F321357

General Info

Members Datasets Scaffolds Average Seq Length
211 138 422 492

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100006826|Ga0070698_1000068263
Length 559
Sequence VITRREQFSRSSVADTNPVALWIIGVISVVLFLTTNLPWQLDDYDQAKQAFTSFQMIKEGHWFYQGTPRERVATKPPLIGWISAGTFAITRSWDVAWRLPSLLAALAISVILFRAATAFERDGSSRLVPPSGGEKSHRSPTSLPTSVLIATSAFVFNLLTPRLATLVRTDMPLALFVFAIGLLIWQKIRGREQWNSRDRVWIFALLTAAMLIKGPIVCAFLLPGILAFEIRGGRRHRPSRTGTGHHSAWCGWWPWLASLGIFLVWVIGGSILVPGFFDQVVMREFLARFGETVHRAQPLLFYLPHLLHKFFPWTVLMIALAIIDLRARRWKIGAAFWEMAPETVWLIYWVFGGLVVMSIIPSKRVDRIFPIIPPLCLLLAVQIGKSPTCCSHGSASRPSLRSDVKQTGHPQSFGEASRPMATGNELMRPRVLRWSLAALLTSILFTSGYTVAKVVSGYRVRRDALAVFGHAVRNEAAAHNWRYEVLKTGDEGLLLYLERTHFIEPHRAVVEWNRGNLDALVAPADTAPALMGDLHDAALSRLTSDQRGNHGGAYVLISR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
99 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
117 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.74
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 26.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100006826 3300005471 Bacteria 12372
2 CNXas_1000010 3300000545 Bacteria 39918
3 JGI24033J26618_1000417 3300002155 Bacteria 4246
4 JGI25406J46586_10000090 3300003203 Bacteria 41533
5 rootH2_10000703 3300003320 Bacteria 17289
6 rootL2_10326158 3300003322 Unclassified 1670
7 rootH1_10011269 3300003323 Bacteria 45119
8 Ga0065712_10007611 3300005290 Unclassified 3002
9 Ga0065715_10003039 3300005293 Bacteria 4674
10 Ga0065715_10089345 3300005293 Bacteria 11017
11 Ga0070676_10012024 3300005328 Unclassified 4717
12 Ga0070676_10016099 3300005328 Bacteria 4131
13 Ga0070670_100000645 3300005331 Bacteria 27103
14 Ga0070670_100007091 3300005331 Bacteria 9489
15 Ga0070670_100031230 3300005331 Unclassified 4586
16 Ga0070677_10002902 3300005333 Bacteria 5506
17 Ga0068869_100014254 3300005334 Bacteria 5307
18 Ga0070666_10012354 3300005335 Bacteria 5384
19 Ga0070666_10019823 3300005335 Unclassified 4344
20 Ga0068868_100014437 3300005338 Bacteria 5820
21 Ga0070687_100000749 3300005343 Bacteria 10778
22 Ga0070661_100000650 3300005344 Bacteria 25597
23 Ga0070668_100006616 3300005347 Bacteria 8587
24 Ga0070668_100006983 3300005347 Bacteria 8364
25 Ga0070668_100173084 3300005347 Unclassified 1759
26 Ga0070669_100001053 3300005353 Bacteria 20176
27 Ga0070669_100064999 3300005353 Bacteria 2687
28 Ga0070675_100000362 3300005354 Bacteria 30738
29 Ga0070675_100048809 3300005354 Bacteria 3472
30 Ga0070675_100108600 3300005354 Bacteria 2343
31 Ga0070671_100000652 3300005355 Bacteria 24926
32 Ga0070671_100016244 3300005355 Bacteria 6020
33 Ga0070671_100018643 3300005355 Bacteria 5639
34 Ga0070674_100046126 3300005356 Unclassified 2980
35 Ga0070673_100007005 3300005364 Bacteria 7390
36 Ga0070673_100008707 3300005364 Bacteria 6769
37 Ga0070673_100063615 3300005364 Bacteria 2936
38 Ga0070673_100088926 3300005364 Unclassified 2520
39 Ga0070688_100043889 3300005365 Bacteria 2757
40 Ga0070659_100013994 3300005366 Bacteria 5987
