F320989

General Info

Members Datasets Scaffolds Average Seq Length
210 145 175 348

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221619|2644110733
Length 390
Sequence DPIGDFAEAAAPTPDEERLGVDSDEERLGVDSDEERLGVDSDEERLSIDGIAMVRLLGPQDRLLTQVQREYPGVQVHVRGNEIAIRGDQEGRMHVRRLIEELLELVRSGQDPTPTEVRSSARMLEADPNAKPSELLGQVIVSSRGKTIRPKTEGQRRYVDAIDEHTIVFGIGPAGTGKTYLAMAKAVQALQRKEVSRIILTRPAVEAGERLGFLPGTLTDKIDPYLRPLYDALNEMMDPELVPKLLASGTVEVAPLAYMRGRTLNDSFVVLDEAQNTTPEQMKMFLTRLGFGSRMVVTGDITQIDLPGGASGLRLVTRILDHVEDIEFVRLTSDDVVRHTLVGRIVDAYTEFDQRQQAQRFERDQAREFANRAERRGAGPRDHLPRKGKA

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221619 Agromyces sp. Root81 Isolate Unclassified
5 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
6 2643221649 Leifsonia sp. Root4 Isolate Unclassified
7 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
8 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
9 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
10 2773857759 Microbacterium sp. 1294 Isolate Unclassified
11 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
12 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
13 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
14 2808606372 Agromyces sp. 23-23 Isolate Unclassified
15 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
16 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
17 2902582711 Micromonospora sp. AP08 Isolate Unclassified
18 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
19 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
20 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
21 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
22 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
23 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
24 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
25 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
26 2920879853 Kocuria salina CV6 Isolate Unclassified
27 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
28 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
29 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
30 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
31 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
32 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
33 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
37 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
38 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
41 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
42 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
111 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
112 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
113 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
116 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
117 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
118 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
119 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
120 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
121 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
140 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
141 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
144 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
145 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 3.33
Isolates 16.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 3.81
Nodule 0
Rhizoplane 10.48
Rhizosphere 59.52
Stem 0
Stem Tuber 0
