F321546

General Info

Members Datasets Scaffolds Average Seq Length
211 155 208 57

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_11109212|Ga0105245_111092122
Length 57
Sequence MSSAGDSKAGKAQFNVYLPVDLVRRIKHKAIDEEASLSALVERAMEEFLERNGEPRA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
69 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
70 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
83 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
84 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
87 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
110 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
150 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
153 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
154 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
155 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0.95
Rhizoplane 2.84
Rhizosphere 84.36
Stem 0
Stem Tuber 0
Unclassified 7.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10149821 3300003323 Bacteria 2673
2 Ga0070670_100707935 3300005331 Unclassified 906
3 Ga0070680_100249507 3300005336 Bacteria 1500
4 Ga0068868_101583858 3300005338 Bacteria 615
5 Ga0070687_100382903 3300005343 Bacteria 917
6 Ga0070675_101125319 3300005354 Bacteria 722
7 Ga0070674_100681600 3300005356 Bacteria 877
8 Ga0070678_101081515 3300005456 Bacteria 740
9 Ga0070678_101640872 3300005456 Bacteria 604
10 Ga0070679_101433270 3300005530 Bacteria 637
11 Ga0070679_101550177 3300005530 Bacteria 610
12 Ga0070697_101672816 3300005536 Unclassified 569
13 Ga0070686_100236964 3300005544 Bacteria 1327
14 Ga0070665_100115777 3300005548 Bacteria 2683
15 Ga0070665_101293998 3300005548 Bacteria 739
16 Ga0068855_100161587 3300005563 Bacteria 2542
17 Ga0068856_101311644 3300005614 Bacteria 739
18 Ga0070702_101327782 3300005615 Unclassified 585
19 Ga0068866_10445889 3300005718 Bacteria 845
20 Ga0068863_100005215 3300005841 Bacteria 12823
21 Ga0068862_100246316 3300005844 Bacteria 1627
22 Ga0075363_100736435 3300006048 Bacteria 597
23 Ga0075362_10414899 3300006177 Bacteria 680
24 Ga0075362_10509163 3300006177 Bacteria 616
25 Ga0075431_101939880 3300006847 Bacteria 544
26 Ga0068865_101073473 3300006881 Bacteria 708
27 Ga0105240_10025687 3300009093 Bacteria 7737
28 Ga0105240_10127764 3300009093 Bacteria 3052
29 Ga0105240_10208094 3300009093 Bacteria 2288
30 Ga0105240_10338492 3300009093 Bacteria 1710
31 Ga0105240_10391310 3300009093 Bacteria 1568
32 Ga0111539_11898968 3300009094 Bacteria 690
33 Ga0105245_11109212 3300009098 Bacteria 838
34 Ga0105247_10000445 3300009101 Bacteria 34975
35 Ga0114129_10836180 3300009147 Bacteria 1172
36 Ga0105243_10125310 3300009148 Bacteria 2172
37 Ga0105243_12522122 3300009148 Bacteria 553
38 Ga0105242_11749263 3300009176 Unclassified 659
39 Ga0105248_13128489 3300009177 Bacteria 527
40 Ga0105237_10097190 3300009545 Bacteria 2935
41 Ga0105237_12751621 3300009545 Bacteria 503
42 Ga0105238_10005938 3300009551 Bacteria 12101
43 Ga0105238_10304212 3300009551 Bacteria 1578
44 Ga0105238_11111851 3300009551 Bacteria 813
45 Ga0105238_13063847 3300009551 Bacteria 501
