F321120

General Info

Members Datasets Scaffolds Average Seq Length
211 114 422 208

Family's Representative Sequence

Representative Sequence 3300003911|JGI25405J52794_10032401|JGI25405J52794_100324012
Length 247
Sequence MSRFTSENTAVADDIIARYPRPRSALIPLLHLAQEQDGYLTEEAMEHIAELVDVTPAEVLGTASFYEMFKREPVGDYVITVCTNISCMLVGGEELLHHLEHRLGVKAGSTTPDGKFTLEDVECIAACSEAPCMQVNYRYFQRVQLDDVDDLLDDLRAGKLAHEVPRHGTLSRVRQRLPENRAGNAPPDRNVEPPWLARNQRGDWVVTRGNGCRSDEAEAMTVANRPPMPRPVATVRHCLALRGPEGR

Samples

Sample ID Description Type Environment
1 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
8 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
9 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
18 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
19 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
36 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
37 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
38 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
39 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
40 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
41 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
42 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
43 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
44 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
45 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
46 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
47 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
48 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
49 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
50 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
51 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
52 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
53 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
54 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
55 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
56 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
57 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
58 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
59 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
60 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
61 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
62 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
63 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
64 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
65 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
66 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
67 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
69 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
73 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
74 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
75 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
76 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
77 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
98 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
99 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
103 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
104 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
107 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
108 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
111 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
112 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.53
Nodule 0
Rhizoplane 2.84
Rhizosphere 85.31
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25405J52794_10032401 3300003911 Bacteria 1088
2 Ga0065704_10394136 3300005289 Bacteria 759
3 Ga0070671_100023579 3300005355 Bacteria 5038
4 Ga0070674_100244785 3300005356 Bacteria 1406
