F322055

General Info

Members Datasets Scaffolds Average Seq Length
211 160 108 335

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0155582|Ga0496126_0155582_150_1223
Length 357
Sequence MNLPLCVIATPGLTRSAFAVVLLSGSILAGCATPQKPPQISYDDDVPPLPAAPAAALDERPKPLHVPPGWVATRGGVAGSTPVARVENANAAARVQPRREGYYNAIQIYPWSEGALYQVYAAPGQITDIALEPGESLTGEGPIAAGDTARWIIGDTESGAGVARRVHVLVKPSRSDINTNLVITTDRRSYMIELRSGEKPYMPAVSWSYPAPPAGQARAIPSTPVIPAITARNYRYGLAGDAPPWRPVSVYDDGRRVYVEFPRGIVQGEMPPIFVIGPDGGAEIANSRVYQNTLIVDRLFGAAELRLGSGKRQQKEIMSTTISAFSARTFSPNVPAFSSVSRSITTGSTDFHAAFSV

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2512875024 Mesorhizobium loti R88b Isolate Nodule
3 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
4 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
5 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
6 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
7 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
8 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
9 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
10 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
11 2643221674 Devosia sp. Root436 Isolate Unclassified
12 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
13 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
14 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
15 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
16 2773857925 Microvirga vignae BR3299 Isolate Unclassified
17 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
18 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
19 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
20 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
21 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
22 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
23 2854911287 Brucella lupini LUP21 Isolate Unclassified
24 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
25 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
26 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
27 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
28 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
29 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
30 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
31 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
32 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
33 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
34 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
35 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
36 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
37 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
38 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
39 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
40 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
41 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
42 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
43 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
44 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
45 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
46 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
47 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
48 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
49 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
50 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
51 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
52 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
53 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
54 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
55 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
56 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
57 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
58 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
59 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
60 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
61 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
62 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
63 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
64 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
65 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
66 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
67 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
68 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
69 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
70 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
71 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
72 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
73 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
74 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
75 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
76 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
77 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
78 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
79 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
80 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
81 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
82 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
83 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
84 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
85 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
86 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
87 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
88 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
89 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
90 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
91 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
92 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
93 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
94 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
95 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
96 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
97 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
98 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
99 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