46 Ga0105249_10793449 3300009553 Bacteria 1011
47 Ga0105239_11923186 3300010375 Bacteria 686
48 Ga0105239_12036891 3300010375 Bacteria 667
49 Ga0157374_12299994 3300013296 Bacteria 566
50 Ga0157378_10116991 3300013297 Bacteria 2452
51 Ga0157378_11914418 3300013297 Bacteria 642
52 Ga0157378_12199727 3300013297 Unclassified 603
53 Ga0163162_10425737 3300013306 Bacteria 1460
54 Ga0163162_12537736 3300013306 Bacteria 589
55 Ga0163162_12720658 3300013306 Bacteria 569
56 Ga0157375_12122290 3300013308 Bacteria 669
57 Ga0157375_12606162 3300013308 Bacteria 604
58 Ga0157375_12995307 3300013308 Unclassified 564
59 Ga0163163_10104546 3300014325 Unclassified 2857
60 Ga0157380_11427278 3300014326 Unclassified 743
61 Ga0157380_11977849 3300014326 Bacteria 644
62 Ga0157377_10413316 3300014745 Bacteria 922
63 Ga0157377_11017592 3300014745 Bacteria 629
64 Ga0157379_10372165 3300014968 Bacteria 1310
65 Ga0157379_11669722 3300014968 Bacteria 623
66 Ga0157376_10700882 3300014969 Unclassified 1017
67 Ga0157376_11414032 3300014969 Bacteria 727
68 Ga0157376_11459294 3300014969 Bacteria 716
69 Ga0157376_12315019 3300014969 Unclassified 576
70 Ga0207642_10595299 3300025899 Bacteria 688
71 Ga0207654_11039977 3300025911 Unclassified 596
72 Ga0207695_10268293 3300025913 Bacteria 1603
73 Ga0207695_10302487 3300025913 Bacteria 1491
74 Ga0207695_10737403 3300025913 Bacteria 865
75 Ga0207695_11591371 3300025913 Unclassified 534
76 Ga0207660_10062892 3300025917 Bacteria 2675
77 Ga0207652_11654181 3300025921 Unclassified 545
78 Ga0207694_10005456 3300025924 Bacteria 9773
79 Ga0207694_10364280 3300025924 Bacteria 1198
80 Ga0207644_10918881 3300025931 Bacteria 734
81 Ga0207709_11543271 3300025935 Unclassified 551
82 Ga0207669_10852960 3300025937 Bacteria 758
83 Ga0207669_11177317 3300025937 Bacteria 649
84 Ga0207704_11480796 3300025938 Unclassified 582
85 Ga0207665_10504280 3300025939 Bacteria 935
86 Ga0207667_10002474 3300025949 Bacteria 23034
87 Ga0207667_10191123 3300025949 Bacteria 2101
88 Ga0207668_11023721 3300025972 Unclassified 739
89 Ga0207658_11840471 3300025986 Bacteria 552
90 Ga0207702_10211246 3300026078 Bacteria 1804
91 Ga0207702_12099660 3300026078 Bacteria 555
92 Ga0207641_10087556 3300026088 Unclassified 2717
93 Ga0207641_11483257 3300026088 Unclassified 680
94 Ga0207648_10862623 3300026089 Bacteria 845
95 Ga0207675_100269291 3300026118 Bacteria 1653
96 Ga0207683_11078888 3300026121 Bacteria 745
97 Ga0207698_10939193 3300026142 Bacteria 874
98 Ga0268266_10041815 3300028379 Bacteria 3913
99 Ga0268265_10321840 3300028380 Bacteria 1401
100 Ga0265320_10493781 3300031240 Bacteria 541
101 Ga0265325_10159064 3300031241 Bacteria 1064
102 Ga0265327_10214127 3300031251 Bacteria 868
103 Ga0307508_10008159 3300031616 Bacteria 9709
104 Ga0307508_10210075 3300031616 Bacteria 1547
105 Ga0307508_10275470 3300031616 Unclassified 1276
106 Ga0265314_10447142 3300031711 Bacteria 689
107 Ga0307507_10015952 3300033179 Bacteria 8788
108 Ga0307507_10042082 3300033179 Bacteria 4560
109 Ga0307510_10532022 3300033180 Bacteria 620
110 Ga0373935_0630278 3300035692 Archaea 785
111 Ga0373947_0037844 3300035725 Bacteria 2864
