F322055
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 211 | 160 | 108 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0155582|Ga0496126_0155582_150_1223 |
| Length | 357 |
| Sequence | MNLPLCVIATPGLTRSAFAVVLLSGSILAGCATPQKPPQISYDDDVPPLPAAPAAALDERPKPLHVPPGWVATRGGVAGSTPVARVENANAAARVQPRREGYYNAIQIYPWSEGALYQVYAAPGQITDIALEPGESLTGEGPIAAGDTARWIIGDTESGAGVARRVHVLVKPSRSDINTNLVITTDRRSYMIELRSGEKPYMPAVSWSYPAPPAGQARAIPSTPVIPAITARNYRYGLAGDAPPWRPVSVYDDGRRVYVEFPRGIVQGEMPPIFVIGPDGGAEIANSRVYQNTLIVDRLFGAAELRLGSGKRQQKEIMSTTISAFSARTFSPNVPAFSSVSRSITTGSTDFHAAFSV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 3 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 4 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 5 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 6 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 7 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 8 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 9 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 10 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 11 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 12 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 13 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 14 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 15 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 16 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 17 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 18 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 19 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 20 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 21 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 22 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 23 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 24 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 25 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 26 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 27 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 28 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 29 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 30 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 31 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 32 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 33 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 34 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 35 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 36 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 37 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 38 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 39 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 40 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 41 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 42 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 43 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 44 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 45 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 46 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 47 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 48 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 49 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 50 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 51 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 52 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 53 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 54 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 55 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 