41 Ga0070711_100009404 3300005439 Bacteria 6021
42 Ga0070711_100041545 3300005439 Bacteria 3106
43 Ga0070708_100136467 3300005445 Unclassified 2273
44 Ga0070678_100001778 3300005456 Bacteria 11618
45 Ga0070662_100000681 3300005457 Bacteria 20752
46 Ga0070662_100012184 3300005457 Bacteria 5696
47 Ga0070706_100000324 3300005467 Bacteria 58179
48 Ga0070706_100020796 3300005467 Bacteria 6042
49 Ga0070707_100015936 3300005468 Bacteria 7055
50 Ga0070707_100057312 3300005468 Bacteria 3737
51 Ga0070698_100004108 3300005471 Bacteria 15997
52 Ga0070698_100029403 3300005471 Bacteria 5705
53 Ga0070698_100040816 3300005471 Unclassified 4767
54 Ga0070699_100157659 3300005518 Unclassified 2009
55 Ga0070697_100002367 3300005536 Bacteria 14504
56 Ga0070697_100042298 3300005536 Unclassified 3687
57 Ga0070697_100076717 3300005536 Unclassified 2748
58 Ga0070672_100029084 3300005543 Bacteria 4140
59 Ga0070665_100073249 3300005548 Unclassified 3432
60 Ga0068856_100001893 3300005614 Bacteria 21811
61 Ga0068856_100069835 3300005614 Unclassified 3474
62 Ga0068860_100047854 3300005843 Unclassified 4076
63 Ga0081455_10023479 3300005937 Bacteria 5736
64 Ga0081455_10029717 3300005937 Unclassified 4979
65 Ga0081539_10001036 3300005985 Bacteria 51273
66 Ga0081539_10021706 3300005985 Bacteria 4276
67 Ga0070717_10000833 3300006028 Bacteria 20376
68 Ga0070712_100005769 3300006175 Bacteria 7650
69 Ga0070712_100014554 3300006175 Bacteria 5049
70 Ga0097621_100054313 3300006237 Unclassified 3267
71 Ga0068871_100012163 3300006358 Bacteria 6335
72 Ga0068865_100013030 3300006881 Bacteria 5244
73 Ga0075436_100039413 3300006914 Unclassified 3261
74 Ga0105240_10180218 3300009093 Bacteria 2494
75 Ga0111539_10182362 3300009094 Unclassified 2452
76 Ga0105245_10009580 3300009098 Bacteria 8449
77 Ga0114129_10052213 3300009147 Bacteria 5737
78 Ga0105249_10006502 3300009553 Bacteria 10166
79 Ga0099796_10035418 3300010159 Unclassified 1656
80 Ga0105239_10043855 3300010375 Bacteria 4904
81 Ga0157371_10181706 3300013102 Unclassified 1504
82 Ga0157374_10002132 3300013296 Bacteria 16666
83 Ga0157374_10018127 3300013296 Bacteria 6210
84 Ga0157374_10022296 3300013296 Bacteria 5648
85 Ga0157374_10081427 3300013296 Bacteria 3072
86 Ga0157374_10204754 3300013296 Bacteria 1933
87 Ga0157378_10001822 3300013297 Bacteria 19113
88 Ga0157378_10007982 3300013297 Bacteria 9241
89 Ga0157378_10027536 3300013297 Bacteria 5015
90 Ga0157378_10099536 3300013297 Unclassified 2653
91 Ga0157378_10119800 3300013297 Bacteria 2424
92 Ga0163162_10001659 3300013306 Bacteria 20860
93 Ga0163162_10006328 3300013306 Bacteria 11465
94 Ga0163162_10013939 3300013306 Bacteria 7853
95 Ga0163162_10216725 3300013306 Unclassified 2044
96 Ga0157372_10025310 3300013307 Bacteria 6450
97 Ga0157372_10049055 3300013307 Unclassified 4694
98 Ga0157375_10002244 3300013308 Bacteria 16703
99 Ga0157375_10007290 3300013308 Bacteria 9677
100 Ga0157375_10132971 3300013308 Bacteria 2609