112 Ga0395899_0093359 3300037312 Bacteria 2178
113 Ga0395900_0114191 3300037418 Bacteria 2772
114 Ga0395898_0002853 3300037466 Bacteria 19760
115 Ga0436364_1052799 3300037853 Bacteria 754
116 Ga0395901_0178244 3300038443 Bacteria 2229
117 Ga0436365_0744968 3300039437 Bacteria 646
118 Ga0436365_1125171 3300039437 Bacteria 888
119 Ga0436365_1317264 3300039437 Bacteria 2901
120 Ga0436360_0149847 3300039438 Unclassified 600
121 Ga0451791_0681985 3300041451 Bacteria 802
122 Ga0451793_0338059 3300041452 Bacteria 521
123 Ga0451807_1323345 3300041486 Bacteria 503
124 Ga0466972_0092985 3300044658 Bacteria 1430
125 Ga0466989_0105518 3300044663 Bacteria 1729
126 Ga0466965_0283685 3300044683 Bacteria 895
127 Ga0466966_0017388 3300044684 Bacteria 4752
128 Ga0466966_0418509 3300044684 Bacteria 805
129 Ga0466961_0160467 3300044693 Bacteria 1401
130 Ga0466961_0677849 3300044693 Bacteria 618
131 Ga0466964_0164327 3300044706 Bacteria 1040
132 Ga0466964_0267802 3300044706 Bacteria 849
133 Ga0466971_0320844 3300044719 Bacteria 746
134 Ga0466970_0071770 3300044765 Bacteria 1863
135 Ga0466959_0023858 3300045049 Bacteria 4528
136 Ga0466959_0078111 3300045049 Bacteria 2387
137 Ga0466959_0254746 3300045049 Bacteria 1210
138 Ga0466958_0151303 3300045836 Bacteria 1464
139 Ga0466958_0706090 3300045836 Bacteria 657
140 Ga0466967_0543392 3300045976 Bacteria 1143
141 Ga0466967_2075675 3300045976 Bacteria 565
142 Ga0466967_2208721 3300045976 Bacteria 546
143 Ga0495629_0200482 3300046459 Bacteria 1380
144 Ga0495629_0537981 3300046459 Bacteria 785
145 Ga0495582_0652105 3300046473 Bacteria 609
146 Ga0495582_0908481 3300046473 Bacteria 509
147 Ga0495596_0421434 3300046500 Bacteria 520
148 Ga0495608_0071184 3300046511 Bacteria 2269
149 Ga0495618_0277350 3300046514 Bacteria 1046
150 Ga0495628_0203778 3300046516 Bacteria 1490
151 Ga0495630_0051806 3300046517 Bacteria 3072
152 Ga0495630_0910044 3300046517 Unclassified 670
153 Ga0495640_0029321 3300046533 Unclassified 3952
154 Ga0495668_0571818 3300046616 Bacteria 624
155 Ga0495634_0011539 3300046642 Bacteria 6429
156 Ga0495625_0793943 3300046660 Bacteria 551
157 Ga0495635_0153837 3300046663 Bacteria 1566
158 Ga0495599_0385069 3300046678 Bacteria 837
159 Ga0495647_0108783 3300046681 Bacteria 1155
160 Ga0495658_0049556 3300046683 Bacteria 2373
161 Ga0495613_0000937 3300046689 Bacteria 22355
162 Ga0495670_0125251 3300046691 Unclassified 1337
163 Ga0495600_0727953 3300046809 Bacteria 595
164 Ga0495581_0354184 3300047315 Bacteria 857
165 Ga0495674_0639685 3300047319 Unclassified 839
166 Ga0495674_0748157 3300047319 Bacteria 764
167 Ga0495676_0223125 3300047321 Bacteria 1298
168 Ga0495676_0786844 3300047321 Unclassified 613
169 Ga0495680_0358529 3300047322 Bacteria 1014
170 Ga0495684_0858262 3300047471 Archaea 588
171 Ga0495614_0484157 3300048089 Archaea 588
172 Ga0495615_0264616 3300048090 Bacteria 548
173 Ga0496100_0200455 3300048903 Bacteria 1454
174 Ga0496108_0977300 3300048911 Bacteria 724
175 Ga0496114_0293848 3300048917 Bacteria 1434
176 Ga0496121_0009623 3300048924 Bacteria 11069
177 Ga0496125_0012911 3300048928 Bacteria 8246
178 Ga0496126_0038663 3300048929 Bacteria 4436