56 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 57 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 58 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 59 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 60 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 61 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 62 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 63 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 64 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 65 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 66 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 67 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 68 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 69 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 70 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 71 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 72 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 73 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 74 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 75 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 76 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 77 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 78 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 79 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 80 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 81 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 82 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 83 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 84 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 85 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 86 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 87 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 88 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 89 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 90 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 91 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 92 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 93 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 94 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 95 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 96 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 97 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 98 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 99 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 100 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 101 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 102 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 103 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 106 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 107 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 108 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 120 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 121 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 123 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 124 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 125 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 126 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 127 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 133 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 134 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 135 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 136 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 137 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 144 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 148 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 151 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 152 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 153 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 154 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 155 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 156 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 157 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 159 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 160 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 51.18 |
| Metatranscriptomes | 0 |
| Isolates | 48.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.47 |
| Bulb | 0 |
| Endosphere | 7.11 |
| Nodule | 35.55 |
| Rhizoplane | 1.9 |
| Rhizosphere | 43.6 |
| Stem | 0 |
| Stem Tuber | 0.47 |
| Unclassified | 10.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10000793 | 3300001990 | Bacteria | 11195 |
| 2 | JGI24735J21928_10014034 | 3300002067 | Bacteria | 2512 |
| 3 | JGI25165J46597_1000078 | 3300003214 | Bacteria | 179320 |
| 4 | rootL2_10176035 | 3300003322 | Bacteria | 8331 |
| 5 | Ga0055542_1000557 | 3300003762 | Bacteria | 32931 |
| 6 | Ga0068853_100482606 | 3300005539 | Bacteria | 1168 |
| 7 | Ga0075364_10008734 | 3300006051 | Bacteria | 6061 |
| 8 | Ga0075364_10101446 | 3300006051 | Bacteria | 1916 |
| 9 | Ga0075362_10021391 | 3300006177 | Bacteria | 2713 |
| 10 | Ga0075369_10041102 | 3300006186 | Bacteria | 1979 |
| 11 | Ga0099823_1000747 | 3300006944 | Bacteria | 23809 |
| 12 | Ga0099826_10000025 | 3300006948 | Bacteria | 146840 |
| 13 | Ga0105241_10440484 | 3300009174 | Bacteria | 1151 |
| 14 | Ga0105239_10121961 | 3300010375 | Bacteria | 2896 |
| 15 | Ga0105239_10133561 | 3300010375 | Bacteria | 2762 |
| 16 | Ga0157370_10311339 | 3300013104 | Bacteria | 1453 |
| 17 | Ga0213872_10000276 | 3300021361 | Bacteria | 43790 |
| 18 | Ga0209148_1000126 | 3300025254 | Bacteria | 181590 |
| 19 | Ga0209233_1008595 | 3300025261 | Bacteria | 3147 |
| 20 | Ga0209455_1002586 | 3300025272 | Bacteria | 6891 |
| 21 | Ga0207671_10004536 | 3300025914 | Bacteria | 13193 |
| 22 | Ga0207657_10088083 | 3300025919 | Bacteria | 2596 |
| 23 | Ga0207698_10115107 | 3300026142 | Bacteria | 2263 |
| 24 | Ga0209389_1024218 | 3300027296 | Bacteria | 5330 |
| 25 | Ga0209282_1000685 | 3300027666 | Bacteria | 16831 |
| 26 | Ga0265339_10002251 | 3300031249 | Bacteria | 13948 |
| 27 | Ga0395899_0000014 | 3300037312 | Bacteria | 488813 |
| 28 | Ga0395899_0000107 | 3300037312 | Bacteria | 144087 |
| 29 | Ga0395900_0000007 | 3300037418 | Bacteria | 488860 |
| 30 | Ga0395900_0000101 | 3300037418 | Bacteria | 153550 |
| 31 | Ga0395898_0000011 | 3300037466 | Bacteria | 488860 |
| 32 | Ga0395898_0000043 | 3300037466 | Bacteria | 301783 |
| 33 | Ga0395905_0000008 | 3300037471 | Bacteria | 488860 |
| 34 | Ga0395905_0000101 | 3300037471 | Bacteria | 144115 |
| 35 | Ga0395901_0000020 | 3300038443 | Bacteria | 314918 |
| 36 | Ga0395901_0000068 | 3300038443 | Bacteria | 144095 |
| 37 | Ga0436361_0526559 | 3300039447 | Bacteria | 60778 |
| 38 | Ga0466960_0020643 | 3300044901 | Bacteria | 2921 |
| 39 | Ga0451576_0290177 | 3300045051 | Bacteria | 1710 |
| 40 | Ga0495643_0000042 | 3300046522 | Bacteria | 229665 |
| 41 | Ga0496104_0296502 | 3300048907 | Bacteria | 1529 |
| 42 | Ga0496116_0038673 | 3300048919 | Bacteria | 3309 |
| 43 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 44 | Ga0496125_0157335 | 3300048928 | Bacteria | 1550 |