100 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
101 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
102 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
103 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
106 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
107 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
108 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
120 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
153 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
154 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
155 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
158 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
159 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
160 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 51.18
Metatranscriptomes 0
Isolates 48.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 7.11
Nodule 35.55
Rhizoplane 1.9
Rhizosphere 43.6
Stem 0
Stem Tuber 0.47
Unclassified 10.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10000793 3300001990 Bacteria 11195
2 JGI24735J21928_10014034 3300002067 Bacteria 2512
3 JGI25165J46597_1000078 3300003214 Bacteria 179320
4 rootL2_10176035 3300003322 Bacteria 8331
5 Ga0055542_1000557 3300003762 Bacteria 32931
6 Ga0068853_100482606 3300005539 Bacteria 1168
7 Ga0075364_10008734 3300006051 Bacteria 6061
8 Ga0075364_10101446 3300006051 Bacteria 1916
9 Ga0075362_10021391 3300006177 Bacteria 2713
10 Ga0075369_10041102 3300006186 Bacteria 1979
11 Ga0099823_1000747 3300006944 Bacteria 23809
12 Ga0099826_10000025 3300006948 Bacteria 146840
13 Ga0105241_10440484 3300009174 Bacteria 1151
14 Ga0105239_10121961 3300010375 Bacteria 2896
15 Ga0105239_10133561 3300010375 Bacteria 2762
16 Ga0157370_10311339 3300013104 Bacteria 1453
17 Ga0213872_10000276 3300021361 Bacteria 43790
18 Ga0209148_1000126 3300025254 Bacteria 181590
19 Ga0209233_1008595 3300025261 Bacteria 3147
20 Ga0209455_1002586 3300025272 Bacteria 6891
21 Ga0207671_10004536 3300025914 Bacteria 13193
22 Ga0207657_10088083 3300025919 Bacteria 2596
23 Ga0207698_10115107 3300026142 Bacteria 2263
24 Ga0209389_1024218 3300027296 Bacteria 5330
25 Ga0209282_1000685 3300027666 Bacteria 16831
26 Ga0265339_10002251 3300031249 Bacteria 13948
27 Ga0395899_0000014 3300037312 Bacteria 488813
28 Ga0395899_0000107 3300037312 Bacteria 144087
29 Ga0395900_0000007 3300037418 Bacteria 488860
30 Ga0395900_0000101 3300037418 Bacteria 153550
31 Ga0395898_0000011 3300037466 Bacteria 488860
32 Ga0395898_0000043 3300037466 Bacteria 301783
33 Ga0395905_0000008 3300037471 Bacteria 488860
34 Ga0395905_0000101 3300037471 Bacteria 144115
35 Ga0395901_0000020 3300038443 Bacteria 314918
36 Ga0395901_0000068 3300038443 Bacteria 144095
37 Ga0436361_0526559 3300039447 Bacteria 60778
38 Ga0466960_0020643 3300044901 Bacteria 2921
39 Ga0451576_0290177 3300045051 Bacteria 1710
40 Ga0495643_0000042 3300046522 Bacteria 229665
41 Ga0496104_0296502 3300048907 Bacteria 1529
42 Ga0496116_0038673 3300048919 Bacteria 3309
43 Ga0496121_0000003 3300048924 Bacteria 1191431
44 Ga0496125_0157335 3300048928 Bacteria 1550
45 Ga0496125_0162768 3300048928 Bacteria 1513
46 Ga0496126_0000343 3300048929 Bacteria 97986
47 Ga0496126_0133744 3300048929 Bacteria 2141
48 Ga0496126_0155582 3300048929 Bacteria 1957
49 Ga0501031_0006184 3300049568 Bacteria 7816
50 Ga0501031_0272971 3300049568 Bacteria 1098
51 Ga0501032_0000059 3300049569 Bacteria 96399
52 Ga0501032_0000653 3300049569 Bacteria 28159
53 Ga0501032_0000928 3300049569 Bacteria 23702
54 Ga0501033_0000048 3300049570 Bacteria 120958
55 Ga0501033_0000284 3300049570 Bacteria 48783
56 Ga0501033_0016370 3300049570 Bacteria 5615
57 Ga0501033_0028521 3300049570 Bacteria 4193
58 Ga0501033_0413825 3300049570 Bacteria 939
59 Ga0501034_0000094 3300049571 Bacteria 163124
60 Ga0501034_0000662 3300049571 Bacteria 52559
61 Ga0501034_0000775 3300049571 Bacteria 47800
62 Ga0501034_0027352 3300049571 Bacteria 5800
63 Ga0501034_0030780 3300049571 Bacteria 5454
64 Ga0501034_0097215 3300049571 Bacteria 2940
65 Ga0501034_0155346 3300049571 Bacteria 2262
66 Ga0501034_0209519 3300049571 Bacteria 1905
67 Ga0501036_0000207 3300049572 Bacteria 39247
68 Ga0501036_0001352 3300049572 Bacteria 18796
69 Ga0501037_0000057 3300049573 Bacteria 107920
70 Ga0501037_0000197 3300049573 Bacteria 54709
71 Ga0501037_0047568 3300049573 Bacteria 3143
72 Ga0501037_0136511 3300049573 Bacteria 1757
73 Ga0501038_0000218 3300049574 Bacteria 49144
74 Ga0501038_0000971 3300049574 Bacteria 25712
75 Ga0501038_0003533 3300049574 Bacteria 14553
76 Ga0501038_0121533 3300049574 Bacteria 2153
77 Ga0501038_0249242 3300049574 Bacteria 1407
78 Ga0501039_0000010 3300049575 Bacteria 247832
79 Ga0501039_0013077 3300049575 Bacteria 6346
80 Ga0501043_0000040 3300049579 Bacteria 117024
81 Ga0501043_0000611 3300049579 Bacteria 31659
82 Ga0501043_0152185 3300049579 Bacteria 1810
83 Ga0501046_0010804 3300049580 Bacteria 7827
84 Ga0501046_0014899 3300049580 Bacteria 6542
85 Ga0501047_0000747 3300049581 Bacteria 33899
86 Ga0501047_0042102 3300049581 Bacteria 4414
87 Ga0501047_0051178 3300049581 Bacteria 3990
88 Ga0501047_0216429 3300049581 Bacteria 1772
89 Ga0501070_0024606 3300049586 Bacteria 5049
90 Ga0501070_0142479 3300049586 Bacteria 1979
91 Ga0501070_0177303 3300049586 Bacteria 1754
92 Ga0501077_0010601 3300049593 Bacteria 5740
93 Ga0501083_0070784 3300049744 Bacteria 2319
94 Ga0501035_0000076 3300049822 Bacteria 121548
95 Ga0501035_0000353 3300049822 Bacteria 52827
96 Ga0501035_0036793 3300049822 Bacteria 4435
97 Ga0501044_0000075 3300049823 Bacteria 120819
98 Ga0501044_0002058 3300049823 Bacteria 23194
99 Ga0501044_0102422 3300049823 Bacteria 2879
100 Ga0501044_0280530 3300049823 Bacteria 1600
101 Ga0501044_0292408 3300049823 Bacteria 1560
102 nmdc:mga03683_21662_c1 3300050489 Bacteria 2482
103 nmdc:mga00v17_105242_c1 3300050491 Bacteria 1785
104 nmdc:mga0yw44_61074_c1 3300050492 Bacteria 2311
105 nmdc:mga0yw44_6579_c1 3300050492 Bacteria 5628
106 nmdc:mga06z11_46317_c1 3300050494 Bacteria 2203
107 nmdc:mga0sz30_84132_c1 3300050516 Bacteria 1379
108 Ga0501082_0104405 3300060353 Bacteria 2451