179 Ga0501034_1177640 3300049571 Bacteria 646
180 Ga0501036_0646189 3300049572 Unclassified 876
181 Ga0501038_1386806 3300049574 Unclassified 505
182 Ga0501039_0451046 3300049575 Bacteria 1010
183 Ga0501040_0595856 3300049576 Unclassified 798
184 Ga0501040_1191197 3300049576 Bacteria 553
185 Ga0501041_0219644 3300049577 Unclassified 1193
186 Ga0501070_0053809 3300049586 Bacteria 3338
187 Ga0501071_0332662 3300049587 Bacteria 1155
188 Ga0501071_0439741 3300049587 Unclassified 998
189 Ga0501072_0405468 3300049588 Unclassified 1081
190 Ga0501074_0884119 3300049590 Unclassified 629
191 Ga0501080_0494383 3300049742 Bacteria 1094
192 Ga0501080_0983355 3300049742 Unclassified 732
193 nmdc:mga00v17_306890_c1 3300050491 Bacteria 1031
194 nmdc:mga06z11_721266_c1 3300050494 Bacteria 607
195 nmdc:mga05p37_961113_c1 3300050507 Unclassified 913
196 nmdc:mga06r32_1671491_c1 3300050510 Bacteria 574
197 Ga0495601_0350519 3300053077 Bacteria 960
198 Ga0495595_0192740 3300053084 Bacteria 1013
199 Ga0495619_0173144 3300053085 Bacteria 1493
200 Ga0495619_0963936 3300053085 Bacteria 572
201 Ga0500578_0711270 3300053086 Bacteria 539
202 Ga0500646_0010672 3300053090 Bacteria 2357
203 Ga0500658_0152942 3300053134 Bacteria 1041
204 Ga0500616_0001333 3300053153 Bacteria 24248
205 Ga0500637_0029679 3300053178 Bacteria 3036
206 Ga0590071_190832 3300059421 Bacteria 538
207 Ga0501082_0102478 3300060353 Bacteria 2476
208 Ga0466962_0465443 3300061719 Bacteria 638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009098 Ga0105245_11109212 Ga0105245_111092122 49
2 3300009176 Ga0105242_11749263 Ga0105242_117492632 49
3 3300013308 Ga0157375_12995307 Ga0157375_129953072 49
4 3300014745 Ga0157377_10413316 Ga0157377_104133161 49
5 3300026088 Ga0207641_11483257 Ga0207641_114832573 49
6 3300026089 Ga0207648_10862623 Ga0207648_108626232 49
7 3300041451 Ga0451791_0681985 Ga0451791_0681985_474_647 49
8 3300041452 Ga0451793_0338059 Ga0451793_0338059_24_197 49
9 3300041486 Ga0451807_1323345 Ga0451807_1323345_204_377 49
10 3300048911 Ga0496108_0977300 Ga0496108_0977300_356_529 49
11 3300049572 Ga0501036_0646189 Ga0501036_0646189_683_859 49
12 3300049574 Ga0501038_1386806 Ga0501038_1386806_32_208 49
13 3300049575 Ga0501039_0451046 Ga0501039_0451046_621_797 49
14 3300049576 Ga0501040_0595856 Ga0501040_0595856_18_194 49
15 3300049577 Ga0501041_0219644 Ga0501041_0219644_965_1141 49
16 3300049586 Ga0501070_0053809 Ga0501070_0053809_2106_2273 49
17 3300049587 Ga0501071_0439741 Ga0501071_0439741_632_805 49
18 3300049588 Ga0501072_0405468 Ga0501072_0405468_122_298 49
19 3300049590 Ga0501074_0884119 Ga0501074_0884119_187_363 49
20 3300005338 Ga0068868_101583858 Ga0068868_1015838582 50
21 3300049587 Ga0501071_0332662 Ga0501071_0332662_189_356 50
22 3300044663 Ga0466989_0105518 Ga0466989_0105518_517_681 51
23 3300044683 Ga0466965_0283685 Ga0466965_0283685_564_728 51
24 3300044684 Ga0466966_0017388 Ga0466966_0017388_3458_3622 51
25 3300044693 Ga0466961_0160467 Ga0466961_0160467_107_271 51
26 3300044719 Ga0466971_0320844 Ga0466971_0320844_555_719 51
27 3300044765 Ga0466970_0071770 Ga0466970_0071770_1101_1265 51