| 45 | Ga0496125_0162768 | 3300048928 | Bacteria | 1513 |
| 46 | Ga0496126_0000343 | 3300048929 | Bacteria | 97986 |
| 47 | Ga0496126_0133744 | 3300048929 | Bacteria | 2141 |
| 48 | Ga0496126_0155582 | 3300048929 | Bacteria | 1957 |
| 49 | Ga0501031_0006184 | 3300049568 | Bacteria | 7816 |
| 50 | Ga0501031_0272971 | 3300049568 | Bacteria | 1098 |
| 51 | Ga0501032_0000059 | 3300049569 | Bacteria | 96399 |
| 52 | Ga0501032_0000653 | 3300049569 | Bacteria | 28159 |
| 53 | Ga0501032_0000928 | 3300049569 | Bacteria | 23702 |
| 54 | Ga0501033_0000048 | 3300049570 | Bacteria | 120958 |
| 55 | Ga0501033_0000284 | 3300049570 | Bacteria | 48783 |
| 56 | Ga0501033_0016370 | 3300049570 | Bacteria | 5615 |
| 57 | Ga0501033_0028521 | 3300049570 | Bacteria | 4193 |
| 58 | Ga0501033_0413825 | 3300049570 | Bacteria | 939 |
| 59 | Ga0501034_0000094 | 3300049571 | Bacteria | 163124 |
| 60 | Ga0501034_0000662 | 3300049571 | Bacteria | 52559 |
| 61 | Ga0501034_0000775 | 3300049571 | Bacteria | 47800 |
| 62 | Ga0501034_0027352 | 3300049571 | Bacteria | 5800 |
| 63 | Ga0501034_0030780 | 3300049571 | Bacteria | 5454 |
| 64 | Ga0501034_0097215 | 3300049571 | Bacteria | 2940 |
| 65 | Ga0501034_0155346 | 3300049571 | Bacteria | 2262 |
| 66 | Ga0501034_0209519 | 3300049571 | Bacteria | 1905 |
| 67 | Ga0501036_0000207 | 3300049572 | Bacteria | 39247 |
| 68 | Ga0501036_0001352 | 3300049572 | Bacteria | 18796 |
| 69 | Ga0501037_0000057 | 3300049573 | Bacteria | 107920 |
| 70 | Ga0501037_0000197 | 3300049573 | Bacteria | 54709 |
| 71 | Ga0501037_0047568 | 3300049573 | Bacteria | 3143 |
| 72 | Ga0501037_0136511 | 3300049573 | Bacteria | 1757 |
| 73 | Ga0501038_0000218 | 3300049574 | Bacteria | 49144 |
| 74 | Ga0501038_0000971 | 3300049574 | Bacteria | 25712 |
| 75 | Ga0501038_0003533 | 3300049574 | Bacteria | 14553 |
| 76 | Ga0501038_0121533 | 3300049574 | Bacteria | 2153 |
| 77 | Ga0501038_0249242 | 3300049574 | Bacteria | 1407 |
| 78 | Ga0501039_0000010 | 3300049575 | Bacteria | 247832 |
| 79 | Ga0501039_0013077 | 3300049575 | Bacteria | 6346 |
| 80 | Ga0501043_0000040 | 3300049579 | Bacteria | 117024 |
| 81 | Ga0501043_0000611 | 3300049579 | Bacteria | 31659 |
| 82 | Ga0501043_0152185 | 3300049579 | Bacteria | 1810 |
| 83 | Ga0501046_0010804 | 3300049580 | Bacteria | 7827 |
| 84 | Ga0501046_0014899 | 3300049580 | Bacteria | 6542 |
| 85 | Ga0501047_0000747 | 3300049581 | Bacteria | 33899 |
| 86 | Ga0501047_0042102 | 3300049581 | Bacteria | 4414 |
| 87 | Ga0501047_0051178 | 3300049581 | Bacteria | 3990 |
| 88 | Ga0501047_0216429 | 3300049581 | Bacteria | 1772 |
| 89 | Ga0501070_0024606 | 3300049586 | Bacteria | 5049 |
| 90 | Ga0501070_0142479 | 3300049586 | Bacteria | 1979 |
| 91 | Ga0501070_0177303 | 3300049586 | Bacteria | 1754 |
| 92 | Ga0501077_0010601 | 3300049593 | Bacteria | 5740 |
| 93 | Ga0501083_0070784 | 3300049744 | Bacteria | 2319 |
| 94 | Ga0501035_0000076 | 3300049822 | Bacteria | 121548 |
| 95 | Ga0501035_0000353 | 3300049822 | Bacteria | 52827 |
| 96 | Ga0501035_0036793 | 3300049822 | Bacteria | 4435 |
| 97 | Ga0501044_0000075 | 3300049823 | Bacteria | 120819 |
| 98 | Ga0501044_0002058 | 3300049823 | Bacteria | 23194 |
| 99 | Ga0501044_0102422 | 3300049823 | Bacteria | 2879 |
| 100 | Ga0501044_0280530 | 3300049823 | Bacteria | 1600 |
| 101 | Ga0501044_0292408 | 3300049823 | Bacteria | 1560 |
| 102 | nmdc:mga03683_21662_c1 | 3300050489 | Bacteria | 2482 |
| 103 | nmdc:mga00v17_105242_c1 | 3300050491 | Bacteria | 1785 |
| 104 | nmdc:mga0yw44_61074_c1 | 3300050492 | Bacteria | 2311 |
| 105 | nmdc:mga0yw44_6579_c1 | 3300050492 | Bacteria | 5628 |