101 Ga0182008_10019947 3300014497 Unclassified 3454
102 Ga0157377_10043718 3300014745 Unclassified 2494
103 Ga0157376_10093257 3300014969 Unclassified 2613
104 Ga0163161_10007211 3300017792 Bacteria 7683
105 Ga0207697_10000084 3300025315 Bacteria 41551
106 Ga0207697_10000679 3300025315 Bacteria 19342
107 Ga0207697_10001325 3300025315 Bacteria 13629
108 Ga0207697_10004992 3300025315 Bacteria 6247
109 Ga0207697_10010551 3300025315 Bacteria 3945
110 Ga0207688_10004832 3300025901 Bacteria 7338
111 Ga0207680_10036415 3300025903 Unclassified 2834
112 Ga0207699_10010716 3300025906 Unclassified 4610
113 Ga0207645_10000107 3300025907 Bacteria 61800
114 Ga0207645_10000359 3300025907 Bacteria 37786
115 Ga0207684_10000390 3300025910 Bacteria 58658
116 Ga0207684_10016982 3300025910 Bacteria 6253
117 Ga0207693_10005905 3300025915 Bacteria 10156
118 Ga0207693_10006253 3300025915 Bacteria 9875
119 Ga0207663_10009739 3300025916 Bacteria 5087
120 Ga0207663_10058621 3300025916 Archaea 2431
121 Ga0207662_10000513 3300025918 Bacteria 17267
122 Ga0207649_10000426 3300025920 Bacteria 30823
123 Ga0207646_10001447 3300025922 Bacteria 29482
124 Ga0207646_10044688 3300025922 Unclassified 3976
125 Ga0207646_10068355 3300025922 Bacteria 3172
126 Ga0207681_10040786 3300025923 Bacteria 3091
127 Ga0207650_10037754 3300025925 Bacteria 3522
128 Ga0207659_10047323 3300025926 Unclassified 3042
129 Ga0207659_10075132 3300025926 Unclassified 2479
130 Ga0207659_10090925 3300025926 Bacteria 2279
131 Ga0207659_10138303 3300025926 Unclassified 1888
132 Ga0207700_10014743 3300025928 Bacteria 5131
133 Ga0207644_10040417 3300025931 Unclassified 3296
134 Ga0207690_10058912 3300025932 Bacteria 2600
135 Ga0207706_10000823 3300025933 Bacteria 32168
136 Ga0207706_10014621 3300025933 Bacteria 7106
137 Ga0207706_10033923 3300025933 Bacteria 4543
138 Ga0207670_10109032 3300025936 Bacteria 1992
139 Ga0207669_10012672 3300025937 Unclassified 4155
140 Ga0207665_10090483 3300025939 Unclassified 2121
141 Ga0207691_10000719 3300025940 Bacteria 32701
142 Ga0207691_10001579 3300025940 Bacteria 22610
143 Ga0207691_10082177 3300025940 Bacteria 2894
144 Ga0207689_10020761 3300025942 Bacteria 5524
145 Ga0207651_10074096 3300025960 Bacteria 2423
146 Ga0207668_10142783 3300025972 Unclassified 1843
147 Ga0207658_10013737 3300025986 Bacteria 5539
148 Ga0207658_10018230 3300025986 Bacteria 4843
149 Ga0207658_10118309 3300025986 Unclassified 2107
150 Ga0207677_10008254 3300026023 Bacteria 5804
151 Ga0207703_10079643 3300026035 Bacteria 2726
152 Ga0207702_10001879 3300026078 Bacteria 20599
153 Ga0207648_10132203 3300026089 Unclassified 2197
154 Ga0207675_100026773 3300026118 Bacteria 5367
155 Ga0209974_10012242 3300027876 Bacteria 2870
156 Ga0268266_10016835 3300028379 Bacteria 6247
157 Ga0268265_10008758 3300028380 Bacteria 6836
158 Ga0268264_10060737 3300028381 Unclassified 3168
159 Ga0373943_0023971 3300035170 Unclassified 2842
160 Ga0373943_0028795 3300035170 Bacteria 2620