28 3300045049 Ga0466959_0078111 Ga0466959_0078111_1532_1696 51
29 3300045836 Ga0466958_0151303 Ga0466958_0151303_263_427 51
30 iso_pu_bacteria 8025478263 8025482900 51
31 iso_pu_bacteria 8054913762 8054919203 51
32 iso_pu_bacteria 8054920844 8054921851 51
33 3300026142 Ga0207698_10939193 Ga0207698_109391932 52
34 3300046459 Ga0495629_0200482 Ga0495629_0200482_151_333 52
35 3300046514 Ga0495618_0277350 Ga0495618_0277350_641_823 52
36 3300046516 Ga0495628_0203778 Ga0495628_0203778_132_314 52
37 3300046517 Ga0495630_0051806 Ga0495630_0051806_2162_2344 52
38 3300046533 Ga0495640_0029321 Ga0495640_0029321_3665_3847 52
39 3300046642 Ga0495634_0011539 Ga0495634_0011539_538_720 52
40 3300046683 Ga0495658_0049556 Ga0495658_0049556_1928_2110 52
41 3300046689 Ga0495613_0000937 Ga0495613_0000937_15761_15943 52
42 3300047321 Ga0495676_0786844 Ga0495676_0786844_377_559 52
43 3300060353 Ga0501082_0102478 Ga0501082_0102478_1177_1344 52
44 3300005530 Ga0070679_101550177 Ga0070679_1015501772 53
45 3300005563 Ga0068855_100161587 Ga0068855_1001615875 53
46 3300005614 Ga0068856_101311644 Ga0068856_1013116441 53
47 3300009093 Ga0105240_10127764 Ga0105240_101277643 53
48 3300009093 Ga0105240_10208094 Ga0105240_102080942 53
49 3300009093 Ga0105240_10338492 Ga0105240_103384922 53
50 3300009093 Ga0105240_10391310 Ga0105240_103913104 53
51 3300009148 Ga0105243_12522122 Ga0105243_125221222 53
52 3300009545 Ga0105237_12751621 Ga0105237_127516212 53
53 3300009551 Ga0105238_10005938 Ga0105238_100059388 53
54 3300013297 Ga0157378_12199727 Ga0157378_121997272 53
55 3300014968 Ga0157379_11669722 Ga0157379_116697222 53
56 3300025913 Ga0207695_10302487 Ga0207695_103024872 53
57 3300025913 Ga0207695_10737403 Ga0207695_107374033 53
58 3300025924 Ga0207694_10005456 Ga0207694_100054563 53
59 3300025949 Ga0207667_10191123 Ga0207667_101911233 53
60 3300026078 Ga0207702_12099660 Ga0207702_120996601 53
61 3300031251 Ga0265327_10214127 Ga0265327_102141272 53
62 3300031616 Ga0307508_10275470 Ga0307508_102754703 53
63 3300033180 Ga0307510_10532022 Ga0307510_105320221 53
64 3300037312 Ga0395899_0093359 Ga0395899_0093359_1583_1747 53
65 3300037418 Ga0395900_0114191 Ga0395900_0114191_1142_1306 53
66 3300038443 Ga0395901_0178244 Ga0395901_0178244_907_1071 53
67 3300039438 Ga0436360_0149847 Ga0436360_0149847_276_443 53
68 3300044693 Ga0466961_0677849 Ga0466961_0677849_49_216 53
69 3300045976 Ga0466967_2208721 Ga0466967_2208721_354_530 53
70 3300048929 Ga0496126_0038663 Ga0496126_0038663_2515_2679 53
71 3300049571 Ga0501034_1177640 Ga0501034_1177640_85_252 53
72 3300003323 rootH1_10149821 rootH1_101498212 54
73 3300005331 Ga0070670_100707935 Ga0070670_1007079352 54
74 3300005336 Ga0070680_100249507 Ga0070680_1002495072 54
75 3300005343 Ga0070687_100382903 Ga0070687_1003829032 54
76 3300005354 Ga0070675_101125319 Ga0070675_1011253192 54
77 3300005356 Ga0070674_100681600 Ga0070674_1006816002 54
78 3300005456 Ga0070678_101081515 Ga0070678_1010815152 54
79 3300005456 Ga0070678_101640872 Ga0070678_1016408722 54
80 3300005530 Ga0070679_101433270 Ga0070679_1014332702 54
81 3300005536 Ga0070697_101672816 Ga0070697_1016728162 54