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048929 Ga0496126_0133744 Ga0496126_0133744_82_945 249
2 3300021361 Ga0213872_10000276 Ga0213872_1000027637 267
3 3300039447 Ga0436361_0526559 Ga0436361_0526559_47688_48680 267
4 3300006944 Ga0099823_1000747 Ga0099823_100074720 268
5 3300027296 Ga0209389_1024218 Ga0209389_10242184 268
6 3300049579 Ga0501043_0152185 Ga0501043_0152185_881_1780 274
7 3300049570 Ga0501033_0016370 Ga0501033_0016370_577_1476 275
8 3300049822 Ga0501035_0036793 Ga0501035_0036793_2180_3079 275
9 3300049571 Ga0501034_0209519 Ga0501034_0209519_648_1553 276
10 3300049593 Ga0501077_0010601 Ga0501077_0010601_757_1743 278
11 3300049744 Ga0501083_0070784 Ga0501083_0070784_1139_2125 278
12 3300060353 Ga0501082_0104405 Ga0501082_0104405_239_1225 278
13 3300049570 Ga0501033_0413825 Ga0501033_0413825_14_928 280
14 3300045051 Ga0451576_0290177 Ga0451576_0290177_448_1368 281
15 3300049823 Ga0501044_0102422 Ga0501044_0102422_1514_2434 281
16 3300049574 Ga0501038_0121533 Ga0501038_0121533_310_1236 282
17 3300049573 Ga0501037_0136511 Ga0501037_0136511_348_1280 284
18 3300037312 Ga0395899_0000107 Ga0395899_0000107_117288_118301 285
19 3300037418 Ga0395900_0000101 Ga0395900_0000101_25787_26800 285
20 3300037466 Ga0395898_0000043 Ga0395898_0000043_117316_118329 285
21 3300037471 Ga0395905_0000101 Ga0395905_0000101_117316_118329 285
22 3300038443 Ga0395901_0000068 Ga0395901_0000068_117316_118329 285
23 iso_pu_bacteria 2643221623 2644129045 285
24 iso_pu_bacteria 2881853255 2881856923 285
25 iso_pu_bacteria 2961127735 2961129780 285
26 3300006051 Ga0075364_10008734 Ga0075364_100087347 286
27 3300006186 Ga0075369_10041102 Ga0075369_100411022 286
28 3300048924 Ga0496121_0000003 Ga0496121_0000003_751102_752058 286
29 3300049570 Ga0501033_0028521 Ga0501033_0028521_2039_3013 286
30 3300049571 Ga0501034_0000775 Ga0501034_0000775_6987_7955 286
31 iso_pu_bacteria 2582581304 2585259402 286
32 iso_pu_bacteria 2615840698 2616556364 286
33 iso_pu_bacteria 2773857925 2774872007 286
34 iso_pu_bacteria 2775507049 2776913398 286
35 iso_pu_bacteria 2854896431 2854900724 286
36 iso_pu_bacteria 2882456835 2882460964 286
37 iso_pu_bacteria 2883354860 2883358117 286
38 iso_pu_bacteria 2960637947 2960638931 286
39 iso_pu_bacteria 2964628898 2964634273 286
40 iso_pu_bacteria 2964719344 2964720332 286
41 iso_pu_bacteria 2984601300 2984603950 286
42 3300049568 Ga0501031_0272971 Ga0501031_0272971_19_1035 287
43 3300049571 Ga0501034_0097215 Ga0501034_0097215_763_1779 287
44 3300049573 Ga0501037_0047568 Ga0501037_0047568_960_1940 287
45 3300049574 Ga0501038_0003533 Ga0501038_0003533_10422_11402 287
46 3300049574 Ga0501038_0249242 Ga0501038_0249242_51_1028 287
47 3300049575 Ga0501039_0013077 Ga0501039_0013077_3733_4713 287
48 3300049581 Ga0501047_0042102 Ga0501047_0042102_2642_3622 287
49 3300049581 Ga0501047_0216429 Ga0501047_0216429_384_1361 287
50 3300049586 Ga0501070_0177303 Ga0501070_0177303_551_1567 287
