F321005

General Info

Members Datasets Scaffolds Average Seq Length
210 144 420 222

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2848297114|2848298852
Length 238
Sequence PVTDTATRPGTRSGAGLRPHVQGQQSLARVQALPWLLFIIMLALAVWLGWRAFGPRDQGDVLATSLVAFEKQNRLTVFSAQLSPVVASEDSRLFGALRSRQVAVIPARVDYTLDLSAMDRNRMSWNEESDTLDVQLPALTIGRPNLDEGRAQYLREGLWITRDAQDQLTRDNTALAERQAVEQAANPVLLNLARGAAKDAIRQNLAIPLQVAGFGNVTVNVRFDGEAQAPPAAARPAN

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
70 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
76 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
77 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
78 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
85 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
86 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
87 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
95 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
96 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
97 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
117 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
118 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
119 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
120 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
121 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
122 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
123 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
124 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
125 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
126 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
127 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
128 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
129 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
132 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
133 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
134 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
135 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
136 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
137 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
138 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
139 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
140 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
141 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
142 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
143 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
144 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.33
Metatranscriptomes 0
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.43
Nodule 0.48
Rhizoplane 4.76
Rhizosphere 60.48
Stem 0
Stem Tuber 0
Unclassified 1.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000205 3300002074 Bacteria 7539
2 JGI24034J26672_10002546 3300002239 Bacteria 2505
3 Ga0065704_10070637 3300005289 Bacteria 18649
4 Ga0065704_10078900 3300005289 Bacteria 4308
5 Ga0070658_10063245 3300005327 Bacteria 3017
6 Ga0070676_10422566 3300005328 Bacteria 932
7 Ga0070666_10098887 3300005335 Bacteria 2009
8 Ga0070666_10180519 3300005335 Bacteria 1480
9 Ga0070682_100386360 3300005337 Bacteria 1054
10 Ga0070668_100002787 3300005347 Bacteria 12857
11 Ga0070668_100003059 3300005347 Bacteria 12368
12 Ga0070669_100000056 3300005353 Bacteria 111413
13 Ga0070669_100000500 3300005353 Bacteria 29519
14 Ga0070671_100000198 3300005355 Bacteria 40255
15 Ga0070671_100002411 3300005355 Bacteria 14452
16 Ga0070659_100065738 3300005366 Bacteria 2872