82 3300005544 Ga0070686_100236964 Ga0070686_1002369642 54
83 3300005548 Ga0070665_100115777 Ga0070665_1001157774 54
84 3300005548 Ga0070665_101293998 Ga0070665_1012939982 54
85 3300005615 Ga0070702_101327782 Ga0070702_1013277822 54
86 3300005718 Ga0068866_10445889 Ga0068866_104458893 54
87 3300005841 Ga0068863_100005215 Ga0068863_10000521512 54
88 3300005844 Ga0068862_100246316 Ga0068862_1002463163 54
89 3300006048 Ga0075363_100736435 Ga0075363_1007364352 54
90 3300006177 Ga0075362_10414899 Ga0075362_104148992 54
91 3300006177 Ga0075362_10509163 Ga0075362_105091632 54
92 3300006847 Ga0075431_101939880 Ga0075431_1019398802 54
93 3300006881 Ga0068865_101073473 Ga0068865_1010734733 54
94 3300009093 Ga0105240_10025687 Ga0105240_100256877 54
95 3300009094 Ga0111539_11898968 Ga0111539_118989682 54
96 3300009101 Ga0105247_10000445 Ga0105247_1000044517 54
97 3300009147 Ga0114129_10836180 Ga0114129_108361802 54
98 3300009148 Ga0105243_10125310 Ga0105243_101253102 54
99 3300009177 Ga0105248_13128489 Ga0105248_131284891 54
100 3300009545 Ga0105237_10097190 Ga0105237_100971901 54
101 3300009551 Ga0105238_10304212 Ga0105238_103042122 54
102 3300009551 Ga0105238_11111851 Ga0105238_111118512 54
103 3300009551 Ga0105238_13063847 Ga0105238_130638472 54
104 3300009553 Ga0105249_10793449 Ga0105249_107934493 54
105 3300010375 Ga0105239_11923186 Ga0105239_119231862 54
106 3300010375 Ga0105239_12036891 Ga0105239_120368913 54
107 3300013296 Ga0157374_12299994 Ga0157374_122999942 54
108 3300013297 Ga0157378_10116991 Ga0157378_101169914 54
109 3300013297 Ga0157378_11914418 Ga0157378_119144181 54
110 3300013306 Ga0163162_10425737 Ga0163162_104257371 54
111 3300013306 Ga0163162_12537736 Ga0163162_125377362 54
112 3300013306 Ga0163162_12720658 Ga0163162_127206581 54
113 3300013308 Ga0157375_12122290 Ga0157375_121222902 54
114 3300013308 Ga0157375_12606162 Ga0157375_126061622 54
115 3300014325 Ga0163163_10104546 Ga0163163_101045464 54
116 3300014326 Ga0157380_11427278 Ga0157380_114272782 54
117 3300014326 Ga0157380_11977849 Ga0157380_119778492 54
118 3300014745 Ga0157377_11017592 Ga0157377_110175922 54
119 3300014968 Ga0157379_10372165 Ga0157379_103721652 54
120 3300014969 Ga0157376_10700882 Ga0157376_107008822 54
121 3300014969 Ga0157376_11414032 Ga0157376_114140322 54
122 3300014969 Ga0157376_11459294 Ga0157376_114592943 54
123 3300014969 Ga0157376_12315019 Ga0157376_123150191 54
124 3300025899 Ga0207642_10595299 Ga0207642_105952992 54
125 3300025911 Ga0207654_11039977 Ga0207654_110399772 54
126 3300025913 Ga0207695_10268293 Ga0207695_102682933 54
127 3300025913 Ga0207695_11591371 Ga0207695_115913712 54
128 3300025917 Ga0207660_10062892 Ga0207660_100628923 54
129 3300025921 Ga0207652_11654181 Ga0207652_116541811 54
130 3300025924 Ga0207694_10364280 Ga0207694_103642802 54
131 3300025931 Ga0207644_10918881 Ga0207644_109188811 54
132 3300025935 Ga0207709_11543271 Ga0207709_115432712 54
133 3300025937 Ga0207669_10852960 Ga0207669_108529603 54
134 3300025937 Ga0207669_11177317 Ga0207669_111773172 54
135 3300025938 Ga0207704_11480796 Ga0207704_114807961 54
136 3300025939 Ga0207665_10504280 Ga0207665_105042802 54