161 Ga0373955_0017847 3300035172 Unclassified 3518
162 Ga0373935_0016078 3300035692 Bacteria 4528
163 Ga0373935_0076329 3300035692 Unclassified 2170
164 Ga0373937_0098913 3300036401 Bacteria 2706
165 Ga0373925_0140046 3300037068 Bacteria 1893
166 Ga0395899_0000109 3300037312 Bacteria 142069
167 Ga0395898_0000005 3300037466 Bacteria 621247
168 Ga0436365_0458352 3300039437 Bacteria 6674
169 Ga0436365_1018523 3300039437 Bacteria 27551
170 Ga0436365_1633409 3300039437 Unclassified 3534
171 Ga0466964_0012099 3300044706 Bacteria 3265
172 Ga0466971_0000364 3300044719 Bacteria 17396
173 Ga0495629_0083163 3300046459 Unclassified 2234
174 Ga0495651_0056198 3300046462 Unclassified 3024
175 Ga0495630_0135832 3300046517 Unclassified 1868
176 Ga0495652_0103770 3300046529 Unclassified 2301
177 Ga0495598_0007468 3300046537 Unclassified 2510
178 Ga0495634_0021514 3300046642 Unclassified 4557
179 Ga0495669_0006682 3300046684 Bacteria 4826
180 Ga0495684_0002940 3300047471 Bacteria 13419
181 Ga0495684_0046862 3300047471 Unclassified 3307
182 Ga0496100_0013782 3300048903 Unclassified 4677
183 Ga0496101_0000813 3300048904 Bacteria 18392
184 Ga0496104_0024798 3300048907 Bacteria 5522
185 Ga0496105_0055961 3300048908 Bacteria 3257
186 Ga0496106_0018508 3300048909 Bacteria 5151
187 Ga0496112_0106832 3300048915 Bacteria 2769
188 Ga0496112_0118182 3300048915 Unclassified 2621
189 Ga0496113_0087854 3300048916 Unclassified 2391
190 Ga0496115_0003071 3300048918 Bacteria 11989
191 Ga0496115_0020015 3300048918 Bacteria 5156
192 Ga0496125_0000078 3300048928 Bacteria 230157
193 Ga0501031_0001907 3300049568 Bacteria 13134
194 Ga0501032_0000243 3300049569 Bacteria 45146
195 Ga0501032_0049713 3300049569 Bacteria 2829
196 Ga0501033_0000001 3300049570 Bacteria 795921
197 Ga0501033_0000234 3300049570 Bacteria 53555
198 Ga0501037_0000103 3300049573 Bacteria 80391
199 Ga0501038_0001619 3300049574 Bacteria 20936
200 Ga0501038_0003244 3300049574 Bacteria 15162
201 Ga0501039_0004519 3300049575 Bacteria 10507
202 Ga0501043_0001934 3300049579 Bacteria 17735
203 Ga0501043_0001991 3300049579 Bacteria 17439
204 Ga0501047_0000520 3300049581 Bacteria 41671
205 Ga0501070_0020923 3300049586 Bacteria 5488
206 Ga0501035_0000018 3300049822 Bacteria 241543
207 Ga0501044_0000356 3300049823 Bacteria 57280
208 nmdc:mga05p37_231076_c1 3300050507 Bacteria 2228
209 nmdc:mga05p37_250933_c1 3300050507 Bacteria 2122
210 Ga0495619_0049400 3300053085 Bacteria 2774
211 Ga0466962_0000064 3300061719 Bacteria 43758
212 Ga0070698_100006826
213 CNXas_1000010
214 JGI24033J26618_1000417
215 JGI25406J46586_10000090
216 rootH2_10000703
217 rootL2_10326158
218 rootH1_10011269
219 Ga0065712_10007611
220 Ga0065715_10003039
221 Ga0065715_10089345
222 Ga0070676_10012024
223 Ga0070676_10016099
224 Ga0070670_100000645
225 Ga0070670_100007091
226 Ga0070670_100031230
227 Ga0070677_10002902
228 Ga0068869_100014254
229 Ga0070666_10012354
230 Ga0070666_10019823