5 Ga0070667_100073577 3300005367 Bacteria 2914
6 Ga0070667_100510193 3300005367 Bacteria 1103
7 Ga0070678_100266859 3300005456 Bacteria 1442
8 Ga0068867_101178785 3300005459 Bacteria 703
9 Ga0068859_100222821 3300005617 Bacteria 1974
10 Ga0068864_100483259 3300005618 Bacteria 1189
11 Ga0068860_100011590 3300005843 Bacteria 8694
12 Ga0081455_10007334 3300005937 Bacteria 11631
13 Ga0081455_10013395 3300005937 Bacteria 8110
14 Ga0081455_10345766 3300005937 Bacteria 1051
15 Ga0081538_10000033 3300005981 Bacteria 121023
16 Ga0081538_10011283 3300005981 Bacteria 7249
17 Ga0075365_10086814 3300006038 Bacteria 2126
18 Ga0075365_10356652 3300006038 Bacteria 1031
19 Ga0075368_10071811 3300006042 Bacteria 1399
20 Ga0075364_10009198 3300006051 Bacteria 5919
21 Ga0075364_10013771 3300006051 Bacteria 4981
22 Ga0075367_10080875 3300006178 Bacteria 1966
23 Ga0075367_10495371 3300006178 Bacteria 775
24 Ga0075428_100031306 3300006844 Bacteria 5883
25 Ga0075430_100008158 3300006846 Bacteria 8851
26 Ga0075430_100032279 3300006846 Bacteria 4445
27 Ga0075430_100141886 3300006846 Bacteria 2000
28 Ga0075431_100000972 3300006847 Bacteria 25462
29 Ga0075431_100277993 3300006847 Bacteria 1695
30 Ga0075431_100615710 3300006847 Bacteria 1069
31 Ga0075431_101052386 3300006847 Bacteria 779
32 Ga0075429_100006169 3300006880 Bacteria 10364
33 Ga0075429_100060369 3300006880 Bacteria 3303
34 Ga0075429_100288119 3300006880 Bacteria 1438
35 Ga0097620_100222836 3300006931 Bacteria 1974
36 Ga0097620_100541558 3300006931 Bacteria 1259
37 Ga0111539_10002370 3300009094 Bacteria 25028
38 Ga0111539_10057812 3300009094 Bacteria 4604
39 Ga0111539_11128862 3300009094 Bacteria 911
40 Ga0114129_10034077 3300009147 Bacteria 7193
41 Ga0114129_10045995 3300009147 Bacteria 6134
42 Ga0114129_10292463 3300009147 Bacteria 2173
43 Ga0207652_10502960 3300025921 Bacteria 1091
44 Ga0207694_10353040 3300025924 Bacteria 1217
45 Ga0207669_10249764 3300025937 Bacteria 1320
46 Ga0207661_11207928 3300025944 Bacteria 696
47 Ga0207648_10825002 3300026089 Bacteria 864
48 Ga0207683_10098197 3300026121 Bacteria 2613
49 Ga0209813_10110334 3300027866 Bacteria 947
50 Ga0207428_10250429 3300027907 Bacteria 1321
51 Ga0207428_10325712 3300027907 Bacteria 1134
52 Ga0268265_10218859 3300028380 Bacteria 1665
53 Ga0268264_10023156 3300028381 Bacteria 5068
54 Ga0307416_100337535 3300032002 Bacteria 1518
55 Ga0307415_100054734 3300032126 Bacteria 2726
56 Ga0373937_0002992 3300036401 Bacteria 14167
57 Ga0316584_0291702 3300036712 Bacteria 1183
58 Ga0400483_103120 3300039062 Bacteria 57797
59 Ga0400483_151497 3300039062 Bacteria 1400
60 Ga0400483_240614 3300039062 Bacteria 4853
61 Ga0400483_253115 3300039062 Bacteria 57701
62 Ga0400483_255640 3300039062 Bacteria 5526
63 Ga0451797_0410740 3300041453 Bacteria 721
64 Ga0451797_1403784 3300041453 Bacteria 2199
65 Ga0451837_0034045 3300041494 Bacteria 1834
66 Ga0451837_1222822 3300041494 Bacteria 1660
67 Ga0439443_005202 3300042003 Bacteria 1730
68 Ga0439448_0008029 3300042005 Bacteria 3078
69 Ga0439455_0005567 3300042012 Bacteria 2563
70 Ga0439434_0003940 3300042435 Bacteria 4336
71 Ga0439464_0000577 3300042439 Bacteria 7659
72 Ga0451577_0001220 3300042876 Bacteria 35873
73 Ga0439440_0003762 3300042993 Bacteria 2952
74 Ga0466965_0171445 3300044683 Bacteria 1142
75 Ga0495651_0001000 3300046462 Bacteria 21932
76 Ga0495608_0009846 3300046511 Bacteria 6671
77 Ga0495586_0041845 3300046535 Bacteria 2468
78 Ga0495587_0198987 3300046536 Bacteria 1133
79 Ga0495667_0001731 3300046559 Bacteria 14502
80 Ga0495657_0022332 3300046675 Bacteria 4534
81 Ga0495658_0048878 3300046683 Bacteria 2387
82 Ga0495613_0211007 3300046689 Bacteria 1366