Unclassified 25.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10004172 3300002067 Bacteria 4880
2 JGI25406J46586_10016227 3300003203 Bacteria 3111
3 Ga0006562J51391_1028904 3300003578 Bacteria 5220
4 Ga0058859_10095246 3300004798 Bacteria 1152
5 Ga0058863_11740987 3300004799 Bacteria 1271
6 Ga0058861_11903183 3300004800 Bacteria 1772
7 Ga0058860_12163698 3300004801 Bacteria 1201
8 Ga0065714_10014224 3300005288 Bacteria 1757
9 Ga0070658_10000833 3300005327 Bacteria 26391
10 Ga0070658_10109182 3300005327 Bacteria 2290
11 Ga0070659_100024279 3300005366 Bacteria 4645
12 Ga0070667_100000033 3300005367 Bacteria 175463
13 Ga0070714_100000050 3300005435 Bacteria 110823
14 Ga0070713_100305406 3300005436 Bacteria 1466
15 Ga0070700_100000026 3300005441 Bacteria 125610
16 Ga0070665_100004911 3300005548 Bacteria 13869
17 Ga0068859_100001517 3300005617 Bacteria 23701
18 Ga0068864_100023965 3300005618 Bacteria 5130
19 Ga0068863_100005183 3300005841 Bacteria 12853
20 Ga0068863_100032678 3300005841 Bacteria 4958
21 Ga0068858_100057217 3300005842 Bacteria 3604
22 Ga0068860_100000010 3300005843 Bacteria 359114
23 Ga0068862_100000008 3300005844 Bacteria 305510
24 Ga0081539_10000682 3300005985 Bacteria 67986
25 Ga0097620_100001516 3300006931 Bacteria 23701
26 Ga0105247_10000019 3300009101 Bacteria 245170
27 Ga0105247_10036816 3300009101 Bacteria 2983
28 Ga0105248_10023398 3300009177 Bacteria 6863
29 Ga0105249_10000019 3300009553 Bacteria 273807
30 Ga0157370_10023935 3300013104 Bacteria 6056
31 Ga0157370_10117850 3300013104 Bacteria 2480
32 Ga0157369_10456864 3300013105 Bacteria 1322
33 Ga0163162_10255666 3300013306 Bacteria 1884
34 Ga0163162_10292859 3300013306 Bacteria 1759
35 Ga0157375_10144053 3300013308 Bacteria 2512
36 Ga0157379_10134732 3300014968 Bacteria 2225
37 Ga0206354_10673422 3300020081 Bacteria 1257
38 Ga0224712_10061233 3300022467 Bacteria 1500
39 Ga0209672_100006 3300025228 Bacteria 1004497
40 Ga0209147_101211 3300025229 Bacteria 10340
41 Ga0209148_1000015 3300025254 Bacteria 850103
42 Ga0209455_1000013 3300025272 Bacteria 850103
43 Ga0207710_10000036 3300025900 Bacteria 245176
44 Ga0207647_10045489 3300025904 Bacteria 2738
45 Ga0207705_10000006 3300025909 Bacteria 657147
46 Ga0207681_10001794 3300025923 Bacteria 13787
47 Ga0207664_10000003 3300025929 Bacteria 510966
48 Ga0207711_10001201 3300025941 Bacteria 24507
49 Ga0207711_10141765 3300025941 Bacteria 2163
50 Ga0207712_10000025 3300025961 Bacteria 274015
51 Ga0207712_10136761 3300025961 Bacteria 1875
52 Ga0207658_10000125 3300025986 Bacteria 83488
53 Ga0207708_10000014 3300026075 Bacteria 203569
54 Ga0207641_10004618 3300026088 Bacteria 11892
55 Ga0207641_10058458 3300026088 Bacteria 3281
56 Ga0207676_10039576 3300026095 Bacteria 3607
57 Ga0268266_10004645 3300028379 Bacteria 13095
58 Ga0268265_10000007 3300028380 Bacteria 431817
59 Ga0268264_10000007 3300028381 Bacteria 815790
60 Ga0307518_10049469 3300031838 Bacteria 3056
61 Ga0307410_10045798 3300031852 Bacteria 2915
62 Ga0307410_10132517 3300031852 Bacteria 1833
63 Ga0307406_10052506 3300031901 Bacteria 2593
64 Ga0307409_100020357 3300031995 Bacteria 4519
65 Ga0395899_0000786 3300037312 Bacteria 31058
66 Ga0395900_0061011 3300037418 Bacteria 3878
67 Ga0466965_0000002 3300044683 Bacteria 297957
68 Ga0466970_0113818 3300044765 Bacteria 1478
69 Ga0466958_0198654 3300045836 Bacteria 1276
70 Ga0495590_0001219 3300046457 Bacteria 11238
71 Ga0495629_0126414 3300046459 Bacteria 1781
72 Ga0495629_0263212 3300046459 Bacteria 1185
73 Ga0495672_0033679 3300047320 Bacteria 3173