137 3300025949 Ga0207667_10002474 Ga0207667_1000247412 54
138 3300025972 Ga0207668_11023721 Ga0207668_110237212 54
139 3300025986 Ga0207658_11840471 Ga0207658_118404712 54
140 3300026078 Ga0207702_10211246 Ga0207702_102112463 54
141 3300026088 Ga0207641_10087556 Ga0207641_100875564 54
142 3300026118 Ga0207675_100269291 Ga0207675_1002692912 54
143 3300026121 Ga0207683_11078888 Ga0207683_110788882 54
144 3300028379 Ga0268266_10041815 Ga0268266_100418156 54
145 3300028380 Ga0268265_10321840 Ga0268265_103218401 54
146 3300031240 Ga0265320_10493781 Ga0265320_104937812 54
147 3300031241 Ga0265325_10159064 Ga0265325_101590642 54
148 3300031616 Ga0307508_10008159 Ga0307508_100081595 54
149 3300031616 Ga0307508_10210075 Ga0307508_102100752 54
150 3300031711 Ga0265314_10447142 Ga0265314_104471422 54
151 3300033179 Ga0307507_10015952 Ga0307507_100159527 54
152 3300033179 Ga0307507_10042082 Ga0307507_100420824 54
153 3300035692 Ga0373935_0630278 Ga0373935_0630278_155_337 54
154 3300035725 Ga0373947_0037844 Ga0373947_0037844_1813_1995 54
155 3300037466 Ga0395898_0002853 Ga0395898_0002853_13533_13700 54
156 3300037853 Ga0436364_1052799 Ga0436364_1052799_237_404 54
157 3300039437 Ga0436365_0744968 Ga0436365_0744968_205_396 54
158 3300039437 Ga0436365_1125171 Ga0436365_1125171_325_501 54
159 3300039437 Ga0436365_1317264 Ga0436365_1317264_2000_2188 54
160 3300044658 Ga0466972_0092985 Ga0466972_0092985_663_830 54
161 3300044684 Ga0466966_0418509 Ga0466966_0418509_22_189 54
162 3300044706 Ga0466964_0164327 Ga0466964_0164327_674_841 54
163 3300044706 Ga0466964_0267802 Ga0466964_0267802_604_771 54
164 3300045049 Ga0466959_0023858 Ga0466959_0023858_1955_2122 54
165 3300045049 Ga0466959_0254746 Ga0466959_0254746_391_558 54
166 3300045836 Ga0466958_0706090 Ga0466958_0706090_439_606 54
167 3300045976 Ga0466967_0543392 Ga0466967_0543392_187_354 54
168 3300045976 Ga0466967_2075675 Ga0466967_2075675_255_425 54
169 3300046459 Ga0495629_0537981 Ga0495629_0537981_170_349 54
170 3300046473 Ga0495582_0652105 Ga0495582_0652105_274_453 54
171 3300046473 Ga0495582_0908481 Ga0495582_0908481_288_467 54
172 3300046500 Ga0495596_0421434 Ga0495596_0421434_262_429 54
173 3300046511 Ga0495608_0071184 Ga0495608_0071184_1120_1299 54
174 3300046517 Ga0495630_0910044 Ga0495630_0910044_101_283 54
175 3300046616 Ga0495668_0571818 Ga0495668_0571818_317_484 54
176 3300046660 Ga0495625_0793943 Ga0495625_0793943_246_413 54
177 3300046663 Ga0495635_0153837 Ga0495635_0153837_163_342 54
178 3300046678 Ga0495599_0385069 Ga0495599_0385069_387_566 54
179 3300046681 Ga0495647_0108783 Ga0495647_0108783_336_515 54
180 3300046691 Ga0495670_0125251 Ga0495670_0125251_1061_1243 54
181 3300046809 Ga0495600_0727953 Ga0495600_0727953_359_538 54
182 3300047315 Ga0495581_0354184 Ga0495581_0354184_122_322 54
183 3300047319 Ga0495674_0639685 Ga0495674_0639685_77_259 54
184 3300047319 Ga0495674_0748157 Ga0495674_0748157_578_745 54
185 3300047321 Ga0495676_0223125 Ga0495676_0223125_609_788 54
186 3300047322 Ga0495680_0358529 Ga0495680_0358529_755_934 54
187 3300047471 Ga0495684_0858262 Ga0495684_0858262_146_328 54
188 3300048089 Ga0495614_0484157 Ga0495614_0484157_251_433 54