83 Ga0495604_0027713 3300047317 Bacteria 4505
84 Ga0495674_0524109 3300047319 Bacteria 946
85 Ga0495672_0000884 3300047320 Bacteria 31539
86 Ga0495680_0002645 3300047322 Bacteria 18132
87 Ga0495675_0003058 3300047444 Bacteria 10055
88 Ga0495684_0020311 3300047471 Bacteria 5118
89 Ga0495602_0086620 3300048088 Bacteria 2614
90 Ga0496105_0210807 3300048908 Bacteria 1584
91 Ga0496109_0863121 3300048912 Bacteria 843
92 Ga0496114_0050069 3300048917 Bacteria 3477
93 Ga0496114_0078163 3300048917 Bacteria 2792
94 Ga0501031_0018058 3300049568 Bacteria 4588
95 Ga0501033_0003829 3300049570 Bacteria 12242
96 Ga0501034_0002750 3300049571 Bacteria 20681
97 Ga0501034_0054239 3300049571 Bacteria 4036
98 Ga0501034_0119363 3300049571 Bacteria 2623
99 Ga0501034_0491877 3300049571 Bacteria 1141
100 Ga0501036_0011362 3300049572 Bacteria 7370
101 Ga0501037_0013736 3300049573 Bacteria 5964
102 Ga0501037_0044136 3300049573 Bacteria 3275
103 Ga0501037_0063400 3300049573 Bacteria 2694
104 Ga0501037_0084491 3300049573 Bacteria 2299
105 Ga0501038_0029141 3300049574 Bacteria 4895
106 Ga0501039_0002306 3300049575 Bacteria 14165
107 Ga0501039_0218048 3300049575 Bacteria 1500
108 Ga0501040_0005528 3300049576 Bacteria 8183
109 Ga0501040_0007411 3300049576 Bacteria 7104
110 Ga0501040_0070883 3300049576 Bacteria 2406
111 Ga0501041_0066750 3300049577 Bacteria 2205
112 Ga0501042_0043561 3300049578 Bacteria 3196
113 Ga0501042_0168400 3300049578 Bacteria 1581
114 Ga0501043_0026355 3300049579 Bacteria 4561
115 Ga0501043_0089402 3300049579 Bacteria 2421
116 Ga0501046_0033217 3300049580 Bacteria 4171
117 Ga0501047_0090500 3300049581 Bacteria 2937
118 Ga0501048_0003688 3300049582 Bacteria 11670
119 Ga0501048_0052036 3300049582 Bacteria 2914
120 Ga0501068_0001452 3300049584 Bacteria 12599
121 Ga0501068_0009997 3300049584 Bacteria 5320
122 Ga0501068_0197101 3300049584 Bacteria 1277
123 Ga0501069_0000380 3300049585 Bacteria 20051
124 Ga0501069_0002914 3300049585 Bacteria 8777
125 Ga0501069_0117558 3300049585 Bacteria 1517
126 Ga0501070_0000438 3300049586 Bacteria 37824
127 Ga0501070_0002318 3300049586 Bacteria 16701
128 Ga0501070_0002602 3300049586 Bacteria 15769
129 Ga0501070_0238690 3300049586 Bacteria 1488
130 Ga0501070_0670871 3300049586 Bacteria 822
131 Ga0501070_0931021 3300049586 Bacteria 677
132 Ga0501071_0009002 3300049587 Bacteria 6627
133 Ga0501071_0121607 3300049587 Bacteria 1935
134 Ga0501071_0197299 3300049587 Bacteria 1511
135 Ga0501071_0200986 3300049587 Bacteria 1497
136 Ga0501072_0006299 3300049588 Bacteria 9033
137 Ga0501072_0103097 3300049588 Bacteria 2267
138 Ga0501072_0157608 3300049588 Bacteria 1810
139 Ga0501072_0207603 3300049588 Bacteria 1561
140 Ga0501072_0580325 3300049588 Bacteria 884
141 Ga0501073_0004030 3300049589 Bacteria 11038
142 Ga0501073_0026186 3300049589 Bacteria 4179
143 Ga0501074_0005466 3300049590 Bacteria 9141
144 Ga0501074_0033722 3300049590 Bacteria 3711
145 Ga0501074_0047927 3300049590 Bacteria 3087
146 Ga0501074_0067957 3300049590 Bacteria 2562
147 Ga0501075_0233795 3300049591 Bacteria 1401
148 Ga0501075_0375254 3300049591 Bacteria 1084
149 Ga0501076_0057745 3300049592 Bacteria 3082
150 Ga0501076_0101605 3300049592 Bacteria 2318
151 Ga0501076_0167803 3300049592 Bacteria 1789
152 Ga0501076_0424484 3300049592 Bacteria 1094
153 Ga0501077_0125843 3300049593 Bacteria 1624
154 Ga0501079_0003485 3300049741 Bacteria 11570
155 Ga0501079_0025575 3300049741 Bacteria 4526
156 Ga0501079_0383195 3300049741 Bacteria 1102
157 Ga0501080_0000695 3300049742 Bacteria 27013
158 Ga0501080_0004304 3300049742 Bacteria 12640
159 Ga0501080_0025720 3300049742 Bacteria 5467
160 Ga0501080_0125139 3300049742 Bacteria 2381
161 Ga0501080_0143137 3300049742 Bacteria 2210