51 iso_pu_bacteria 2513237351 2514590840 287
52 iso_pu_bacteria 2599185301 2599936037 287
53 iso_pu_bacteria 2643221674 2644413967 287
54 iso_pu_bacteria 2693429783 2694629603 287
55 iso_pu_bacteria 2693429784 2694640200 287
56 iso_pu_bacteria 2758568016 2758642701 287
57 iso_pu_bacteria 2924754689 2924757778 287
58 iso_pu_bacteria 2928521798 2928521851 287
59 iso_pu_bacteria 8004395343 8004395699 287
60 iso_pu_bacteria 8004395343 8004396081 287
61 iso_pu_bacteria 8045864390 8045869176 287
62 3300006948 Ga0099826_10000025 Ga0099826_1000002595 288
63 3300027666 Ga0209282_1000685 Ga0209282_100068512 288
64 3300031249 Ga0265339_10002251 Ga0265339_1000225114 288
65 3300049569 Ga0501032_0000653 Ga0501032_0000653_23722_24738 288
66 3300049569 Ga0501032_0000928 Ga0501032_0000928_2960_3943 288
67 3300049570 Ga0501033_0000284 Ga0501033_0000284_25403_26419 288
68 3300049571 Ga0501034_0000094 Ga0501034_0000094_101990_103006 288
69 3300049572 Ga0501036_0001352 Ga0501036_0001352_15921_16937 288
70 3300049573 Ga0501037_0000057 Ga0501037_0000057_9394_10410 288
71 3300049574 Ga0501038_0000218 Ga0501038_0000218_3422_4438 288
72 3300049575 Ga0501039_0000010 Ga0501039_0000010_23710_24726 288
73 3300049579 Ga0501043_0000040 Ga0501043_0000040_112459_113475 288
74 3300049580 Ga0501046_0014899 Ga0501046_0014899_1466_2482 288
75 3300049581 Ga0501047_0051178 Ga0501047_0051178_643_1659 288
76 3300049822 Ga0501035_0000353 Ga0501035_0000353_28068_29084 288
77 iso_pu_bacteria 2856342000 2856346066 288
78 iso_pu_bacteria 2968117919 2968120031 288
79 3300003762 Ga0055542_1000557 Ga0055542_100055726 289
80 3300005539 Ga0068853_100482606 Ga0068853_1004826061 289
81 3300010375 Ga0105239_10121961 Ga0105239_101219612 289
82 3300013104 Ga0157370_10311339 Ga0157370_103113392 289
83 3300025254 Ga0209148_1000126 Ga0209148_1000126100 289
84 3300025261 Ga0209233_1008595 Ga0209233_10085954 289
85 3300025272 Ga0209455_1002586 Ga0209455_10025866 289
86 3300025919 Ga0207657_10088083 Ga0207657_100880831 289
87 3300026142 Ga0207698_10115107 Ga0207698_101151072 289
88 3300037312 Ga0395899_0000014 Ga0395899_0000014_477374_478363 289
89 3300037418 Ga0395900_0000007 Ga0395900_0000007_477393_478382 289
90 3300037466 Ga0395898_0000011 Ga0395898_0000011_10479_11468 289
91 3300037471 Ga0395905_0000008 Ga0395905_0000008_477393_478382 289
92 3300038443 Ga0395901_0000020 Ga0395901_0000020_303451_304440 289
93 3300048928 Ga0496125_0162768 Ga0496125_0162768_251_1303 289
94 3300050492 nmdc:mga0yw44_6579_c1 nmdc:mga0yw44_6579_c1_2912_3964 289
95 3300050494 nmdc:mga06z11_46317_c1 nmdc:mga06z11_46317_c1_450_1502 289
96 iso_pu_bacteria 2503198000 2503200878 289
97 iso_pu_bacteria 2512875024 2512963716 289
98 iso_pu_bacteria 2513237090 2513608240 289
99 iso_pu_bacteria 2600255279 2601611351 289
100 iso_pu_bacteria 2600255308 2601748228 289
101 iso_pu_bacteria 2757320392 2757572199 289
102 iso_pu_bacteria 2757320392 2757572616 289
103 iso_pu_bacteria 2842357229 2842362960 289
