.70.1730
af_Q8I1U9_104_236_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8887 2 128 3.30.70.1730
af_Q9FY50_43_174_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8796 2 131 3.30.70.1730
af_Q21083_19_191_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.8735 7 128 3.30.70.1730
af_P36521_47_187_3.30.70.1730 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein L10, N-terminal RNA-binding domain 0.863 7 128 3.30.70.1730
ID Description Score Start End GO Terms
AF-A0A7Z9WDZ0-F1-model_v4 50S ribosomal protein L10 0.9507 2 126 GO:0003735
GO:0006412
GO:0015934
AF-A0A7Z9WDZ0-F1-model_v4 50S ribosomal protein L10 0.9434 2 126 GO:0003735
GO:0006412
GO:0015934
AF-A0A1G3CHG3-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9404 7 126 GO:0005840
GO:1990904
AF-A0A7W0R1I4-F1-model_v4 Large ribosomal subunit protein uL10 (50S ribosomal protein L10) 0.9387 7 131 GO:0005840
GO:1990904
AF-A0A378BFA1-F1-model_v4 Large ribosomal subunit protein uL10 0.9348 1 131 GO:0003735
GO:0006412
GO:0015934
GO:0070180

Map