162 Ga0501080_0150775 3300049742 Bacteria 2149
163 Ga0501081_0010469 3300049743 Bacteria 6051
164 Ga0501083_0002139 3300049744 Bacteria 13559
165 Ga0501035_0099468 3300049822 Bacteria 2553
166 Ga0501035_0208938 3300049822 Bacteria 1671
167 Ga0501044_0015641 3300049823 Bacteria 8172
168 Ga0501044_0482775 3300049823 Bacteria 1142
169 Ga0501045_0001569 3300049824 Bacteria 15231
170 Ga0501045_0130047 3300049824 Bacteria 1871
171 Ga0501045_0178058 3300049824 Bacteria 1584
172 nmdc:mga00v17_107428_c1 3300050491 Bacteria 1767
173 nmdc:mga00v17_2757_c1 3300050491 Bacteria 9015
174 nmdc:mga00v17_6250_c1 3300050491 Bacteria 5971
175 nmdc:mga0yw44_186272_c1 3300050492 Bacteria 1368
176 nmdc:mga0yw44_395618_c1 3300050492 Bacteria 934
177 nmdc:mga06z11_8689_c1 3300050494 Bacteria 4250
178 nmdc:mga04h51_130108_c1 3300050495 Bacteria 946
179 nmdc:mga05p37_283094_c1 3300050507 Bacteria 1976
180 nmdc:mga05p37_425947_c1 3300050507 Bacteria 1543
181 nmdc:mga05p37_42867_c1 3300050507 Bacteria 5563
182 nmdc:mga09592_6565_c1 3300050508 Bacteria 9472
183 nmdc:mga09592_80452_c1 3300050508 Bacteria 2775
184 nmdc:mga0qj67_111440_c2 3300050509 Bacteria 1885
185 nmdc:mga0qj67_24379_c1 3300050509 Bacteria 4662
186 nmdc:mga0qj67_24671_c1 3300050509 Bacteria 4638
187 nmdc:mga0qj67_249067_c1 3300050509 Bacteria 1442
188 nmdc:mga0qj67_64633_c1 3300050509 Bacteria 2911
189 nmdc:mga0qj67_7979_c1 3300050509 Bacteria 7828
190 nmdc:mga06r32_21828_c1 3300050510 Bacteria 5912
191 nmdc:mga06r32_605181_c1 3300050510 Bacteria 1067
192 nmdc:mga06r32_605707_c1 3300050510 Bacteria 1066
193 nmdc:mga06r32_628092_c1 3300050510 Bacteria 1044
194 nmdc:mga06r32_730115_c1 3300050510 Bacteria 955
195 nmdc:mga06r32_810_c1 3300050510 Bacteria 27781
196 nmdc:mga08y16_22044_c1 3300050511 Bacteria 6726
197 nmdc:mga08y16_409107_c1 3300050511 Bacteria 1388
198 Ga0495595_0021073 3300053084 Bacteria 2844
199 Ga0495619_0306228 3300053085 Bacteria 1100
200 Ga0500568_0000029 3300053139 Bacteria 159927
201 Ga0500604_0100453 3300053151 Bacteria 953
202 Ga0500616_0035161 3300053153 Bacteria 2726
203 Ga0501084_0023785 3300054114 Bacteria 5109
204 Ga0501084_0424328 3300054114 Bacteria 1124
205 Ga0501084_0474554 3300054114 Bacteria 1057
206 Ga0501082_0026216 3300060353 Bacteria 5023
207 Ga0501082_0067034 3300060353 Bacteria 3091
208 Ga0501082_0106571 3300060353 Bacteria 2425
209 Ga0530510_0001714 3300061734 Bacteria 14898
210 Ga0530510_0182915 3300061734 Bacteria 1554
211 Ga0530510_0344970 3300061734 Bacteria 1118
212 JGI25405J52794_10032401
213 Ga0065704_10394136
214 Ga0070671_100023579
215 Ga0070674_100244785
216 Ga0070667_100073577
217 Ga0070667_100510193
218 Ga0070678_100266859
219 Ga0068867_101178785
220 Ga0068859_100222821
221 Ga0068864_100483259
222 Ga0068860_100011590
223 Ga0081455_10007334
224 Ga0081455_10013395
225 Ga0081455_10345766
226 Ga0081538_10000033
227 Ga0081538_10011283
228 Ga0075365_10086814
229 Ga0075365_10356652
230 Ga0075368_10071811
231 Ga0075364_10009198
232 Ga0075364_10013771
233 Ga0075367_10080875
234 Ga0075367_10495371
235 Ga0075428_100031306
236 Ga0075430_100008158
237 Ga0075430_100032279
238 Ga0075430_100141886
239 Ga0075431_100000972
240 Ga0075431_100277993
241 Ga0075431_100615710
242 Ga0075431_101052386
243 Ga0075429_100006169
244 Ga0075429_100060369
245 Ga0075429_100288119
246 Ga0097620_100222836
247 Ga0097620_100541558
248 Ga0111539_10002370
249 Ga0111539_10057812
250 Ga0111539_11128862
251 Ga0114129_10034077
252 Ga0114129_10045995
253 Ga0114129_10292463
254 Ga0207652_10502960
255 Ga0207694_10353040
256 Ga0207669_10249764
257 Ga0207661_11207928
258 Ga0207648_10825002
259 Ga0207683_10098197
260 Ga0209813_10110334
261 Ga0207428_10250429
262 Ga0207428_10325712
263 Ga0268265_10218859