| 106 | nmdc:mga06z11_46317_c1 | 3300050494 | Bacteria | 2203 |
| 107 | nmdc:mga0sz30_84132_c1 | 3300050516 | Bacteria | 1379 |
| 108 | Ga0501082_0104405 | 3300060353 | Bacteria | 2451 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048929 | Ga0496126_0133744 | Ga0496126_0133744_82_945 | 249 |
| 2 | 3300021361 | Ga0213872_10000276 | Ga0213872_1000027637 | 267 |
| 3 | 3300039447 | Ga0436361_0526559 | Ga0436361_0526559_47688_48680 | 267 |
| 4 | 3300006944 | Ga0099823_1000747 | Ga0099823_100074720 | 268 |
| 5 | 3300027296 | Ga0209389_1024218 | Ga0209389_10242184 | 268 |
| 6 | 3300049579 | Ga0501043_0152185 | Ga0501043_0152185_881_1780 | 274 |
| 7 | 3300049570 | Ga0501033_0016370 | Ga0501033_0016370_577_1476 | 275 |
| 8 | 3300049822 | Ga0501035_0036793 | Ga0501035_0036793_2180_3079 | 275 |
| 9 | 3300049571 | Ga0501034_0209519 | Ga0501034_0209519_648_1553 | 276 |
| 10 | 3300049593 | Ga0501077_0010601 | Ga0501077_0010601_757_1743 | 278 |
| 11 | 3300049744 | Ga0501083_0070784 | Ga0501083_0070784_1139_2125 | 278 |
| 12 | 3300060353 | Ga0501082_0104405 | Ga0501082_0104405_239_1225 | 278 |
| 13 | 3300049570 | Ga0501033_0413825 | Ga0501033_0413825_14_928 | 280 |
| 14 | 3300045051 | Ga0451576_0290177 | Ga0451576_0290177_448_1368 | 281 |
| 15 | 3300049823 | Ga0501044_0102422 | Ga0501044_0102422_1514_2434 | 281 |
| 16 | 3300049574 | Ga0501038_0121533 | Ga0501038_0121533_310_1236 | 282 |
| 17 | 3300049573 | Ga0501037_0136511 | Ga0501037_0136511_348_1280 | 284 |
| 18 | 3300037312 | Ga0395899_0000107 | Ga0395899_0000107_117288_118301 | 285 |
| 19 | 3300037418 | Ga0395900_0000101 | Ga0395900_0000101_25787_26800 | 285 |
| 20 | 3300037466 | Ga0395898_0000043 | Ga0395898_0000043_117316_118329 | 285 |
| 21 | 3300037471 | Ga0395905_0000101 | Ga0395905_0000101_117316_118329 | 285 |
| 22 | 3300038443 | Ga0395901_0000068 | Ga0395901_0000068_117316_118329 | 285 |
| 23 | iso_pu_bacteria | 2643221623 | 2644129045 | 285 |
| 24 | iso_pu_bacteria | 2881853255 | 2881856923 | 285 |
| 25 | iso_pu_bacteria | 2961127735 | 2961129780 | 285 |
| 26 | 3300006051 | Ga0075364_10008734 | Ga0075364_100087347 | 286 |
| 27 | 3300006186 | Ga0075369_10041102 | Ga0075369_100411022 | 286 |
| 28 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_751102_752058 | 286 |
| 29 | 3300049570 | Ga0501033_0028521 | Ga0501033_0028521_2039_3013 | 286 |
| 30 | 3300049571 | Ga0501034_0000775 | Ga0501034_0000775_6987_7955 | 286 |
| 31 | iso_pu_bacteria | 2582581304 | 2585259402 | 286 |
| 32 | iso_pu_bacteria | 2615840698 | 2616556364 | 286 |
| 33 | iso_pu_bacteria | 2773857925 | 2774872007 | 286 |
| 34 | iso_pu_bacteria | 2775507049 | 2776913398 | 286 |
| 35 | iso_pu_bacteria | 2854896431 | 2854900724 | 286 |
| 36 | iso_pu_bacteria | 2882456835 | 2882460964 | 286 |
| 37 | iso_pu_bacteria | 2883354860 | 2883358117 | 286 |
| 38 | iso_pu_bacteria | 2960637947 | 2960638931 | 286 |
| 39 | iso_pu_bacteria | 2964628898 | 2964634273 | 286 |
| 40 | iso_pu_bacteria | 2964719344 | 2964720332 | 286 |
| 41 | iso_pu_bacteria | 2984601300 | 2984603950 | 286 |
| 42 | 3300049568 | Ga0501031_0272971 | Ga0501031_0272971_19_1035 | 287 |
| 43 | 3300049571 | Ga0501034_0097215 | Ga0501034_0097215_763_1779 | 287 |
| 44 | 3300049573 | Ga0501037_0047568 | Ga0501037_0047568_960_1940 | 287 |
| 45 | 3300049574 | Ga0501038_0003533 | Ga0501038_0003533_10422_11402 | 287 |
| 46 | 3300049574 | Ga0501038_0249242 | Ga0501038_0249242_51_1028 | 287 |
| 47 | 3300049575 | Ga0501039_0013077 | Ga0501039_0013077_3733_4713 | 287 |
| 48 | 3300049581 | Ga0501047_0042102 | Ga0501047_0042102_2642_3622 | 287 |
| 49 | 3300049581 | Ga0501047_0216429 | Ga0501047_0216429_384_1361 | 287 |