74 Ga0495672_0039725 3300047320 Bacteria 2859
75 Ga0496100_0049554 3300048903 Bacteria 2717
76 Ga0496101_0004689 3300048904 Bacteria 8656
77 Ga0496101_0023885 3300048904 Bacteria 4227
78 Ga0496102_0000789 3300048905 Bacteria 30791
79 Ga0496102_0048205 3300048905 Bacteria 3873
80 Ga0496103_0002100 3300048906 Bacteria 12704
81 Ga0496104_0031468 3300048907 Bacteria 4935
82 Ga0496104_0214572 3300048907 Bacteria 1836
83 Ga0496105_0005304 3300048908 Bacteria 9771
84 Ga0496105_0020315 3300048908 Bacteria 5366
85 Ga0496107_0008744 3300048910 Bacteria 7015
86 Ga0496108_0042142 3300048911 Bacteria 3811
87 Ga0496108_0129265 3300048911 Bacteria 2171
88 Ga0496109_0010022 3300048912 Bacteria 8090
89 Ga0496110_0012890 3300048913 Bacteria 6892
90 Ga0496110_0168889 3300048913 Bacteria 1984
91 Ga0496111_0031229 3300048914 Bacteria 3794
92 Ga0496112_0036802 3300048915 Bacteria 4775
93 Ga0496112_0262739 3300048915 Bacteria 1675
94 Ga0496114_0027821 3300048917 Bacteria 4634
95 Ga0496114_0154393 3300048917 Bacteria 1992
96 Ga0496115_0004597 3300048918 Bacteria 9992
97 Ga0496116_0014171 3300048919 Bacteria 6381
98 Ga0496116_0015879 3300048919 Bacteria 5926
99 Ga0496117_0000564 3300048920 Bacteria 60818
100 Ga0496117_0001925 3300048920 Bacteria 27694
101 Ga0496117_0011044 3300048920 Bacteria 8131
102 Ga0496117_0106159 3300048920 Bacteria 1763
103 Ga0496118_0001102 3300048921 Bacteria 41962
104 Ga0496118_0002101 3300048921 Bacteria 27975
105 Ga0496118_0006827 3300048921 Bacteria 12384
106 Ga0496118_0058388 3300048921 Bacteria 2883
107 Ga0496119_0010729 3300048922 Bacteria 7679
108 Ga0496119_0014510 3300048922 Bacteria 6158
109 Ga0496119_0019101 3300048922 Bacteria 5065
110 Ga0496119_0083478 3300048922 Bacteria 1834
111 Ga0496120_0001014 3300048923 Bacteria 37596
112 Ga0496120_0026888 3300048923 Bacteria 3547
113 Ga0496120_0039442 3300048923 Bacteria 2786
114 Ga0496121_0035682 3300048924 Bacteria 4449
115 Ga0496122_0000030 3300048925 Bacteria 331586
116 Ga0496122_0029507 3300048925 Bacteria 4625
117 Ga0496123_0000024 3300048926 Bacteria 331587
118 Ga0496123_0028721 3300048926 Bacteria 4111
119 Ga0496124_0000439 3300048927 Bacteria 73567
120 Ga0496124_0020994 3300048927 Bacteria 6023
121 Ga0496124_0087399 3300048927 Bacteria 2549
122 Ga0496124_0099277 3300048927 Bacteria 2361
123 Ga0496125_0000061 3300048928 Bacteria 262739
124 Ga0496125_0022774 3300048928 Bacteria 5807
125 Ga0496125_0104060 3300048928 Bacteria 2080
126 Ga0496126_0000013 3300048929 Bacteria 690046
127 Ga0496126_0088821 3300048929 Bacteria 2721
128 Ga0496126_0120073 3300048929 Bacteria 2281
129 Ga0501032_0010988 3300049569 Bacteria 6509
130 Ga0501032_0035064 3300049569 Bacteria 3431
131 Ga0501032_0139052 3300049569 Bacteria 1599
132 Ga0501033_0010127 3300049570 Bacteria 7235
133 Ga0501033_0121626 3300049570 Bacteria 1894
134 Ga0501033_0160319 3300049570 Bacteria 1619
135 Ga0501034_0015746 3300049571 Bacteria 7764
136 Ga0501034_0072690 3300049571 Bacteria 3448
137 Ga0501034_0078862 3300049571 Bacteria 3296
138 Ga0501034_0101240 3300049571 Bacteria 2874
139 Ga0501034_0118574 3300049571 Bacteria 2633
140 Ga0501034_0206720 3300049571 Bacteria 1919
141 Ga0501036_0244224 3300049572 Bacteria 1505
142 Ga0501037_0022947 3300049573 Bacteria 4615
143 Ga0501037_0066543 3300049573 Bacteria 2624
144 Ga0501038_0065789 3300049574 Bacteria 3088
145 Ga0501038_0094995 3300049574 Bacteria 2491
146 Ga0501039_0140715 3300049575 Bacteria 1895
147 Ga0501042_0003175 3300049578 Bacteria 10247