264 Ga0268264_10023156
265 Ga0307416_100337535
266 Ga0307415_100054734
267 Ga0373937_0002992
268 Ga0316584_0291702
269 Ga0400483_103120
270 Ga0400483_151497
271 Ga0400483_240614
272 Ga0400483_253115
273 Ga0400483_255640
274 Ga0451797_0410740
275 Ga0451797_1403784
276 Ga0451837_0034045
277 Ga0451837_1222822
278 Ga0439443_005202
279 Ga0439448_0008029
280 Ga0439455_0005567
281 Ga0439434_0003940
282 Ga0439464_0000577
283 Ga0451577_0001220
284 Ga0439440_0003762
285 Ga0466965_0171445
286 Ga0495651_0001000
287 Ga0495608_0009846
288 Ga0495586_0041845
289 Ga0495587_0198987
290 Ga0495667_0001731
291 Ga0495657_0022332
292 Ga0495658_0048878
293 Ga0495613_0211007
294 Ga0495604_0027713
295 Ga0495674_0524109
296 Ga0495672_0000884
297 Ga0495680_0002645
298 Ga0495675_0003058
299 Ga0495684_0020311
300 Ga0495602_0086620
301 Ga0496105_0210807
302 Ga0496109_0863121
303 Ga0496114_0050069
304 Ga0496114_0078163
305 Ga0501031_0018058
306 Ga0501033_0003829
307 Ga0501034_0002750
308 Ga0501034_0054239
309 Ga0501034_0119363
310 Ga0501034_0491877
311 Ga0501036_0011362
312 Ga0501037_0013736
313 Ga0501037_0044136
314 Ga0501037_0063400
315 Ga0501037_0084491
316 Ga0501038_0029141
317 Ga0501039_0002306
318 Ga0501039_0218048
319 Ga0501040_0005528
320 Ga0501040_0007411
321 Ga0501040_0070883
322 Ga0501041_0066750
323 Ga0501042_0043561
324 Ga0501042_0168400
325 Ga0501043_0026355
326 Ga0501043_0089402
327 Ga0501046_0033217
328 Ga0501047_0090500
329 Ga0501048_0003688
330 Ga0501048_0052036
331 Ga0501068_0001452
332 Ga0501068_0009997
333 Ga0501068_0197101
334 Ga0501069_0000380
335 Ga0501069_0002914
336 Ga0501069_0117558
337 Ga0501070_0000438
338 Ga0501070_0002318
339 Ga0501070_0002602
340 Ga0501070_0238690
341 Ga0501070_0670871
342 Ga0501070_0931021
343 Ga0501071_0009002
344 Ga0501071_0121607
345 Ga0501071_0197299
346 Ga0501071_0200986
347 Ga0501072_0006299
348 Ga0501072_0103097
349 Ga0501072_0157608
350 Ga0501072_0207603
351 Ga0501072_0580325
352 Ga0501073_0004030
353 Ga0501073_0026186
354 Ga0501074_0005466
355 Ga0501074_0033722
356 Ga0501074_0047927
357 Ga0501074_0067957
358 Ga0501075_0233795
359 Ga0501075_0375254
360 Ga0501076_0057745
361 Ga0501076_0101605
362 Ga0501076_0167803
363 Ga0501076_0424484
364 Ga0501077_0125843
365 Ga0501079_0003485
366 Ga0501079_0025575
367 Ga0501079_0383195
368 Ga0501080_0000695
369 Ga0501080_0004304
370 Ga0501080_0025720
371 Ga0501080_0125139
372 Ga0501080_0143137
373 Ga0501080_0150775
374 Ga0501081_0010469
375 Ga0501083_0002139
376 Ga0501035_0099468
377 Ga0501035_0208938
378 Ga0501044_0015641
379 Ga0501044_0482775
380 Ga0501045_0001569
381 Ga0501045_0130047
382 Ga0501045_0178058
383 nmdc:mga00v17_107428_c1
384 nmdc:mga00v17_2757_c1
385 nmdc:mga00v17_6250_c1
386 nmdc:mga0yw44_186272_c1
387 nmdc:mga0yw44_395618_c1
388 nmdc:mga06z11_8689_c1
389 nmdc:mga04h51_130108_c1
390 nmdc:mga05p37_283094_c1
391 nmdc:mga05p37_425947_c1
392 nmdc:mga05p37_42867_c1
393 nmdc:mga09592_6565_c1
394 nmdc:mga09592_80452_c1
395 nmdc:mga0qj67_111440_c2
396 nmdc:mga0qj67_24379_c1
397 nmdc:mga0qj67_24671_c1
398 nmdc:mga0qj67_249067_c1
399 nmdc:mga0qj67_64633_c1
400 nmdc:mga0qj67_7979_c1
401 nmdc:mga06r32_21828_c1
402 nmdc:mga06r32_605181_c1
403 nmdc:mga06r32_605707_c1
404 nmdc:mga06r32_628092_c1
405 nmdc:mga06r32_730115_c1
406 nmdc:mga06r32_810_c1
407 nmdc:mga08y16_22044_c1
408 nmdc:mga08y16_409107_c1
409 Ga0495595_0021073
410 Ga0495619_0306228
411 Ga0500568_0000029
412 Ga0500604_0100453
413 Ga0500616_0035161
414 Ga0501084_0023785
415 Ga0501084_0424328
416 Ga0501084_0474554
417 Ga0501082_0026216
418 Ga0501082_0067034
419 Ga0501082_0106571
420 Ga0530510_0001714
421 Ga0530510_0182915
422 Ga0530510_0344970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01257