| 50 | 3300049586 | Ga0501070_0177303 | Ga0501070_0177303_551_1567 | 287 |
| 51 | iso_pu_bacteria | 2513237351 | 2514590840 | 287 |
| 52 | iso_pu_bacteria | 2599185301 | 2599936037 | 287 |
| 53 | iso_pu_bacteria | 2643221674 | 2644413967 | 287 |
| 54 | iso_pu_bacteria | 2693429783 | 2694629603 | 287 |
| 55 | iso_pu_bacteria | 2693429784 | 2694640200 | 287 |
| 56 | iso_pu_bacteria | 2758568016 | 2758642701 | 287 |
| 57 | iso_pu_bacteria | 2924754689 | 2924757778 | 287 |
| 58 | iso_pu_bacteria | 2928521798 | 2928521851 | 287 |
| 59 | iso_pu_bacteria | 8004395343 | 8004395699 | 287 |
| 60 | iso_pu_bacteria | 8004395343 | 8004396081 | 287 |
| 61 | iso_pu_bacteria | 8045864390 | 8045869176 | 287 |
| 62 | 3300006948 | Ga0099826_10000025 | Ga0099826_1000002595 | 288 |
| 63 | 3300027666 | Ga0209282_1000685 | Ga0209282_100068512 | 288 |
| 64 | 3300031249 | Ga0265339_10002251 | Ga0265339_1000225114 | 288 |
| 65 | 3300049569 | Ga0501032_0000653 | Ga0501032_0000653_23722_24738 | 288 |
| 66 | 3300049569 | Ga0501032_0000928 | Ga0501032_0000928_2960_3943 | 288 |
| 67 | 3300049570 | Ga0501033_0000284 | Ga0501033_0000284_25403_26419 | 288 |
| 68 | 3300049571 | Ga0501034_0000094 | Ga0501034_0000094_101990_103006 | 288 |
| 69 | 3300049572 | Ga0501036_0001352 | Ga0501036_0001352_15921_16937 | 288 |
| 70 | 3300049573 | Ga0501037_0000057 | Ga0501037_0000057_9394_10410 | 288 |
| 71 | 3300049574 | Ga0501038_0000218 | Ga0501038_0000218_3422_4438 | 288 |
| 72 | 3300049575 | Ga0501039_0000010 | Ga0501039_0000010_23710_24726 | 288 |
| 73 | 3300049579 | Ga0501043_0000040 | Ga0501043_0000040_112459_113475 | 288 |
| 74 | 3300049580 | Ga0501046_0014899 | Ga0501046_0014899_1466_2482 | 288 |
| 75 | 3300049581 | Ga0501047_0051178 | Ga0501047_0051178_643_1659 | 288 |
| 76 | 3300049822 | Ga0501035_0000353 | Ga0501035_0000353_28068_29084 | 288 |
| 77 | iso_pu_bacteria | 2856342000 | 2856346066 | 288 |
| 78 | iso_pu_bacteria | 2968117919 | 2968120031 | 288 |
| 79 | 3300003762 | Ga0055542_1000557 | Ga0055542_100055726 | 289 |
| 80 | 3300005539 | Ga0068853_100482606 | Ga0068853_1004826061 | 289 |
| 81 | 3300010375 | Ga0105239_10121961 | Ga0105239_101219612 | 289 |
| 82 | 3300013104 | Ga0157370_10311339 | Ga0157370_103113392 | 289 |
| 83 | 3300025254 | Ga0209148_1000126 | Ga0209148_1000126100 | 289 |
| 84 | 3300025261 | Ga0209233_1008595 | Ga0209233_10085954 | 289 |
| 85 | 3300025272 | Ga0209455_1002586 | Ga0209455_10025866 | 289 |
| 86 | 3300025919 | Ga0207657_10088083 | Ga0207657_100880831 | 289 |
| 87 | 3300026142 | Ga0207698_10115107 | Ga0207698_101151072 | 289 |
| 88 | 3300037312 | Ga0395899_0000014 | Ga0395899_0000014_477374_478363 | 289 |
| 89 | 3300037418 | Ga0395900_0000007 | Ga0395900_0000007_477393_478382 | 289 |
| 90 | 3300037466 | Ga0395898_0000011 | Ga0395898_0000011_10479_11468 | 289 |
| 91 | 3300037471 | Ga0395905_0000008 | Ga0395905_0000008_477393_478382 | 289 |
| 92 | 3300038443 | Ga0395901_0000020 | Ga0395901_0000020_303451_304440 | 289 |
| 93 | 3300048928 | Ga0496125_0162768 | Ga0496125_0162768_251_1303 | 289 |
| 94 | 3300050492 | nmdc:mga0yw44_6579_c1 | nmdc:mga0yw44_6579_c1_2912_3964 | 289 |
| 95 | 3300050494 | nmdc:mga06z11_46317_c1 | nmdc:mga06z11_46317_c1_450_1502 | 289 |
| 96 | iso_pu_bacteria | 2503198000 | 2503200878 | 289 |
| 97 | iso_pu_bacteria | 2512875024 | 2512963716 | 289 |
| 98 | iso_pu_bacteria | 2513237090 | 2513608240 | 289 |
| 99 | iso_pu_bacteria | 2600255279 | 2601611351 | 289 |
| 100 | iso_pu_bacteria | 2600255308 | 2601748228 | 289 |
| 101 | iso_pu_bacteria | 2757320392 | 2757572199 | 289 |