104 iso_pu_bacteria 2857349434 2857355775 289
105 iso_pu_bacteria 2871488783 2871491804 289
106 iso_pu_bacteria 2871495908 2871500986 289
107 iso_pu_bacteria 2874102143 2874105659 289
108 iso_pu_bacteria 2874139085 2874139690 289
109 iso_pu_bacteria 2874168670 2874171277 289
110 iso_pu_bacteria 2878738818 2878739519 289
111 iso_pu_bacteria 2878753008 2878755966 289
112 iso_pu_bacteria 2878760144 2878765023 289
113 iso_pu_bacteria 2878767105 2878772175 289
114 iso_pu_bacteria 2881147464 2881153907 289
115 iso_pu_bacteria 2881161766 2881163649 289
116 iso_pu_bacteria 2881861095 2881865614 289
117 iso_pu_bacteria 2882912400 2882912794 289
118 iso_pu_bacteria 2885305155 2885311913 289
119 iso_pu_bacteria 2885318864 2885323116 289
120 iso_pu_bacteria 2885334103 2885338175 289
121 iso_pu_bacteria 2888337043 2888341669 289
122 iso_pu_bacteria 2889010040 2889011756 289
123 iso_pu_bacteria 2889914905 2889919627 289
124 iso_pu_bacteria 2903492973 2903501434 289
125 iso_pu_bacteria 2903540706 2903545803 289
126 iso_pu_bacteria 2915650412 2915652101 289
127 iso_pu_bacteria 2924776078 2924777043 289
128 iso_pu_bacteria 2924784321 2924791066 289
129 iso_pu_bacteria 2937848649 2937852668 289
130 iso_pu_bacteria 2937877337 2937880347 289
131 iso_pu_bacteria 2937972304 2937976449 289
132 iso_pu_bacteria 2937994558 2937999653 289
133 iso_pu_bacteria 2958034702 2958038609 289
134 iso_pu_bacteria 2958084443 2958087483 289
135 iso_pu_bacteria 2958092219 2958096622 289
136 iso_pu_bacteria 2958144490 2958145284 289
137 iso_pu_bacteria 2958165035 2958170124 289
138 iso_pu_bacteria 2961163497 2961168578 289
139 iso_pu_bacteria 2961170736 2961174015 289
140 iso_pu_bacteria 2965018300 2965023399 289
141 iso_pu_bacteria 2965062239 2965064371 289
142 iso_pu_bacteria 2968003550 2968005577 289
143 iso_pu_bacteria 2968016561 2968023790 289
144 iso_pu_bacteria 2968171901 2968176989 289
145 iso_pu_bacteria 2970469710 2970469831 289
146 iso_pu_bacteria 2970503327 2970506605 289
147 iso_pu_bacteria 2970554993 2970559871 289
148 iso_pu_bacteria 2977821940 2977825189 289
149 iso_pu_bacteria 2977828996 2977833827 289
150 iso_pu_bacteria 2977864932 2977868639 289
151 iso_pu_bacteria 2977922695 2977925226 289
152 iso_pu_bacteria 2977942078 2977944440 289
153 iso_pu_bacteria 2979808191 2979811251 289
154 iso_pu_bacteria 2987636660 2987640909 289
155 iso_pu_bacteria 2987652177 2987653079 289
156 iso_pu_bacteria 2987659509 2987664605 289
157 iso_pu_bacteria 2996348954 2996355101 289
158 iso_pu_bacteria 3000135777 3000142187 289
159 iso_pu_bacteria 3004188549 3004193657 289
160 iso_pu_bacteria 3004203850 3004209106 289
161 iso_pu_bacteria 3004211236 3004212489 289
162 iso_pu_bacteria 3004218560 3004224156 289
163 iso_pu_bacteria 3004275668 3004281635 289
164 iso_pu_bacteria 8004374579 8004377556 289
165 3300006177 Ga0075362_10021391 Ga0075362_100213913 290
166 3300009174 Ga0105241_10440484 Ga0105241_104404841 290
167 3300010375 Ga0105239_10133561 Ga0105239_101335613 290