148 Ga0501043_0033886 3300049579 Bacteria 4018
149 Ga0501043_0051250 3300049579 Bacteria 3243
150 Ga0501043_0209445 3300049579 Bacteria 1511
151 Ga0501043_0292905 3300049579 Bacteria 1245
152 Ga0501046_0014152 3300049580 Bacteria 6738
153 Ga0501046_0014818 3300049580 Bacteria 6562
154 Ga0501047_0003067 3300049581 Bacteria 15842
155 Ga0501047_0010294 3300049581 Bacteria 8844
156 Ga0501047_0043053 3300049581 Bacteria 4362
157 Ga0501067_0021659 3300049583 Bacteria 3557
158 Ga0501070_0000088 3300049586 Bacteria 77423
159 Ga0501070_0041776 3300049586 Bacteria 3819
160 Ga0501070_0071291 3300049586 Bacteria 2877
161 Ga0501070_0095654 3300049586 Bacteria 2457
162 Ga0501072_0055684 3300049588 Bacteria 3116
163 Ga0501074_0068040 3300049590 Bacteria 2560
164 Ga0501083_0000052 3300049744 Bacteria 84349
165 Ga0501083_0008309 3300049744 Bacteria 7341
166 Ga0501035_0014725 3300049822 Bacteria 7219
167 Ga0501035_0099565 3300049822 Bacteria 2551
168 Ga0501044_0003513 3300049823 Bacteria 17638
169 Ga0501044_0011377 3300049823 Bacteria 9636
170 Ga0501044_0066729 3300049823 Bacteria 3667
171 Ga0501044_0365407 3300049823 Bacteria 1360
172 Ga0500635_0000013 3300053080 Bacteria 133088
173 Ga0500559_0000372 3300053136 Bacteria 33038
174 Ga0500568_0002975 3300053139 Bacteria 9697
175 Ga0500590_035525 3300053148 Bacteria 2579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100000026 Ga0070700_1000000267 291
2 3300026075 Ga0207708_10000014 Ga0207708_1000001420 291
3 3300004798 Ga0058859_10095246 Ga0058859_100952461 292
4 3300004799 Ga0058863_11740987 Ga0058863_117409872 292
5 3300004800 Ga0058861_11903183 Ga0058861_119031831 292
6 3300005435 Ga0070714_100000050 Ga0070714_10000005056 292
7 3300025929 Ga0207664_10000003 Ga0207664_10000003259 292
8 iso_pu_bacteria 8002811521 8002811854 306
9 3300009101 Ga0105247_10000019 Ga0105247_1000001951 307
10 3300009177 Ga0105248_10023398 Ga0105248_100233986 307
11 3300009553 Ga0105249_10000019 Ga0105249_10000019204 307
12 3300013306 Ga0163162_10255666 Ga0163162_102556662 307
13 3300014968 Ga0157379_10134732 Ga0157379_101347322 307
14 3300048904 Ga0496101_0023885 Ga0496101_0023885_225_1184 307
15 3300048905 Ga0496102_0000789 Ga0496102_0000789_29262_30221 307
16 3300048906 Ga0496103_0002100 Ga0496103_0002100_8406_9365 307
17 3300048919 Ga0496116_0015879 Ga0496116_0015879_3248_4207 307
18 3300048920 Ga0496117_0000564 Ga0496117_0000564_12398_13357 307
19 3300048921 Ga0496118_0002101 Ga0496118_0002101_24489_25448 307
20 3300048922 Ga0496119_0010729 Ga0496119_0010729_2144_3103 307
21 3300048923 Ga0496120_0026888 Ga0496120_0026888_679_1638 307
22 3300048924 Ga0496121_0035682 Ga0496121_0035682_1320_2279 307
23 3300048927 Ga0496124_0099277 Ga0496124_0099277_341_1300 307
24 3300048928 Ga0496125_0022774 Ga0496125_0022774_1982_2941 307
25 3300005618 Ga0068864_100023965 Ga0068864_1000239655 308
26 3300005841 Ga0068863_100032678 Ga0068863_1000326781 308
27 3300009101 Ga0105247_10036816 Ga0105247_100368161 308
28 3300025941 Ga0207711_10141765 Ga0207711_101417651 308
29 3300026088 Ga0207641_10058458 Ga0207641_100584581 308
30 3300026095 Ga0207676_10039576 Ga0207676_100395761 308
31 3300031995 Ga0307409_100020357 Ga0307409_1000203572 308
32 3300048915 Ga0496112_0262739 Ga0496112_0262739_118_1092 308
33 3300048905 Ga0496102_0048205 Ga0496102_0048205_1370_2413 313
34 3300048911 Ga0496108_0042142 Ga0496108_0042142_1923_2966 313
35 3300048913 Ga0496110_0168889 Ga0496110_0168889_98_1141 313