17 Ga0070667_100001829 3300005367 Bacteria 18975
18 Ga0070667_100317768 3300005367 Bacteria 1405
19 Ga0070708_100080919 3300005445 Bacteria 2940
20 Ga0070663_100002596 3300005455 Bacteria 10214
21 Ga0070695_100857471 3300005545 Bacteria 731
22 Ga0070665_100000538 3300005548 Bacteria 53355
23 Ga0070665_100006288 3300005548 Bacteria 12134
24 Ga0070665_100239482 3300005548 Bacteria 1815
25 Ga0070664_100153334 3300005564 Bacteria 2035
26 Ga0068857_100418718 3300005577 Bacteria 1249
27 Ga0068857_100808933 3300005577 Bacteria 895
28 Ga0068854_100037585 3300005578 Bacteria 3399
29 Ga0068859_100035369 3300005617 Bacteria 5012
30 Ga0068864_100273612 3300005618 Bacteria 1574
31 Ga0068863_100007155 3300005841 Bacteria 10949
32 Ga0068858_100042875 3300005842 Bacteria 4195
33 Ga0068860_100007513 3300005843 Bacteria 10906
34 Ga0068860_100019236 3300005843 Bacteria 6629
35 Ga0068862_100125990 3300005844 Bacteria 2261
36 Ga0068862_100432276 3300005844 Bacteria 1237
37 Ga0075365_10087955 3300006038 Bacteria 2113
38 Ga0075368_10000827 3300006042 Bacteria 9531
39 Ga0075363_100026709 3300006048 Bacteria 2955
40 Ga0075364_10034679 3300006051 Bacteria 3257
41 Ga0075364_10037499 3300006051 Bacteria 3139
42 Ga0075432_10000571 3300006058 Bacteria 11115
43 Ga0075362_10000499 3300006177 Bacteria 11464
44 Ga0075362_10015060 3300006177 Bacteria 3138
45 Ga0075362_10024658 3300006177 Bacteria 2553
46 Ga0075367_10035999 3300006178 Bacteria 2868
47 Ga0075369_10013376 3300006186 Bacteria 3257
48 Ga0075366_10002584 3300006195 Bacteria 9310
49 Ga0075366_10240298 3300006195 Unclassified 1104
50 Ga0075370_10113034 3300006353 Bacteria 1578
51 Ga0075428_100551962 3300006844 Bacteria 1231
52 Ga0097620_100035369 3300006931 Bacteria 5012
53 Ga0079104_1007109 3300006946 Bacteria 4114
54 Ga0105251_10007198 3300009011 Bacteria 6910
55 Ga0105251_10118014 3300009011 Bacteria 1206
56 Ga0105243_10591853 3300009148 Bacteria 1066
57 Ga0105248_10028610 3300009177 Bacteria 6210
58 Ga0105248_10308161 3300009177 Bacteria 1783
59 Ga0105248_10343392 3300009177 Bacteria 1680
60 Ga0105249_10002003 3300009553 Bacteria 17687
61 Ga0105249_10533083 3300009553 Bacteria 1223
62 Ga0105249_11563508 3300009553 Bacteria 732
63 Ga0157371_10299664 3300013102 Bacteria 1164
64 Ga0157369_10102821 3300013105 Bacteria 3043
65 Ga0163162_10002115 3300013306 Bacteria 18660
66 Ga0163162_10010973 3300013306 Bacteria 8821
67 Ga0163162_10917650 3300013306 Bacteria 988
68 Ga0157372_10818988 3300013307 Bacteria 1081
69 Ga0157372_11033333 3300013307 Bacteria 951
70 Ga0157375_11151790 3300013308 Bacteria 909
71 Ga0157380_10195090 3300014326 Bacteria 1791
72 Ga0163161_10057671 3300017792 Bacteria 2821
73 Ga0207696_1004284 3300025711 Bacteria 6186
74 Ga0207713_1002165 3300025735 Bacteria 14576
75 Ga0207713_1003104 3300025735 Bacteria 11524
76 Ga0207688_10219897 3300025901 Bacteria 1144
77 Ga0207680_10176101 3300025903 Bacteria 1444
78 Ga0207681_10000019 3300025923 Bacteria 243902
79 Ga0207681_10000802 3300025923 Bacteria 20700
80 Ga0207650_10152550 3300025925 Bacteria 1824
81 Ga0207644_10000446 3300025931 Bacteria 26672
82 Ga0207644_10000838 3300025931 Bacteria 19549
83 Ga0207690_10044636 3300025932 Bacteria 2923
84 Ga0207706_10081404 3300025933 Bacteria 2845
85 Ga0207706_10257103 3300025933 Bacteria 1525
86 Ga0207711_10005062 3300025941 Bacteria 11179
87 Ga0207711_10023460 3300025941 Bacteria 5165
88 Ga0207711_10091773 3300025941 Bacteria 2672
89 Ga0207711_10481393 3300025941 Bacteria 1156
90 Ga0207661_10475697 3300025944 Bacteria 1140