231 Ga0068868_100014437
232 Ga0070687_100000749
233 Ga0070661_100000650
234 Ga0070668_100006616
235 Ga0070668_100006983
236 Ga0070668_100173084
237 Ga0070669_100001053
238 Ga0070669_100064999
239 Ga0070675_100000362
240 Ga0070675_100048809
241 Ga0070675_100108600
242 Ga0070671_100000652
243 Ga0070671_100016244
244 Ga0070671_100018643
245 Ga0070674_100046126
246 Ga0070673_100007005
247 Ga0070673_100008707
248 Ga0070673_100063615
249 Ga0070673_100088926
250 Ga0070688_100043889
251 Ga0070659_100013994
252 Ga0070711_100009404
253 Ga0070711_100041545
254 Ga0070708_100136467
255 Ga0070678_100001778
256 Ga0070662_100000681
257 Ga0070662_100012184
258 Ga0070706_100000324
259 Ga0070706_100020796
260 Ga0070707_100015936
261 Ga0070707_100057312
262 Ga0070698_100004108
263 Ga0070698_100029403
264 Ga0070698_100040816
265 Ga0070699_100157659
266 Ga0070697_100002367
267 Ga0070697_100042298
268 Ga0070697_100076717
269 Ga0070672_100029084
270 Ga0070665_100073249
271 Ga0068856_100001893
272 Ga0068856_100069835
273 Ga0068860_100047854
274 Ga0081455_10023479
275 Ga0081455_10029717
276 Ga0081539_10001036
277 Ga0081539_10021706
278 Ga0070717_10000833
279 Ga0070712_100005769
280 Ga0070712_100014554
281 Ga0097621_100054313
282 Ga0068871_100012163
283 Ga0068865_100013030
284 Ga0075436_100039413
285 Ga0105240_10180218
286 Ga0111539_10182362
287 Ga0105245_10009580
288 Ga0114129_10052213
289 Ga0105249_10006502
290 Ga0099796_10035418
291 Ga0105239_10043855
292 Ga0157371_10181706
293 Ga0157374_10002132
294 Ga0157374_10018127
295 Ga0157374_10022296
296 Ga0157374_10081427
297 Ga0157374_10204754
298 Ga0157378_10001822
299 Ga0157378_10007982
300 Ga0157378_10027536
301 Ga0157378_10099536
302 Ga0157378_10119800
303 Ga0163162_10001659
304 Ga0163162_10006328
305 Ga0163162_10013939
306 Ga0163162_10216725
307 Ga0157372_10025310
308 Ga0157372_10049055
309 Ga0157375_10002244
310 Ga0157375_10007290
311 Ga0157375_10132971
312 Ga0182008_10019947
313 Ga0157377_10043718
314 Ga0157376_10093257
315 Ga0163161_10007211
316 Ga0207697_10000084
317 Ga0207697_10000679
318 Ga0207697_10001325
319 Ga0207697_10004992
320 Ga0207697_10010551
321 Ga0207688_10004832
322 Ga0207680_10036415
323 Ga0207699_10010716
324 Ga0207645_10000107
325 Ga0207645_10000359
326 Ga0207684_10000390
327 Ga0207684_10016982
328 Ga0207693_10005905
329 Ga0207693_10006253
330 Ga0207663_10009739
331 Ga0207663_10058621
332 Ga0207662_10000513
333 Ga0207649_10000426
334 Ga0207646_10001447
335 Ga0207646_10044688
336 Ga0207646_10068355
337 Ga0207681_10040786
338 Ga0207650_10037754
339 Ga0207659_10047323
340 Ga0207659_10075132
341 Ga0207659_10090925
342 Ga0207659_10138303
343 Ga0207700_10014743
344 Ga0207644_10040417
345 Ga0207690_10058912
346 Ga0207706_10000823
347 Ga0207706_10014621
348 Ga0207706_10033923
349 Ga0207670_10109032
350 Ga0207669_10012672
351 Ga0207665_10090483
352 Ga0207691_10000719
353 Ga0207691_10001579
354 Ga0207691_10082177
355 Ga0207689_10020761