36 3300025228 Ga0209672_100006 Ga0209672_100006763 314
37 3300025229 Ga0209147_101211 Ga0209147_1012113 314
38 3300025254 Ga0209148_1000015 Ga0209148_1000015607 314
39 3300025272 Ga0209455_1000013 Ga0209455_1000013607 314
40 3300049586 Ga0501070_0000088 Ga0501070_0000088_61050_62174 314
41 3300048904 Ga0496101_0004689 Ga0496101_0004689_4884_5933 315
42 3300048910 Ga0496107_0008744 Ga0496107_0008744_408_1457 315
43 3300048912 Ga0496109_0010022 Ga0496109_0010022_6071_7120 315
44 3300048915 Ga0496112_0036802 Ga0496112_0036802_37_1086 315
45 3300048917 Ga0496114_0027821 Ga0496114_0027821_3120_4169 315
46 3300048918 Ga0496115_0004597 Ga0496115_0004597_2038_3087 315
47 3300048922 Ga0496119_0083478 Ga0496119_0083478_278_1327 315
48 3300049574 Ga0501038_0094995 Ga0501038_0094995_126_1166 315
49 3300049590 Ga0501074_0068040 Ga0501074_0068040_85_1095 315
50 3300053136 Ga0500559_0000372 Ga0500559_0000372_1889_2884 315
51 3300025961 Ga0207712_10136761 Ga0207712_101367612 317
52 3300049583 Ga0501067_0021659 Ga0501067_0021659_1932_2972 318
53 3300049588 Ga0501072_0055684 Ga0501072_0055684_1641_2681 318
54 3300020081 Ga0206354_10673422 Ga0206354_106734221 320
55 3300046459 Ga0495629_0263212 Ga0495629_0263212_66_1097 321
56 iso_pu_bacteria 2501939600 2501939832 321
57 iso_pu_bacteria 2795385472 2795797867 322
58 3300013104 Ga0157370_10023935 Ga0157370_100239354 323
59 3300005367 Ga0070667_100000033 Ga0070667_100000033113 324
60 3300005548 Ga0070665_100004911 Ga0070665_1000049117 324
61 3300005617 Ga0068859_100001517 Ga0068859_1000015176 324
62 3300005841 Ga0068863_100005183 Ga0068863_1000051837 324
63 3300005842 Ga0068858_100057217 Ga0068858_1000572173 324
64 3300005843 Ga0068860_100000010 Ga0068860_100000010115 324
65 3300005844 Ga0068862_100000008 Ga0068862_100000008209 324
66 3300006931 Ga0097620_100001516 Ga0097620_1000015166 324
67 3300025900 Ga0207710_10000036 Ga0207710_10000036187 324
68 3300025923 Ga0207681_10001794 Ga0207681_1000179413 324
69 3300025941 Ga0207711_10001201 Ga0207711_1000120121 324
70 3300025961 Ga0207712_10000025 Ga0207712_1000002547 324
71 3300025986 Ga0207658_10000125 Ga0207658_1000012573 324
72 3300026088 Ga0207641_10004618 Ga0207641_100046189 324
73 3300028379 Ga0268266_10004645 Ga0268266_1000464510 324
74 3300028380 Ga0268265_10000007 Ga0268265_10000007204 324
75 3300028381 Ga0268264_10000007 Ga0268264_10000007339 324
76 3300003203 JGI25406J46586_10016227 JGI25406J46586_100162272 325
77 3300005327 Ga0070658_10109182 Ga0070658_101091822 325
78 3300005985 Ga0081539_10000682 Ga0081539_1000068265 325
79 3300013104 Ga0157370_10117850 Ga0157370_101178503 325
80 3300013105 Ga0157369_10456864 Ga0157369_104568642 325
81 3300037312 Ga0395899_0000786 Ga0395899_0000786_1482_2492 325
82 3300047320 Ga0495672_0039725 Ga0495672_0039725_1444_2460 325
83 3300049579 Ga0501043_0209445 Ga0501043_0209445_83_1171 325
84 3300049744 Ga0501083_0008309 Ga0501083_0008309_1945_3033 325
85 iso_pu_bacteria 2939657138 2939658281 325
86 3300004801 Ga0058860_12163698 Ga0058860_121636981 326
87 3300046459 Ga0495629_0126414 Ga0495629_0126414_520_1593 326
88 3300048929 Ga0496126_0000013 Ga0496126_0000013_551933_552982 326
89 iso_pu_bacteria 8047710418 8047711576 326
90 3300048907 Ga0496104_0031468 Ga0496104_0031468_3707_4738 327
91 3300048911 Ga0496108_0129265 Ga0496108_0129265_67_1098 327
92 3300048913 Ga0496110_0012890 Ga0496110_0012890_3433_4464 327
93 3300049571 Ga0501034_0206720 Ga0501034_0206720_387_1433 327
94 iso_pu_bacteria 2902582711 2902584855 327