| 102 | iso_pu_bacteria | 2757320392 | 2757572616 | 289 |
| 103 | iso_pu_bacteria | 2842357229 | 2842362960 | 289 |
| 104 | iso_pu_bacteria | 2857349434 | 2857355775 | 289 |
| 105 | iso_pu_bacteria | 2871488783 | 2871491804 | 289 |
| 106 | iso_pu_bacteria | 2871495908 | 2871500986 | 289 |
| 107 | iso_pu_bacteria | 2874102143 | 2874105659 | 289 |
| 108 | iso_pu_bacteria | 2874139085 | 2874139690 | 289 |
| 109 | iso_pu_bacteria | 2874168670 | 2874171277 | 289 |
| 110 | iso_pu_bacteria | 2878738818 | 2878739519 | 289 |
| 111 | iso_pu_bacteria | 2878753008 | 2878755966 | 289 |
| 112 | iso_pu_bacteria | 2878760144 | 2878765023 | 289 |
| 113 | iso_pu_bacteria | 2878767105 | 2878772175 | 289 |
| 114 | iso_pu_bacteria | 2881147464 | 2881153907 | 289 |
| 115 | iso_pu_bacteria | 2881161766 | 2881163649 | 289 |
| 116 | iso_pu_bacteria | 2881861095 | 2881865614 | 289 |
| 117 | iso_pu_bacteria | 2882912400 | 2882912794 | 289 |
| 118 | iso_pu_bacteria | 2885305155 | 2885311913 | 289 |
| 119 | iso_pu_bacteria | 2885318864 | 2885323116 | 289 |
| 120 | iso_pu_bacteria | 2885334103 | 2885338175 | 289 |
| 121 | iso_pu_bacteria | 2888337043 | 2888341669 | 289 |
| 122 | iso_pu_bacteria | 2889010040 | 2889011756 | 289 |
| 123 | iso_pu_bacteria | 2889914905 | 2889919627 | 289 |
| 124 | iso_pu_bacteria | 2903492973 | 2903501434 | 289 |
| 125 | iso_pu_bacteria | 2903540706 | 2903545803 | 289 |
| 126 | iso_pu_bacteria | 2915650412 | 2915652101 | 289 |
| 127 | iso_pu_bacteria | 2924776078 | 2924777043 | 289 |
| 128 | iso_pu_bacteria | 2924784321 | 2924791066 | 289 |
| 129 | iso_pu_bacteria | 2937848649 | 2937852668 | 289 |
| 130 | iso_pu_bacteria | 2937877337 | 2937880347 | 289 |
| 131 | iso_pu_bacteria | 2937972304 | 2937976449 | 289 |
| 132 | iso_pu_bacteria | 2937994558 | 2937999653 | 289 |
| 133 | iso_pu_bacteria | 2958034702 | 2958038609 | 289 |
| 134 | iso_pu_bacteria | 2958084443 | 2958087483 | 289 |
| 135 | iso_pu_bacteria | 2958092219 | 2958096622 | 289 |
| 136 | iso_pu_bacteria | 2958144490 | 2958145284 | 289 |
| 137 | iso_pu_bacteria | 2958165035 | 2958170124 | 289 |
| 138 | iso_pu_bacteria | 2961163497 | 2961168578 | 289 |
| 139 | iso_pu_bacteria | 2961170736 | 2961174015 | 289 |
| 140 | iso_pu_bacteria | 2965018300 | 2965023399 | 289 |
| 141 | iso_pu_bacteria | 2965062239 | 2965064371 | 289 |
| 142 | iso_pu_bacteria | 2968003550 | 2968005577 | 289 |
| 143 | iso_pu_bacteria | 2968016561 | 2968023790 | 289 |
| 144 | iso_pu_bacteria | 2968171901 | 2968176989 | 289 |
| 145 | iso_pu_bacteria | 2970469710 | 2970469831 | 289 |
| 146 | iso_pu_bacteria | 2970503327 | 2970506605 | 289 |
| 147 | iso_pu_bacteria | 2970554993 | 2970559871 | 289 |
| 148 | iso_pu_bacteria | 2977821940 | 2977825189 | 289 |
| 149 | iso_pu_bacteria | 2977828996 | 2977833827 | 289 |
| 150 | iso_pu_bacteria | 2977864932 | 2977868639 | 289 |
| 151 | iso_pu_bacteria | 2977922695 | 2977925226 | 289 |
| 152 | iso_pu_bacteria | 2977942078 | 2977944440 | 289 |
| 153 | iso_pu_bacteria | 2979808191 | 2979811251 | 289 |
| 154 | iso_pu_bacteria | 2987636660 | 2987640909 | 289 |
| 155 | iso_pu_bacteria | 2987652177 | 2987653079 | 289 |
| 156 | iso_pu_bacteria | 2987659509 | 2987664605 | 289 |
| 157 | iso_pu_bacteria | 2996348954 | 2996355101 | 289 |
| 158 | iso_pu_bacteria | 3000135777 | 3000142187 | 289 |
| 159 | iso_pu_bacteria | 3004188549 | 3004193657 | 289 |
| 160 | iso_pu_bacteria | 3004203850 | 3004209106 | 289 |
| 161 | iso_pu_bacteria | 3004211236 | 3004212489 | 289 |
| 162 | iso_pu_bacteria | 3004218560 | 3004224156 | 289 |
| 163 | iso_pu_bacteria | 3004275668 | 3004281635 | 289 |