356 Ga0207651_10074096
357 Ga0207668_10142783
358 Ga0207658_10013737
359 Ga0207658_10018230
360 Ga0207658_10118309
361 Ga0207677_10008254
362 Ga0207703_10079643
363 Ga0207702_10001879
364 Ga0207648_10132203
365 Ga0207675_100026773
366 Ga0209974_10012242
367 Ga0268266_10016835
368 Ga0268265_10008758
369 Ga0268264_10060737
370 Ga0373943_0023971
371 Ga0373943_0028795
372 Ga0373955_0017847
373 Ga0373935_0016078
374 Ga0373935_0076329
375 Ga0373937_0098913
376 Ga0373925_0140046
377 Ga0395899_0000109
378 Ga0395898_0000005
379 Ga0436365_0458352
380 Ga0436365_1018523
381 Ga0436365_1633409
382 Ga0466964_0012099
383 Ga0466971_0000364
384 Ga0495629_0083163
385 Ga0495651_0056198
386 Ga0495630_0135832
387 Ga0495652_0103770
388 Ga0495598_0007468
389 Ga0495634_0021514
390 Ga0495669_0006682
391 Ga0495684_0002940
392 Ga0495684_0046862
393 Ga0496100_0013782
394 Ga0496101_0000813
395 Ga0496104_0024798
396 Ga0496105_0055961
397 Ga0496106_0018508
398 Ga0496112_0106832
399 Ga0496112_0118182
400 Ga0496113_0087854
401 Ga0496115_0003071
402 Ga0496115_0020015
403 Ga0496125_0000078
404 Ga0501031_0001907
405 Ga0501032_0000243
406 Ga0501032_0049713
407 Ga0501033_0000001
408 Ga0501033_0000234
409 Ga0501037_0000103
410 Ga0501038_0001619
411 Ga0501038_0003244
412 Ga0501039_0004519
413 Ga0501043_0001934
414 Ga0501043_0001991
415 Ga0501047_0000520
416 Ga0501070_0020923
417 Ga0501035_0000018
418 Ga0501044_0000356
419 nmdc:mga05p37_231076_c1
420 nmdc:mga05p37_250933_c1
421 Ga0495619_0049400
422 Ga0466962_0000064

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6859 13 483
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.664 13 483
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.6375 7 484
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.6249 7 484
6czm-assembly1.cif.gz_D crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form 0.6065 428 465
ID Description Score Start End Superfamily
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6756 69 232 1.20.1250.20
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6443 69 232 1.20.1250.20
af_Q58580_1_145_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5684 427 488 3.40.190.10
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.5218 407 487 3.40.190.10
3tqwB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.4998 409 486 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A838N2Q5-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9652 5 487 GO:0005886
GO:0009103
GO:0010041
GO:0016763
AF-A0A838N2Q5-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9497 5 487 GO:0005886
GO:0009103
GO:0010041
GO:0016763
AF-A0A2V5WKK1-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9029 114 405 GO:0005886
GO:0009103
GO:0016763
AF-A0A2V5WKK1-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.888 114 405 GO:0005886
GO:0009103
GO:0016763
AF-A0A2V6BPQ2-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.8246 11 347 GO:0005886
GO:0009103
GO:0010041
GO:0016763

Map