95 3300045836 Ga0466958_0198654 Ga0466958_0198654_194_1228 328
96 3300046457 Ga0495590_0001219 Ga0495590_0001219_5187_6302 329
97 3300047320 Ga0495672_0033679 Ga0495672_0033679_2038_3150 329
98 3300053080 Ga0500635_0000013 Ga0500635_0000013_64785_65810 329
99 3300005436 Ga0070713_100305406 Ga0070713_1003054062 330
100 3300031852 Ga0307410_10045798 Ga0307410_100457982 331
101 3300031901 Ga0307406_10052506 Ga0307406_100525062 331
102 3300048908 Ga0496105_0005304 Ga0496105_0005304_5010_6089 331
103 3300049569 Ga0501032_0010988 Ga0501032_0010988_243_1292 331
104 3300049570 Ga0501033_0121626 Ga0501033_0121626_495_1544 331
105 3300013306 Ga0163162_10292859 Ga0163162_102928592 332
106 3300048903 Ga0496100_0049554 Ga0496100_0049554_780_1859 332
107 3300048907 Ga0496104_0214572 Ga0496104_0214572_588_1667 332
108 3300048908 Ga0496105_0020315 Ga0496105_0020315_1328_2407 332
109 3300048917 Ga0496114_0154393 Ga0496114_0154393_207_1286 332
110 3300048929 Ga0496126_0120073 Ga0496126_0120073_823_1902 332
111 3300049581 Ga0501047_0010294 Ga0501047_0010294_4332_5420 333
112 3300049823 Ga0501044_0365407 Ga0501044_0365407_213_1301 333
113 3300044683 Ga0466965_0000002 Ga0466965_0000002_133993_135060 334
114 3300048914 Ga0496111_0031229 Ga0496111_0031229_2033_3139 334
115 3300048920 Ga0496117_0011044 Ga0496117_0011044_6552_7589 334
116 3300048923 Ga0496120_0039442 Ga0496120_0039442_75_1169 334
117 3300049569 Ga0501032_0035064 Ga0501032_0035064_1523_2590 334
118 3300049571 Ga0501034_0072690 Ga0501034_0072690_120_1202 334
119 3300049571 Ga0501034_0078862 Ga0501034_0078862_1395_2462 334
120 3300049573 Ga0501037_0022947 Ga0501037_0022947_862_1929 334
121 3300049574 Ga0501038_0065789 Ga0501038_0065789_967_2049 334
122 3300053139 Ga0500568_0002975 Ga0500568_0002975_3164_4234 335
123 iso_pu_bacteria 2920879853 2920883758 335
124 3300053148 Ga0500590_035525 Ga0500590_035525_1259_2368 336
125 iso_pu_bacteria 2909074476 2909075142 336
126 iso_pu_bacteria 2919039151 2919040556 336
127 3300005327 Ga0070658_10000833 Ga0070658_1000083317 338
128 3300005366 Ga0070659_100024279 Ga0070659_1000242794 338
129 3300025909 Ga0207705_10000006 Ga0207705_10000006197 338
130 iso_pu_bacteria 2906799679 2906800697 338
131 iso_pu_bacteria 2773857759 2774384553 339
132 iso_pu_bacteria 2808606368 2808885673 339
133 iso_pu_bacteria 2895660088 2895661529 339
134 iso_pu_bacteria 2977251589 2977253857 339
135 3300031838 Ga0307518_10049469 Ga0307518_100494692 340
136 3300044765 Ga0466970_0113818 Ga0466970_0113818_149_1261 340
137 3300048921 Ga0496118_0006827 Ga0496118_0006827_6096_7169 340
138 iso_pu_bacteria 2643221572 2643875439 340
139 iso_pu_bacteria 2643221669 2644382494 340
140 iso_pu_bacteria 2904501621 2904502743 340
141 iso_pu_bacteria 2908674828 2908677574 340
142 iso_pu_bacteria 2928500415 2928501616 340
143 3300013308 Ga0157375_10144053 Ga0157375_101440533 341
144 iso_pu_bacteria 2808606306 2808631158 341
145 3300005288 Ga0065714_10014224 Ga0065714_100142241 342
146 3300025904 Ga0207647_10045489 Ga0207647_100454893 342
147 3300048919 Ga0496116_0014171 Ga0496116_0014171_5271_6341 342
148 3300048920 Ga0496117_0106159 Ga0496117_0106159_653_1723 342
149 3300048921 Ga0496118_0058388 Ga0496118_0058388_652_1722 342
150 3300048922 Ga0496119_0019101 Ga0496119_0019101_2697_3767 342
151 3300048923 Ga0496120_0001014 Ga0496120_0001014_1317_2387 342
152 3300048925 Ga0496122_0000030 Ga0496122_0000030_41909_42979 342
153 3300048926 Ga0496123_0000024 Ga0496123_0000024_41909_42979 342