189 3300048090 Ga0495615_0264616 Ga0495615_0264616_335_520 54
190 3300048903 Ga0496100_0200455 Ga0496100_0200455_128_295 54
191 3300048917 Ga0496114_0293848 Ga0496114_0293848_512_712 54
192 3300048924 Ga0496121_0009623 Ga0496121_0009623_10632_10799 54
193 3300048928 Ga0496125_0012911 Ga0496125_0012911_7329_7496 54
194 3300049576 Ga0501040_1191197 Ga0501040_1191197_369_536 54
195 3300049742 Ga0501080_0494383 Ga0501080_0494383_685_885 54
196 3300049742 Ga0501080_0983355 Ga0501080_0983355_24_197 54
197 3300050491 nmdc:mga00v17_306890_c1 nmdc:mga00v17_306890_c1_164_334 54
198 3300050494 nmdc:mga06z11_721266_c1 nmdc:mga06z11_721266_c1_379_549 54
199 3300050507 nmdc:mga05p37_961113_c1 nmdc:mga05p37_961113_c1_662_829 54
200 3300050510 nmdc:mga06r32_1671491_c1 nmdc:mga06r32_1671491_c1_182_349 54
201 3300053077 Ga0495601_0350519 Ga0495601_0350519_136_315 54
202 3300053084 Ga0495595_0192740 Ga0495595_0192740_197_376 54
203 3300053085 Ga0495619_0173144 Ga0495619_0173144_33_212 54
204 3300053085 Ga0495619_0963936 Ga0495619_0963936_203_382 54
205 3300053086 Ga0500578_0711270 Ga0500578_0711270_28_195 54
206 3300053090 Ga0500646_0010672 Ga0500646_0010672_309_476 54
207 3300053134 Ga0500658_0152942 Ga0500658_0152942_732_899 54
208 3300053153 Ga0500616_0001333 Ga0500616_0001333_21227_21394 54
209 3300053178 Ga0500637_0029679 Ga0500637_0029679_432_599 54
210 3300059421 Ga0590071_190832 Ga0590071_190832_156_335 54
211 3300061719 Ga0466962_0465443 Ga0466962_0465443_122_289 54

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01402

RHH_1

Ribbon-helix-helix protein, copG family

13

51

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xrw-assembly2.cif.gz_D-2 chromosomal parde ta system from p. aeruginosa 0.9052 5 44
4me7-assembly1.cif.gz_E crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze 0.8977 5 46
7etr-assembly1.cif.gz_B crystal structure of so_1444-so_1445 complex from shewanella oneidensis 0.8748 6 48
6iya-assembly2.cif.gz_C structure of the dna binding domain of antitoxin copaso 0.8745 6 48
6iya-assembly2.cif.gz_D structure of the dna binding domain of antitoxin copaso 0.8722 5 48
ID Description Score Start End Superfamily
1b28B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8548 3 45 1.10.1220.10
1bazD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8538 5 43 1.10.1220.10
4me7E00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8479 5 46 1.10.1220.10
2hzvA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8471 6 45 1.10.1220.10
2hzvG01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8449 6 45 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A1C0VDF4-F1-model_v4 CopG family transcriptional regulator 0.9404 2 44 GO:0006355
AF-A0A7J9WWG7-F1-model_v4 DNA-binding protein 0.933 1 47 GO:0003677
AF-A0A2G9MEG4-F1-model_v4 CopG family transcriptional regulator 0.9228 1 46 GO:0006355
AF-A0A1X2DW50-F1-model_v4 Uncharacterized protein 0.9182 1 41
AF-A0A6J4SCB0-F1-model_v4 Helix-turn-helix domain-containing protein 0.912 1 47 GO:0003677
GO:0006355

Feature Viewer

pLDDT pTM Quality
85.75 0.58 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map