2Fe-2S_thioredx

Thioredoxin-like [2Fe-2S] ferredoxin

12

156

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6q9g-assembly1.cif.gz_A crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129d and nuof bound to nadh 0.8637 2 153
7p7c-assembly1.cif.gz_E complex i from e. coli, ddm/lmng-purified, apo, open state 0.8633 1 153
6q9j-assembly1.cif.gz_A crystal structure of reduced aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe g129s and nuof bound to nadh 0.8619 1 153
5gpn-assembly1.cif.gz_d architecture of mammalian respirasome 0.8575 1 158
4uq8-assembly1.cif.gz_E electron cryo-microscopy of bovine complex i 0.8549 1 156
ID Description Score Start End Superfamily
af_A4HX94_128_234_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9562 74 158 3.40.30.10
af_P0AFD1_83_165_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9492 73 153 3.40.30.10
1t36A04 Mainly Alpha;Orthogonal Bundle;Carbamoyl Phosphate Synthetase; Chain A, domain 4;Carbamoyl-phosphate synthetase, large subunit oligomerisation domain 0.9429 44 67 1.10.1030.10
af_P0AFD1_13_82_1.10.10.1590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;NADH-quinone oxidoreductase subunit E 0.9429 3 72 1.10.10.1590
af_P9WIV5_106_200_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9366 74 157 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2S8NMS4-F1-model_v4 deleted 0.9585 73 146
AF-X1F0U2-F1-model_v4 Uncharacterized protein 0.9556 75 157
AF-A0A251X5I8-F1-model_v4 Uncharacterized protein 0.9442 75 156 GO:0003954
AF-A0A6J6WJW7-F1-model_v4 Unannotated protein 0.9414 74 159 GO:0003954
AF-A0A7C0YSP5-F1-model_v4 NAD(P)H-dependent oxidoreductase subunit E 0.9367 72 160 GO:0016491

Map