154 3300048927 Ga0496124_0087399 Ga0496124_0087399_508_1578 342
155 3300048928 Ga0496125_0104060 Ga0496125_0104060_78_1148 342
156 3300048929 Ga0496126_0088821 Ga0496126_0088821_420_1490 342
157 3300003578 Ga0006562J51391_1028904 Ga0006562J51391_10289045 343
158 3300048928 Ga0496125_0000061 Ga0496125_0000061_207132_208232 343
159 iso_pu_bacteria 2643221635 2644199100 343
160 iso_pu_bacteria 2939660829 2939664003 343
161 3300049578 Ga0501042_0003175 Ga0501042_0003175_7675_8754 344
162 3300049744 Ga0501083_0000052 Ga0501083_0000052_30721_31800 344
163 iso_pu_bacteria 2893684298 2893684458 344
164 3300037418 Ga0395900_0061011 Ga0395900_0061011_1370_2455 345
165 iso_pu_bacteria 2643221649 2644279312 345
166 iso_pu_bacteria 2721755702 2723642351 345
167 iso_pu_bacteria 2904430863 2904433136 345
168 iso_pu_bacteria 2919042368 2919043656 345
169 iso_pu_bacteria 2984551494 2984553875 345
170 3300049569 Ga0501032_0139052 Ga0501032_0139052_217_1305 346
171 3300049570 Ga0501033_0010127 Ga0501033_0010127_3848_4936 346
172 3300049570 Ga0501033_0160319 Ga0501033_0160319_130_1218 346
173 3300049571 Ga0501034_0015746 Ga0501034_0015746_1252_2340 346
174 3300049571 Ga0501034_0118574 Ga0501034_0118574_1029_2117 346
175 3300049572 Ga0501036_0244224 Ga0501036_0244224_14_1102 346
176 3300049573 Ga0501037_0066543 Ga0501037_0066543_922_2010 346
177 3300049575 Ga0501039_0140715 Ga0501039_0140715_680_1768 346
178 3300049579 Ga0501043_0033886 Ga0501043_0033886_2532_3620 346
179 3300049579 Ga0501043_0292905 Ga0501043_0292905_140_1228 346
180 3300049580 Ga0501046_0014152 Ga0501046_0014152_4314_5402 346
181 3300049581 Ga0501047_0043053 Ga0501047_0043053_2279_3367 346
182 3300049586 Ga0501070_0041776 Ga0501070_0041776_1068_2159 346
183 3300049586 Ga0501070_0095654 Ga0501070_0095654_516_1604 346
184 3300049822 Ga0501035_0014725 Ga0501035_0014725_2368_3456 346
185 3300049822 Ga0501035_0099565 Ga0501035_0099565_884_1972 346
186 3300049823 Ga0501044_0011377 Ga0501044_0011377_3021_4109 346
187 3300049823 Ga0501044_0066729 Ga0501044_0066729_301_1389 346
188 iso_pu_bacteria 2751185788 2753301717 346
189 iso_pu_bacteria 2928104781 2928106566 346
190 3300022467 Ga0224712_10061233 Ga0224712_100612332 347
191 3300049571 Ga0501034_0101240 Ga0501034_0101240_214_1311 348
192 3300049579 Ga0501043_0051250 Ga0501043_0051250_519_1616 348
193 3300049580 Ga0501046_0014818 Ga0501046_0014818_3465_4562 348
194 3300049581 Ga0501047_0003067 Ga0501047_0003067_7792_8889 348
195 3300049586 Ga0501070_0071291 Ga0501070_0071291_213_1310 348
196 3300049823 Ga0501044_0003513 Ga0501044_0003513_10851_11948 348
197 3300048927 Ga0496124_0020994 Ga0496124_0020994_3904_5046 349
198 iso_pu_bacteria 2919443155 2919445959 349
199 3300048920 Ga0496117_0001925 Ga0496117_0001925_25168_26313 350
200 3300048921 Ga0496118_0001102 Ga0496118_0001102_31538_32683 350
201 3300048922 Ga0496119_0014510 Ga0496119_0014510_1938_3083 350
202 3300048925 Ga0496122_0029507 Ga0496122_0029507_1558_2703 350
203 3300048926 Ga0496123_0028721 Ga0496123_0028721_2004_3149 350
204 3300048927 Ga0496124_0000439 Ga0496124_0000439_11630_12775 350
205 3300031852 Ga0307410_10132517 Ga0307410_101325173 351
206 iso_pu_bacteria 2808606372 2808902326 351
207 iso_pu_bacteria 2935409751 2935412732 351
208 3300002067 JGI24735J21928_10004172 JGI24735J21928_100041722 352
209 iso_pu_bacteria 2643221549 2643767472 352
210 iso_pu_bacteria 2643221619 2644110733 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02562

PhoH

PhoH-like protein

147

350

0.99

PF13604

AAA_30

AAA domain

151

377

0.84

PF13245

AAA_19

AAA domain

155

308

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dtj-assembly4.cif.gz_D crystal structure of nova-2 kh3 k-homology rna-binding domain 0.888 16 76
6y2d-assembly1.cif.gz_A crystal structure of the second kh domain of fubp1 0.8874 16 78
3b85-assembly1.cif.gz_B crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.8792 112 313
3b85-assembly1.cif.gz_A crystal structure of predicted phosphate starvation-induced atpase phoh2 from corynebacterium glutamicum 0.8783 112 313
6qh2-assembly1.cif.gz_A solution nmr ensemble for a chimeric kh-s1 domain construct of exosomal polynucleotide phosphrylase at 298k compiled using the comand method 0.8776 17 79
ID Description Score Start End Superfamily
af_O59810_737_809_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.9297 17 85 3.30.1370.10
af_F1R9Y8_652_728_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.9275 15 82 3.30.1370.10
af_D4A4T3_493_567_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.927 15 83 3.30.1370.10
af_Q17832_484_564_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.9256 15 85 3.30.1370.10
af_Q2FY01_1_104_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9199 17 100 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A358NH73-F1-model_v4 Phosphate starvation-inducible protein PhoH 0.9404 14 100 GO:0003723
AF-A0A496LEA0-F1-model_v4 deleted 0.9296 14 100
AF-A0A436M343-F1-model_v4 deleted 0.9267 12 99
AF-A0A353K4T4-F1-model_v4 deleted 0.9261 8 100
AF-A0A380FH42-F1-model_v4 PhoH-like protein 0.9082 106 285 GO:0005524
GO:0005829

Feature Viewer

pLDDT pTM Quality
77.61 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map