| 164 | iso_pu_bacteria | 8004374579 | 8004377556 | 289 |
| 165 | 3300006177 | Ga0075362_10021391 | Ga0075362_100213913 | 290 |
| 166 | 3300009174 | Ga0105241_10440484 | Ga0105241_104404841 | 290 |
| 167 | 3300010375 | Ga0105239_10133561 | Ga0105239_101335613 | 290 |
| 168 | 3300025914 | Ga0207671_10004536 | Ga0207671_100045366 | 290 |
| 169 | 3300044901 | Ga0466960_0020643 | Ga0466960_0020643_1096_2097 | 290 |
| 170 | 3300048919 | Ga0496116_0038673 | Ga0496116_0038673_1638_2636 | 290 |
| 171 | 3300048928 | Ga0496125_0157335 | Ga0496125_0157335_16_1014 | 290 |
| 172 | 3300048929 | Ga0496126_0000343 | Ga0496126_0000343_84989_85990 | 290 |
| 173 | 3300049571 | Ga0501034_0030780 | Ga0501034_0030780_2397_3419 | 290 |
| 174 | 3300049571 | Ga0501034_0155346 | Ga0501034_0155346_629_1654 | 290 |
| 175 | 3300049823 | Ga0501044_0292408 | Ga0501044_0292408_353_1342 | 290 |
| 176 | 3300050489 | nmdc:mga03683_21662_c1 | nmdc:mga03683_21662_c1_891_1946 | 290 |
| 177 | 3300050492 | nmdc:mga0yw44_61074_c1 | nmdc:mga0yw44_61074_c1_835_1887 | 290 |
| 178 | 3300050516 | nmdc:mga0sz30_84132_c1 | nmdc:mga0sz30_84132_c1_92_1147 | 290 |
| 179 | iso_pu_bacteria | 2854911287 | 2854912832 | 290 |
| 180 | iso_pu_bacteria | 2854911287 | 2854913260 | 290 |
| 181 | iso_pu_bacteria | 2855020534 | 2855022173 | 290 |
| 182 | 3300003322 | rootL2_10176035 | rootL2_101760358 | 291 |
| 183 | 3300006051 | Ga0075364_10101446 | Ga0075364_101014461 | 291 |
| 184 | 3300046522 | Ga0495643_0000042 | Ga0495643_0000042_96708_97724 | 291 |
| 185 | 3300048907 | Ga0496104_0296502 | Ga0496104_0296502_406_1422 | 291 |
| 186 | 3300049568 | Ga0501031_0006184 | Ga0501031_0006184_2142_3155 | 291 |
| 187 | 3300049569 | Ga0501032_0000059 | Ga0501032_0000059_11111_12124 | 291 |
| 188 | 3300049570 | Ga0501033_0000048 | Ga0501033_0000048_91040_92053 | 291 |
| 189 | 3300049571 | Ga0501034_0000662 | Ga0501034_0000662_22734_23747 | 291 |
| 190 | 3300049571 | Ga0501034_0027352 | Ga0501034_0027352_2465_3481 | 291 |
| 191 | 3300049572 | Ga0501036_0000207 | Ga0501036_0000207_9459_10472 | 291 |
| 192 | 3300049573 | Ga0501037_0000197 | Ga0501037_0000197_45288_46301 | 291 |
| 193 | 3300049574 | Ga0501038_0000971 | Ga0501038_0000971_8841_9854 | 291 |
| 194 | 3300049579 | Ga0501043_0000611 | Ga0501043_0000611_29071_30084 | 291 |
| 195 | 3300049580 | Ga0501046_0010804 | Ga0501046_0010804_474_1487 | 291 |
| 196 | 3300049581 | Ga0501047_0000747 | Ga0501047_0000747_24949_25962 | 291 |
| 197 | 3300049586 | Ga0501070_0024606 | Ga0501070_0024606_3698_4711 | 291 |
| 198 | 3300049822 | Ga0501035_0000076 | Ga0501035_0000076_91040_92053 | 291 |
| 199 | 3300049823 | Ga0501044_0000075 | Ga0501044_0000075_91013_92026 | 291 |
| 200 | 3300050491 | nmdc:mga00v17_105242_c1 | nmdc:mga00v17_105242_c1_14_1027 | 291 |
| 201 | 3300048929 | Ga0496126_0155582 | Ga0496126_0155582_150_1223 | 292 |
| 202 | 3300003214 | JGI25165J46597_1000078 | JGI25165J46597_100007843 | 301 |
| 203 | 3300049823 | Ga0501044_0280530 | Ga0501044_0280530_361_1434 | 301 |
| 204 | 3300049586 | Ga0501070_0142479 | Ga0501070_0142479_919_1911 | 305 |
| 205 | 3300049823 | Ga0501044_0002058 | Ga0501044_0002058_4429_5415 | 305 |
| 206 | iso_pu_bacteria | 2808606401 | 2809063760 | 306 |
| 207 | iso_pu_bacteria | 2808606404 | 2809079622 | 306 |
| 208 | iso_pu_bacteria | 2808606405 | 2809083987 | 306 |
| 209 | iso_pu_bacteria | 2880518877 | 2880519310 | 306 |
| 210 | 3300001990 | JGI24737J22298_10000793 | JGI24737J22298_100007932 | 310 |
| 211 | 3300002067 | JGI24735J21928_10014034 | JGI24735J21928_100140343 | 310 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar