F321494

General Info

Members Datasets Scaffolds Average Seq Length
211 83 422 287

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10110076|Ga0075433_101100762
Length 290
Sequence MLQSKRGSIPAKAGIGLRFPHHQAVVDTRPEVAWLEAHTENYMGGGTSLRYLETIRRDYPLSLHGVGLSLGSAEEIDAAHLTRVQHVVERIEPGLVSEHLSWSIVGSVYLADLLPLPMTEEALAIVCRHVDQTQATLKRRLLIENPSTYLRFRHSTIPEWEFLSRVAERTGCGILCDVNNIYVSACNHGWDPATYLAGLPPAAIGEIHLAGHAERQLNNGNTLRIDDHGSCVAPAVWALYAEALARFGPVPTLVEWDTNVPPLEVLLGEAARANVMLEETDREYAAADAA

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
3 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
4 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
41 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
43 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
44 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
45 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
46 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
47 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
48 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
49 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
50 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
51 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
52 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
53 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
54 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
55 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
56 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
57 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
59 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
60 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
61 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
62 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
63 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
64 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
65 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
66 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
67 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
70 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
71 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
72 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
78 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
79 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
80 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
81 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
82 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
83 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.47
Rhizosphere 99.53
Stem 0
Stem Tuber 0
Unclassified 9.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10110076 3300006852 Bacteria 2444
2 Ga0070701_10122912 3300005438 Bacteria 1465
3 Ga0070708_100002298 3300005445 Bacteria 14798
4 Ga0070708_100008346 3300005445 Bacteria 8318
5 Ga0070708_100016190 3300005445 Bacteria 6181
6 Ga0070708_100040833 3300005445 Bacteria 4065
7 Ga0070708_100074462 3300005445 Archaea 3062
8 Ga0070708_100138169 3300005445 Bacteria 2258
9 Ga0070708_100191365 3300005445 Unclassified 1913
10 Ga0070708_100331583 3300005445 Bacteria 1434
11 Ga0068867_100609461 3300005459 Bacteria 953
12 Ga0070706_100004515 3300005467 Bacteria 13400
13 Ga0070706_100064951 3300005467 Archaea 3374
14 Ga0070706_100211149 3300005467 Bacteria 1813
15 Ga0070706_100219434 3300005467 Bacteria 1775
16 Ga0070706_100222404 3300005467 Bacteria 1762
17 Ga0070706_100283334 3300005467 Bacteria 1547
18 Ga0070707_100021243 3300005468 Bacteria 6135
19 Ga0070707_100026737 3300005468 Bacteria 5482
20 Ga0070707_100028549 3300005468 Bacteria 5311
21 Ga0070707_100029962 3300005468 Bacteria 5179
22 Ga0070707_100239774 3300005468 Bacteria 1765
23 Ga0070698_100031328 3300005471 Bacteria 5514
24 Ga0070698_100176887 3300005471 Bacteria 2073
25 Ga0070698_100206734 3300005471 Bacteria 1898
26 Ga0070698_100344527 3300005471 Bacteria 1421
27 Ga0070699_100003147 3300005518 Bacteria 14603
28 Ga0070697_100029306 3300005536 Bacteria 4412
29 Ga0070697_100132392 3300005536 Bacteria 2092
30 Ga0068859_100105911 3300005617 Bacteria 2871
31 Ga0068859_100223854 3300005617 Bacteria 1969
32 Ga0068858_100210805 3300005842 Bacteria 1838
33 Ga0068862_100181811 3300005844 Bacteria 1888
34 Ga0081455_10042936 3300005937 Bacteria 3961
35 Ga0081538_10001736 3300005981 Bacteria 22142
36 Ga0081540_1075795 3300005983 Bacteria 1536
37 Ga0075428_100013525 3300006844 Bacteria 9084
38 Ga0075428_100015568 3300006844 Bacteria 8430
39 Ga0075428_100132975 3300006844 Bacteria 2705
40 Ga0075428_100575603 3300006844 Bacteria 1203
41 Ga0075430_100210369 3300006846 Unclassified 1614
42 Ga0075431_100034953 3300006847 Bacteria 5176
43 Ga0075431_100082715 3300006847 Bacteria 3314
44 Ga0075433_10233510 3300006852 Unclassified 1633
45 Ga0075434_100015107 3300006871 Bacteria 7395
46 Ga0075434_100026484 3300006871 Bacteria 5682
47 Ga0075434_100052687 3300006871 Bacteria 4044
48 Ga0075434_100195821 3300006871 Bacteria 2041
49 Ga0075429_100007221 3300006880 Bacteria 9641
50 Ga0075429_100120734 3300006880 Bacteria 2291
51 Ga0075429_100165476 3300006880 Bacteria 1937
52 Ga0075436_100006688 3300006914 Bacteria 7892
53 Ga0075436_100033089 3300006914 Bacteria 3563
54 Ga0075436_100125395 3300006914 Bacteria 1799
55 Ga0097620_100105910 3300006931 Bacteria 2871
56 Ga0097620_100223838 3300006931 Bacteria 1969
57 Ga0075435_100009753 3300007076 Bacteria 6982
58 Ga0075435_100032895 3300007076 Bacteria 4098
59 Ga0075435_100082550 3300007076 Bacteria 2642
60 Ga0075435_100191009 3300007076 Bacteria 1733
61 Ga0075435_100426204 3300007076 Bacteria 1143
62 Ga0075435_100448707 3300007076 Unclassified 1112
63 Ga0105240_10094777 3300009093 Bacteria 3640
64 Ga0111539_10613090 3300009094 Unclassified 1267
65 Ga0105245_10453332 3300009098 Unclassified 1291
66 Ga0114129_10007470 3300009147 Bacteria 15570
67 Ga0114129_10008372 3300009147 Bacteria 14735
68 Ga0114129_10012353 3300009147 Bacteria 12156
69 Ga0114129_10040667 3300009147 Bacteria 6553
70 Ga0114129_10091109 3300009147 Bacteria 4226
71 Ga0114129_10186641 3300009147 Bacteria 2818
72 Ga0105248_10036490 3300009177 Bacteria 5498
73 Ga0105249_10211253 3300009553 Bacteria 1905
74 Ga0105249_10355706 3300009553 Bacteria 1485
75 Ga0163162_10021494 3300013306 Bacteria 6357
76 Ga0157379_10109555 3300014968 Bacteria 2480
77 Ga0157379_10556865 3300014968 Bacteria 1067
78 Ga0207684_10001149 3300025910 Bacteria 29548
79 Ga0207684_10001862 3300025910 Bacteria 21965
80 Ga0207684_10007952 3300025910 Bacteria 9477
81 Ga0207684_10087169 3300025910 Archaea 2659
82 Ga0207684_10103363 3300025910 Bacteria 2436
83 Ga0207684_10155412 3300025910 Bacteria 1969
84 Ga0207662_10149728 3300025918 Bacteria 1483
85 Ga0207646_10007279 3300025922 Bacteria 11279
86 Ga0207646_10024669 3300025922 Bacteria 5507
87 Ga0207646_10128433 3300025922 Archaea 2280
88 Ga0207646_10144857 3300025922 Bacteria 2140
89 Ga0207711_10091661 3300025941 Bacteria 2673
90 Ga0207711_10297964 3300025941 Bacteria 1487
91 Ga0207703_10217735 3300026035 Bacteria 1706
92 Ga0207641_10313182 3300026088 Unclassified 1486
93 Ga0207674_10436787 3300026116 Bacteria 1265
94 Ga0207675_100153588 3300026118 Bacteria 2192
95 Ga0207675_100180337 3300026118 Bacteria 2022
96 Ga0207428_10119083 3300027907 Bacteria 2026
97 Ga0268265_10059353 3300028380 Bacteria 2926
98 Ga0453684_0142298 3300044712 Bacteria 2862
99 Ga0453684_0715715 3300044712 Unclassified 1087
100 Ga0451576_0208486 3300045051 Bacteria 2041
101 Ga0495672_0243551 3300047320 Bacteria 876
102 Ga0496112_0286704 3300048915 Unclassified 1593
103 Ga0501031_0010852 3300049568 Bacteria 5933
104 Ga0501032_0112238 3300049569 Bacteria 1803
105 Ga0501033_0031393 3300049570 Bacteria 3992
106 Ga0501033_0052239 3300049570 Bacteria 3029
107 Ga0501036_0011447 3300049572 Bacteria 7345
108 Ga0501036_0475499 3300049572 Bacteria 1040
109 Ga0501037_0179206 3300049573 Bacteria 1504
110 Ga0501037_0260965 3300049573 Bacteria 1210
111 Ga0501038_0002451 3300049574 Bacteria 17280
112 Ga0501039_0002102 3300049575 Bacteria 14754
113 Ga0501039_0018030 3300049575 Bacteria 5415
114 Ga0501039_0078994 3300049575 Unclassified 2560
115 Ga0501039_0257309 3300049575 Bacteria 1372
116 Ga0501040_0000693 3300049576 Bacteria 20769
117 Ga0501040_0007852 3300049576 Archaea 6914
118 Ga0501041_0000202 3300049577 Bacteria 27560
119 Ga0501041_0048432 3300049577 Archaea 2589
120 Ga0501041_0085827 3300049577 Bacteria 1941
121 Ga0501041_0172413 3300049577 Unclassified 1354
122 Ga0501042_0002845 3300049578 Bacteria 10726
123 Ga0501042_0003597 3300049578 Bacteria 9773
124 Ga0501042_0082525 3300049578 Unclassified 2304
125 Ga0501043_0005282 3300049579 Bacteria 10442
126 Ga0501046_0002966 3300049580 Bacteria 15699
127 Ga0501046_0006204 3300049580 Bacteria 10613
128 Ga0501046_0234551 3300049580 Unclassified 1355
129 Ga0501048_0013143 3300049582 Archaea 6146
130 Ga0501048_0043849 3300049582 Bacteria 3200
131 Ga0501048_0089477 3300049582 Bacteria 2172
132 Ga0501068_0007514 3300049584 Bacteria 6032
133 Ga0501070_0054619 3300049586 Bacteria 3312
134 Ga0501071_0010874 3300049587 Bacteria 6106
135 Ga0501071_0260014 3300049587 Bacteria 1311
136 Ga0501072_0001364 3300049588 Bacteria 18342
137 Ga0501072_0006169 3300049588 Bacteria 9135
138 Ga0501072_0070230 3300049588 Bacteria 2765
139 Ga0501072_0135298 3300049588 Bacteria 1965
140 Ga0501074_0054231 3300049590 Bacteria 2891
141 Ga0501075_0000010 3300049591 Bacteria 87481
142 Ga0501075_0006503 3300049591 Bacteria 8044
143 Ga0501075_0014849 3300049591 Bacteria 5585
144 Ga0501075_0088973 3300049591 Bacteria 2341
145 Ga0501075_0334566 3300049591 Unclassified 1154
146 Ga0501075_0388964 3300049591 Bacteria 1063
147 Ga0501076_0000027 3300049592 Bacteria 78077
148 Ga0501076_0002029 3300049592 Bacteria 13858
149 Ga0501076_0039366 3300049592 Unclassified 3711
150 Ga0501076_0140809 3300049592 Bacteria 1959
151 Ga0501076_0265768 3300049592 Bacteria 1405
152 Ga0501077_0001321 3300049593 Bacteria 14976
153 Ga0501077_0025023 3300049593 Bacteria 3791
154 Ga0501079_0001812 3300049741 Bacteria 15267
155 Ga0501079_0035057 3300049741 Bacteria 3861
156 Ga0501079_0052299 3300049741 Unclassified 3152
157 Ga0501079_0118535 3300049741 Bacteria 2058
158 Ga0501080_0001316 3300049742 Bacteria 20671
159 Ga0501080_0012009 3300049742 Bacteria 7931
160 Ga0501081_0000860 3300049743 Bacteria 17950
161 Ga0501081_0002198 3300049743 Bacteria 12264
162 Ga0501081_0033960 3300049743 Bacteria 3469
163 Ga0501083_0018832 3300049744 Bacteria 4808
164 Ga0501083_0141311 3300049744 Unclassified 1577
165 Ga0501083_0330049 3300049744 Bacteria 992
166 Ga0501035_0006000 3300049822 Bacteria 11441
167 Ga0501044_0285536 3300049823 Bacteria 1583
168 Ga0501045_0000945 3300049824 Bacteria 19005
169 Ga0501045_0012410 3300049824 Archaea 6000
170 Ga0501045_0092930 3300049824 Bacteria 2231
171 Ga0501045_0197028 3300049824 Unclassified 1501
172 nmdc:mga05p37_117852_c1 3300050507 Bacteria 3263
173 nmdc:mga05p37_13872_c1 3300050507 Bacteria 9656
174 nmdc:mga05p37_194909_c1 3300050507 Bacteria 2457
175 nmdc:mga05p37_30079_c1 3300050507 Bacteria 6627
176 nmdc:mga05p37_5106_c1 3300050507 Bacteria 15398
177 nmdc:mga05p37_96835_c1 3300050507 Bacteria 3636
178 nmdc:mga09592_124021_c1 3300050508 Bacteria 2220
179 nmdc:mga09592_170179_c1 3300050508 Unclassified 1884
180 nmdc:mga09592_207451_c1 3300050508 Bacteria 1697
181 nmdc:mga06r32_42149_c1 3300050510 Bacteria 4339
182 nmdc:mga06r32_58012_c1 3300050510 Bacteria 3720
183 nmdc:mga0n895_110686_c1 3300050512 Bacteria 2762
184 nmdc:mga0n895_136362_c1 3300050512 Bacteria 2481
185 nmdc:mga0n895_18611_c1 3300050512 Bacteria 6432
186 nmdc:mga0n895_21353_c1 3300050512 Bacteria 6052
187 nmdc:mga0n895_426170_c1 3300050512 Bacteria 1341
188 nmdc:mga0rr50_180285_c1 3300050513 Bacteria 1726
189 nmdc:mga0rr50_249037_c1 3300050513 Bacteria 1475
190 nmdc:mga0rr50_27833_c1 3300050513 Bacteria 3965
191 nmdc:mga0rr50_305178_c1 3300050513 Bacteria 1332
192 nmdc:mga0rr50_587556_c1 3300050513 Bacteria 949
193 nmdc:mga08x19_13141_c1 3300050514 Bacteria 5001
194 nmdc:mga08x19_31532_c1 3300050514 Bacteria 3334
195 nmdc:mga0a205_117073_c1 3300050515 Bacteria 2563
196 nmdc:mga0a205_128187_c1 3300050515 Bacteria 2437
197 nmdc:mga0a205_241336_c1 3300050515 Unclassified 1688
198 Ga0501084_0007150 3300054114 Bacteria 9195
199 Ga0501084_0014917 3300054114 Bacteria 6443
200 Ga0501084_0019204 3300054114 Bacteria 5693
201 Ga0501084_0158020 3300054114 Bacteria 1912
202 Ga0501084_0164764 3300054114 Bacteria 1871
203 Ga0501084_0215753 3300054114 Bacteria 1619
204 Ga0501082_0000780 3300060353 Bacteria 27961
205 Ga0501082_0007251 3300060353 Bacteria 9563
206 Ga0501082_0080313 3300060353 Bacteria 2814
207 Ga0501082_0446328 3300060353 Unclassified 1130
208 Ga0530510_0000010 3300061734 Bacteria 155647
209 Ga0530510_0001114 3300061734 Bacteria 17856
210 Ga0530510_0001611 3300061734 Bacteria 15227
211 Ga0530510_0087086 3300061734 Bacteria 2276
212 Ga0075433_10110076
213 Ga0070701_10122912
214 Ga0070708_100002298
215 Ga0070708_100008346
216 Ga0070708_100016190
217 Ga0070708_100040833
218 Ga0070708_100074462
219 Ga0070708_100138169
220 Ga0070708_100191365
221 Ga0070708_100331583
222 Ga0068867_100609461
223 Ga0070706_100004515
224 Ga0070706_100064951
225 Ga0070706_100211149
226 Ga0070706_100219434
227 Ga0070706_100222404
228 Ga0070706_100283334
229 Ga0070707_100021243
230 Ga0070707_100026737
231 Ga0070707_100028549
232 Ga0070707_100029962
233 Ga0070707_100239774
234 Ga0070698_100031328
235 Ga0070698_100176887
236 Ga0070698_100206734
237 Ga0070698_100344527
238 Ga0070699_100003147
239 Ga0070697_100029306
240 Ga0070697_100132392
241 Ga0068859_100105911
242 Ga0068859_100223854
243 Ga0068858_100210805
244 Ga0068862_100181811
245 Ga0081455_10042936
246 Ga0081538_10001736
247 Ga0081540_1075795
248 Ga0075428_100013525
249 Ga0075428_100015568
250 Ga0075428_100132975
251 Ga0075428_100575603
252 Ga0075430_100210369
253 Ga0075431_100034953
254 Ga0075431_100082715
255 Ga0075433_10233510
256 Ga0075434_100015107
257 Ga0075434_100026484
258 Ga0075434_100052687
259 Ga0075434_100195821
260 Ga0075429_100007221
261 Ga0075429_100120734
262 Ga0075429_100165476
263 Ga0075436_100006688
264 Ga0075436_100033089
265 Ga0075436_100125395
266 Ga0097620_100105910
267 Ga0097620_100223838
268 Ga0075435_100009753
269 Ga0075435_100032895
270 Ga0075435_100082550
271 Ga0075435_100191009
272 Ga0075435_100426204
273 Ga0075435_100448707
274 Ga0105240_10094777
275 Ga0111539_10613090
276 Ga0105245_10453332
277 Ga0114129_10007470
278 Ga0114129_10008372
279 Ga0114129_10012353
280 Ga0114129_10040667
281 Ga0114129_10091109
282 Ga0114129_10186641
283 Ga0105248_10036490
284 Ga0105249_10211253
285 Ga0105249_10355706
286 Ga0163162_10021494
287 Ga0157379_10109555
288 Ga0157379_10556865
289 Ga0207684_10001149
290 Ga0207684_10001862
291 Ga0207684_10007952
292 Ga0207684_10087169
293 Ga0207684_10103363
294 Ga0207684_10155412
295 Ga0207662_10149728
296 Ga0207646_10007279
297 Ga0207646_10024669
298 Ga0207646_10128433
299 Ga0207646_10144857
300 Ga0207711_10091661
301 Ga0207711_10297964
302 Ga0207703_10217735
303 Ga0207641_10313182
304 Ga0207674_10436787
305 Ga0207675_100153588
306 Ga0207675_100180337
307 Ga0207428_10119083
308 Ga0268265_10059353
309 Ga0453684_0142298
310 Ga0453684_0715715
311 Ga0451576_0208486
312 Ga0495672_0243551
313 Ga0496112_0286704
314 Ga0501031_0010852
315 Ga0501032_0112238
316 Ga0501033_0031393
317 Ga0501033_0052239
318 Ga0501036_0011447
319 Ga0501036_0475499
320 Ga0501037_0179206
321 Ga0501037_0260965
322 Ga0501038_0002451
323 Ga0501039_0002102
324 Ga0501039_0018030
325 Ga0501039_0078994
326 Ga0501039_0257309
327 Ga0501040_0000693
328 Ga0501040_0007852
329 Ga0501041_0000202
330 Ga0501041_0048432
331 Ga0501041_0085827
332 Ga0501041_0172413
333 Ga0501042_0002845
334 Ga0501042_0003597
335 Ga0501042_0082525
336 Ga0501043_0005282
337 Ga0501046_0002966
338 Ga0501046_0006204
339 Ga0501046_0234551
340 Ga0501048_0013143
341 Ga0501048_0043849
342 Ga0501048_0089477
343 Ga0501068_0007514
344 Ga0501070_0054619
345 Ga0501071_0010874
346 Ga0501071_0260014
347 Ga0501072_0001364
348 Ga0501072_0006169
349 Ga0501072_0070230
350 Ga0501072_0135298
351 Ga0501074_0054231
352 Ga0501075_0000010
353 Ga0501075_0006503
354 Ga0501075_0014849
355 Ga0501075_0088973
356 Ga0501075_0334566
357 Ga0501075_0388964
358 Ga0501076_0000027
359 Ga0501076_0002029
360 Ga0501076_0039366
361 Ga0501076_0140809
362 Ga0501076_0265768
363 Ga0501077_0001321
364 Ga0501077_0025023
365 Ga0501079_0001812
366 Ga0501079_0035057
367 Ga0501079_0052299
368 Ga0501079_0118535
369 Ga0501080_0001316
370 Ga0501080_0012009
371 Ga0501081_0000860
372 Ga0501081_0002198
373 Ga0501081_0033960
374 Ga0501083_0018832
375 Ga0501083_0141311
376 Ga0501083_0330049
377 Ga0501035_0006000
378 Ga0501044_0285536
379 Ga0501045_0000945
380 Ga0501045_0012410
381 Ga0501045_0092930
382 Ga0501045_0197028
383 nmdc:mga05p37_117852_c1
384 nmdc:mga05p37_13872_c1
385 nmdc:mga05p37_194909_c1
386 nmdc:mga05p37_30079_c1
387 nmdc:mga05p37_5106_c1
388 nmdc:mga05p37_96835_c1
389 nmdc:mga09592_124021_c1
390 nmdc:mga09592_170179_c1
391 nmdc:mga09592_207451_c1
392 nmdc:mga06r32_42149_c1
393 nmdc:mga06r32_58012_c1
394 nmdc:mga0n895_110686_c1
395 nmdc:mga0n895_136362_c1
396 nmdc:mga0n895_18611_c1
397 nmdc:mga0n895_21353_c1
398 nmdc:mga0n895_426170_c1
399 nmdc:mga0rr50_180285_c1
400 nmdc:mga0rr50_249037_c1
401 nmdc:mga0rr50_27833_c1
402 nmdc:mga0rr50_305178_c1
403 nmdc:mga0rr50_587556_c1
404 nmdc:mga08x19_13141_c1
405 nmdc:mga08x19_31532_c1
406 nmdc:mga0a205_117073_c1
407 nmdc:mga0a205_128187_c1
408 nmdc:mga0a205_241336_c1
409 Ga0501084_0007150
410 Ga0501084_0014917
411 Ga0501084_0019204
412 Ga0501084_0158020
413 Ga0501084_0164764
414 Ga0501084_0215753
415 Ga0501082_0000780
416 Ga0501082_0007251
417 Ga0501082_0080313
418 Ga0501082_0446328
419 Ga0530510_0000010
420 Ga0530510_0001114
421 Ga0530510_0001611
422 Ga0530510_0087086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05114

DUF692

Protein of unknown function (DUF692)

12

278

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.9176 23 287
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8547 23 289
3bww-assembly1.cif.gz_A crystal structure of a duf692 family protein (hs_1138) from haemophilus somnus 129pt at 2.20 a resolution 0.8515 23 287
7fc0-assembly1.cif.gz_B reconstitution of mbnabc complex from rugamonas rubra atcc-43154 (groupiii) 0.8487 23 289
7tcx-assembly1.cif.gz_A methanobactin biosynthetic protein complex of mbnb and mbnc from methylosinus trichosporium ob3b at 2.21 angstrom resolution 0.8205 23 286
ID Description Score Start End Superfamily
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9102 23 287 3.20.20.150
3bwwA01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8468 23 287 3.20.20.150
af_Q4DGY9_46_264_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6555 68 181 3.20.20.70
3vnmD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.6464 24 287 3.20.20.150
1yx1C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.643 23 288 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A530QG49-F1-model_v4 DUF692 domain-containing protein 0.9917 181 286
AF-A0A1J5N389-F1-model_v4 DUF692 domain-containing protein 0.9915 127 287
AF-A0A529ZIH0-F1-model_v4 DUF692 domain-containing protein 0.9914 152 285
AF-A0A532AGY2-F1-model_v4 DUF692 domain-containing protein 0.9914 130 220
AF-A0A522MAJ4-F1-model_v4 DUF692 domain-containing protein 0.9906 130 287

Map