168 3300025914 Ga0207671_10004536 Ga0207671_100045366 290
169 3300044901 Ga0466960_0020643 Ga0466960_0020643_1096_2097 290
170 3300048919 Ga0496116_0038673 Ga0496116_0038673_1638_2636 290
171 3300048928 Ga0496125_0157335 Ga0496125_0157335_16_1014 290
172 3300048929 Ga0496126_0000343 Ga0496126_0000343_84989_85990 290
173 3300049571 Ga0501034_0030780 Ga0501034_0030780_2397_3419 290
174 3300049571 Ga0501034_0155346 Ga0501034_0155346_629_1654 290
175 3300049823 Ga0501044_0292408 Ga0501044_0292408_353_1342 290
176 3300050489 nmdc:mga03683_21662_c1 nmdc:mga03683_21662_c1_891_1946 290
177 3300050492 nmdc:mga0yw44_61074_c1 nmdc:mga0yw44_61074_c1_835_1887 290
178 3300050516 nmdc:mga0sz30_84132_c1 nmdc:mga0sz30_84132_c1_92_1147 290
179 iso_pu_bacteria 2854911287 2854912832 290
180 iso_pu_bacteria 2854911287 2854913260 290
181 iso_pu_bacteria 2855020534 2855022173 290
182 3300003322 rootL2_10176035 rootL2_101760358 291
183 3300006051 Ga0075364_10101446 Ga0075364_101014461 291
184 3300046522 Ga0495643_0000042 Ga0495643_0000042_96708_97724 291
185 3300048907 Ga0496104_0296502 Ga0496104_0296502_406_1422 291
186 3300049568 Ga0501031_0006184 Ga0501031_0006184_2142_3155 291
187 3300049569 Ga0501032_0000059 Ga0501032_0000059_11111_12124 291
188 3300049570 Ga0501033_0000048 Ga0501033_0000048_91040_92053 291
189 3300049571 Ga0501034_0000662 Ga0501034_0000662_22734_23747 291
190 3300049571 Ga0501034_0027352 Ga0501034_0027352_2465_3481 291
191 3300049572 Ga0501036_0000207 Ga0501036_0000207_9459_10472 291
192 3300049573 Ga0501037_0000197 Ga0501037_0000197_45288_46301 291
193 3300049574 Ga0501038_0000971 Ga0501038_0000971_8841_9854 291
194 3300049579 Ga0501043_0000611 Ga0501043_0000611_29071_30084 291
195 3300049580 Ga0501046_0010804 Ga0501046_0010804_474_1487 291
196 3300049581 Ga0501047_0000747 Ga0501047_0000747_24949_25962 291
197 3300049586 Ga0501070_0024606 Ga0501070_0024606_3698_4711 291
198 3300049822 Ga0501035_0000076 Ga0501035_0000076_91040_92053 291
199 3300049823 Ga0501044_0000075 Ga0501044_0000075_91013_92026 291
200 3300050491 nmdc:mga00v17_105242_c1 nmdc:mga00v17_105242_c1_14_1027 291
201 3300048929 Ga0496126_0155582 Ga0496126_0155582_150_1223 292
202 3300003214 JGI25165J46597_1000078 JGI25165J46597_100007843 301
203 3300049823 Ga0501044_0280530 Ga0501044_0280530_361_1434 301
204 3300049586 Ga0501070_0142479 Ga0501070_0142479_919_1911 305
205 3300049823 Ga0501044_0002058 Ga0501044_0002058_4429_5415 305
206 iso_pu_bacteria 2808606401 2809063760 306
207 iso_pu_bacteria 2808606404 2809079622 306
208 iso_pu_bacteria 2808606405 2809083987 306
209 iso_pu_bacteria 2880518877 2880519310 306
210 3300001990 JGI24737J22298_10000793 JGI24737J22298_100007932 310
211 3300002067 JGI24735J21928_10014034 JGI24735J21928_100140343 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03524

CagX

Conjugal transfer protein

104

319

0.93

Feature Viewer

pLDDT pTM Quality
54.79 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map