91 Ga0207679_10370277 3300025945 Bacteria 1254
92 Ga0207668_10001565 3300025972 Bacteria 13396
93 Ga0207668_10005163 3300025972 Bacteria 7682
94 Ga0207668_10033015 3300025972 Bacteria 3426
95 Ga0207668_10366513 3300025972 Bacteria 1209
96 Ga0207668_10427969 3300025972 Bacteria 1125
97 Ga0207640_10022625 3300025981 Bacteria 3765
98 Ga0207658_10000529 3300025986 Bacteria 34847
99 Ga0207658_10008736 3300025986 Bacteria 6882
100 Ga0207658_10569096 3300025986 Bacteria 1015
101 Ga0207703_10258253 3300026035 Bacteria 1574
102 Ga0207678_10329343 3300026067 Bacteria 1315
103 Ga0207708_10105946 3300026075 Bacteria 2180
104 Ga0207641_10003902 3300026088 Bacteria 13053
105 Ga0209813_10000533 3300027866 Bacteria 8991
106 Ga0209974_10019920 3300027876 Bacteria 2224
107 Ga0207428_10058357 3300027907 Bacteria 3063
108 Ga0268266_10000499 3300028379 Bacteria 56016
109 Ga0268266_10001459 3300028379 Bacteria 28148
110 Ga0268266_10202922 3300028379 Bacteria 1815
111 Ga0268265_10022981 3300028380 Bacteria 4389
112 Ga0268265_10074005 3300028380 Bacteria 2662
113 Ga0268264_10009108 3300028381 Bacteria 8232
114 Ga0268264_10031434 3300028381 Bacteria 4353
115 Ga0307408_100189912 3300031548 Bacteria 1654
116 Ga0307408_100593939 3300031548 Bacteria 983
117 Ga0307508_10039338 3300031616 Bacteria 4249
118 Ga0307405_10339107 3300031731 Bacteria 1155
119 Ga0307413_10083860 3300031824 Bacteria 2052
120 Ga0307406_10079534 3300031901 Bacteria 2174
121 Ga0307409_100141807 3300031995 Bacteria 2072
122 Ga0307409_100284053 3300031995 Bacteria 1531
123 Ga0307416_100514059 3300032002 Bacteria 1264
124 Ga0307414_10019924 3300032004 Bacteria 4168
125 Ga0307414_10022534 3300032004 Bacteria 3975
126 Ga0307414_10104588 3300032004 Bacteria 2139
127 Ga0307411_10431443 3300032005 Bacteria 1097
128 Ga0307510_10248133 3300033180 Bacteria 1270
129 Ga0439462_0000371 3300042015 Bacteria 8593
130 Ga0450897_010525 3300042128 Unclassified 890
131 Ga0450893_0018489 3300042532 Bacteria 1188
132 Ga0496101_0156007 3300048904 Bacteria 1748
133 Ga0496101_0224047 3300048904 Bacteria 1460
134 Ga0496102_0000787 3300048905 Bacteria 30820
135 Ga0496102_0208776 3300048905 Bacteria 1841
136 Ga0496103_0000343 3300048906 Bacteria 42415
137 Ga0496103_0004034 3300048906 Bacteria 8922
138 Ga0496103_0391809 3300048906 Bacteria 892
139 Ga0496105_0007455 3300048908 Bacteria 8469
140 Ga0496113_0016093 3300048916 Bacteria 5161
141 Ga0496115_0140292 3300048918 Bacteria 1994
142 Ga0496116_0019649 3300048919 Bacteria 5164
143 Ga0496117_0001020 3300048920 Bacteria 42763
144 Ga0496117_0024402 3300048920 Bacteria 4784
145 Ga0496118_0017270 3300048921 Bacteria 6580
146 Ga0496118_0032214 3300048921 Bacteria 4325
147 Ga0496120_0171726 3300048923 Bacteria 1072
148 Ga0496121_0007432 3300048924 Bacteria 13241
149 Ga0496121_0008446 3300048924 Bacteria 12108
150 Ga0496122_0141788 3300048925 Bacteria 1502
151 Ga0496123_0287492 3300048926 Bacteria 791
152 Ga0496124_0005730 3300048927 Bacteria 13836
153 Ga0496125_0038374 3300048928 Bacteria 4146
154 Ga0496125_0105207 3300048928 Bacteria 2063
155 Ga0496126_0000051 3300048929 Bacteria 313169
156 Ga0496126_0240840 3300048929 Bacteria 1511
157 Ga0501032_0357222 3300049569 Bacteria 941
158 Ga0501033_0316267 3300049570 Bacteria 1097
159 Ga0501034_0293092 3300049571 Bacteria 1565
160 Ga0501043_0381609 3300049579 Bacteria 1067
161 Ga0501047_0203522 3300049581 Bacteria 1840
162 Ga0501047_0249475 3300049581 Bacteria 1624
163 Ga0501263_033796 3300049760 Bacteria 731
164 Ga0501044_0005346 3300049823 Bacteria 14275
165 Ga0501044_0512937 3300049823 Bacteria 1099
166 nmdc:mga03683_14013_c1 3300050489 Bacteria 2959
167 nmdc:mga03683_362_c1 3300050489 Bacteria 13074
168 nmdc:mga03683_56016_c1 3300050489 Bacteria 1657
169 nmdc:mga00v17_32984_c1 3300050491 Bacteria 3065
170 nmdc:mga00v17_33046_c1 3300050491 Bacteria 3063
171 nmdc:mga00v17_788_c1 3300050491 Bacteria 17261
172 nmdc:mga0yw44_44687_c1 3300050492 Bacteria 2651
173 nmdc:mga0k408_17809_c1 3300050493 Bacteria 3960
174 nmdc:mga0k408_182945_c1 3300050493 Bacteria 1250
175 nmdc:mga06z11_454_c1 3300050494 Bacteria 15252
176 nmdc:mga04h51_295_c1 3300050495 Bacteria 12764
177 nmdc:mga07m45_301205_c1 3300050496 Bacteria 932
178 nmdc:mga07m45_41687_c1 3300050496 Bacteria 2142
179 nmdc:mga07m45_44682_c1 3300050496 Bacteria 2486
180 nmdc:mga07m45_5_c2 3300050496 Bacteria 297012
181 nmdc:mga0sz30_136_c1 3300050516 Bacteria 27266
182 nmdc:mga0sz30_645_c2 3300050516 Bacteria 2849
183 Ga0500607_000292 3300053121 Bacteria 47464
184 Ga0500608_000554 3300053122 Bacteria 13983
185 Ga0500614_005754 3300053123 Bacteria 2604
186 Ga0500559_0004865 3300053136 Bacteria 6264
187 Ga0500559_0114590 3300053136 Bacteria 1250
188 Ga0500564_012484 3300053138 Bacteria 3777
189 Ga0500564_067475 3300053138 Bacteria 1617
190 Ga0500604_0045272 3300053151 Unclassified 1342
191 Ga0500622_0006895 3300053156 Bacteria 6517
192 Ga0500636_0094135 3300053177 Bacteria 1712
193 Ga0500637_0004549 3300053178 Bacteria 6597
194 Ga0500567_011266 3300053723 Bacteria 4279
195 Ga0500625_000014 3300053729 Bacteria 109364
196 Ga0500645_003915 3300053730 Bacteria 5875
197 2848298852 2848297114 Bacteria 3608511
198 2643948398 2643221588 Bacteria 3692460
199 2738710439 2738541275 Bacteria 4830863
200 2738848864 2738541301 Bacteria 4834102
201 2738864593 2738541304 Bacteria 4833665
202 2739297111 2738543022 Bacteria 4835059
203 2739358789 2738543033 Bacteria 4833336
204 2740029346 2739367865 Bacteria 4114482
205 2882808648 2882806704 Bacteria 3007728
206 2895881479 2895880812 Bacteria 11255272
207 2896254413 2896253425 Bacteria 3418029
208 2928100538 2928100450 Bacteria 4837635
209 2928960602 2928959182 Bacteria 4725774
210 3000865382 3000865235 Bacteria 3106258
211 JGI24748J21848_1000205
212 JGI24034J26672_10002546
213 Ga0065704_10070637
214 Ga0065704_10078900
215 Ga0070658_10063245
216 Ga0070676_10422566
217 Ga0070666_10098887
218 Ga0070666_10180519
219 Ga0070682_100386360
220 Ga0070668_100002787
221 Ga0070668_100003059
222 Ga0070669_100000056
223 Ga0070669_100000500
224 Ga0070671_100000198
225 Ga0070671_100002411
226 Ga0070659_100065738
227 Ga0070667_100001829
228 Ga0070667_100317768
229 Ga0070708_100080919
230 Ga0070663_100002596
231 Ga0070695_100857471
232 Ga0070665_100000538
233 Ga0070665_100006288
234 Ga0070665_100239482
235 Ga0070664_100153334
236 Ga0068857_100418718
237 Ga0068857_100808933
238 Ga0068854_100037585
239 Ga0068859_100035369
240 Ga0068864_100273612
241 Ga0068863_100007155
242 Ga0068858_100042875
243 Ga0068860_100007513
244 Ga0068860_100019236
245 Ga0068862_100125990
246 Ga0068862_100432276
247 Ga0075365_10087955
248 Ga0075368_10000827
249 Ga0075363_100026709
250 Ga0075364_10034679
251 Ga0075364_10037499
252 Ga0075432_10000571
253 Ga0075362_10000499
254 Ga0075362_10015060
255 Ga0075362_10024658
256 Ga0075367_10035999
257 Ga0075369_10013376
258 Ga0075366_10002584
259 Ga0075366_10240298
260 Ga0075370_10113034
261 Ga0075428_100551962
262 Ga0097620_100035369
263 Ga0079104_1007109
264 Ga0105251_10007198
265 Ga0105251_10118014
266 Ga0105243_10591853
267 Ga0105248_10028610
268 Ga0105248_10308161
269 Ga0105248_10343392
270 Ga0105249_10002003
271 Ga0105249_10533083
272 Ga0105249_11563508
273 Ga0157371_10299664
274 Ga0157369_10102821
275 Ga0163162_10002115
276 Ga0163162_10010973
277 Ga0163162_10917650
278 Ga0157372_10818988
279 Ga0157372_11033333
280 Ga0157375_11151790
281 Ga0157380_10195090
282 Ga0163161_10057671
283 Ga0207696_1004284
284 Ga0207713_1002165
285 Ga0207713_1003104
286 Ga0207688_10219897
287 Ga0207680_10176101
288 Ga0207681_10000019
289 Ga0207681_10000802
290 Ga0207650_10152550
291 Ga0207644_10000446
292 Ga0207644_10000838
293 Ga0207690_10044636
294 Ga0207706_10081404
295 Ga0207706_10257103
296 Ga0207711_10005062
297 Ga0207711_10023460
298 Ga0207711_10091773
299 Ga0207711_10481393
300 Ga0207661_10475697
301 Ga0207679_10370277
302 Ga0207668_10001565
303 Ga0207668_10005163
304 Ga0207668_10033015
305 Ga0207668_10366513
306 Ga0207668_10427969
307 Ga0207640_10022625
308 Ga0207658_10000529
309 Ga0207658_10008736
310 Ga0207658_10569096
311 Ga0207703_10258253
312 Ga0207678_10329343
313 Ga0207708_10105946
314 Ga0207641_10003902
315 Ga0209813_10000533
316 Ga0209974_10019920
317 Ga0207428_10058357
318 Ga0268266_10000499
319 Ga0268266_10001459
320 Ga0268266_10202922
321 Ga0268265_10022981
322 Ga0268265_10074005
323 Ga0268264_10009108
324 Ga0268264_10031434
325 Ga0307408_100189912
326 Ga0307408_100593939
327 Ga0307508_10039338
328 Ga0307405_10339107
329 Ga0307413_10083860
330 Ga0307406_10079534
331 Ga0307409_100141807
332 Ga0307409_100284053
333 Ga0307416_100514059
334 Ga0307414_10019924
335 Ga0307414_10022534
336 Ga0307414_10104588
337 Ga0307411_10431443
338 Ga0307510_10248133
339 Ga0439462_0000371
340 Ga0450897_010525
341 Ga0450893_0018489
342 Ga0496101_0156007
343 Ga0496101_0224047
344 Ga0496102_0000787
345 Ga0496102_0208776
346 Ga0496103_0000343
347 Ga0496103_0004034
348 Ga0496103_0391809
349 Ga0496105_0007455
350 Ga0496113_0016093
351 Ga0496115_0140292
352 Ga0496116_0019649
353 Ga0496117_0001020
354 Ga0496117_0024402
355 Ga0496118_0017270
356 Ga0496118_0032214
357 Ga0496120_0171726
358 Ga0496121_0007432
359 Ga0496121_0008446
360 Ga0496122_0141788
361 Ga0496123_0287492
362 Ga0496124_0005730
363 Ga0496125_0038374
364 Ga0496125_0105207
365 Ga0496126_0000051
366 Ga0496126_0240840
367 Ga0501032_0357222
368 Ga0501033_0316267
369 Ga0501034_0293092
370 Ga0501043_0381609
371 Ga0501047_0203522
372 Ga0501047_0249475
373 Ga0501263_033796
374 Ga0501044_0005346
375 Ga0501044_0512937
376 nmdc:mga03683_14013_c1
377 nmdc:mga03683_362_c1
378 nmdc:mga03683_56016_c1
379 nmdc:mga00v17_32984_c1
380 nmdc:mga00v17_33046_c1
381 nmdc:mga00v17_788_c1
382 nmdc:mga0yw44_44687_c1
383 nmdc:mga0k408_17809_c1
384 nmdc:mga0k408_182945_c1
385 nmdc:mga06z11_454_c1
386 nmdc:mga04h51_295_c1
387 nmdc:mga07m45_301205_c1
388 nmdc:mga07m45_41687_c1
389 nmdc:mga07m45_44682_c1
390 nmdc:mga07m45_5_c2
391 nmdc:mga0sz30_136_c1
392 nmdc:mga0sz30_645_c2
393 Ga0500607_000292
394 Ga0500608_000554
395 Ga0500614_005754
396 Ga0500559_0004865
397 Ga0500559_0114590
398 Ga0500564_012484
399 Ga0500564_067475
400 Ga0500604_0045272
401 Ga0500622_0006895
402 Ga0500636_0094135
403 Ga0500637_0004549
404 Ga0500567_011266
405 Ga0500625_000014
406 Ga0500645_003915
407 2848298852
408 2643948398
409 2738710439
410 2738848864
411 2738864593
412 2739297111
413 2739358789
414 2740029346
415 2882808648
416 2895881479
417 2896254413
418 2928100538
419 2928960602
420 3000865382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14014

DUF4230

Protein of unknown function (DUF4230)

68

219

0.84

Map