F320910

General Info

Members Datasets Scaffolds Average Seq Length
210 106 420 434

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0000562|Ga0501083_0000562_12966_14390
Length 474
Sequence VPATPGQTQDRTTAPRAEFSSRHRLRLAGIGFGQHAMNLVERVRQAGIVGAGGGGFPTHVKLAATADTVIANGAECEPLLHKDAAVMEHEAELVVRGMQLAMEAVKARDGVVGIKAKNAHAVETIRAACAGTSVRVHLLGDYYPAGDEYDLVHEVTGRLIPPGGIPLNVGVVVCNVETFANIARAADGRPVTQKVLTIAGAVSQPLTLTVPLGTSLRECIAAAGGATVADPVLCIGGMMMGETTDALDRPVTKTTGGVIVLGREHHVVARKLKPAPVQNAIGKSACDQCRYCTEFCPRFLLGYAVEPHQVMRSLAFTATGAERWNEWAAMCCACGLCTLYACPEELFPKEACDQSKAEMRRANLKWSGPTTVKPHPMRDGRRVPIKSLMKKLHIAHYDHPAPLQPTAVAPRRLVLPLKQSAGNAVRPVVQRGERVAAGQLLGDVGEKELGAALHAPIAALVHEITPQHVALERL

Samples

Sample ID Description Type Environment
1 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
22 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
23 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
24 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
36 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
37 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
38 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
39 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
40 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
41 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
42 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
43 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
44 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
45 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
46 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
47 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
48 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
49 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
50 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
51 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
52 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
53 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
54 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
55 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
56 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
59 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
60 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
61 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
62 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
63 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
64 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
65 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
74 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
75 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
88 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
89 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
90 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
97 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501083_0000562 3300049744 Bacteria 23795
2 Ga0070683_100000013 3300005329 Bacteria 241235
3 Ga0070683_100059050 3300005329 Bacteria 3563
4 Ga0070673_100105141 3300005364 Bacteria 2332
5 Ga0070714_100008582 3300005435 Bacteria 7993
6 Ga0070713_100028118 3300005436 Bacteria 4437
7 Ga0070684_100000015 3300005535 Bacteria 143515
8 Ga0070684_100101363 3300005535 Bacteria 2573
9 Ga0068855_100053461 3300005563 Unclassified 4751
10 Ga0068856_100007084 3300005614 Bacteria 10948
11 Ga0068856_100011530 3300005614 Bacteria 8575
12 Ga0068859_100088286 3300005617 Unclassified 3150
13 Ga0068859_100316621 3300005617 Unclassified 1654
14 Ga0068864_100009566 3300005618 Bacteria 7992
15 Ga0068863_100242128 3300005841 Bacteria 1741
16 Ga0070717_10013054 3300006028 Bacteria 6348
17 Ga0075431_100020509 3300006847 Bacteria 6752
18 Ga0097620_100088286 3300006931 Unclassified 3150
19 Ga0097620_100316617 3300006931 Unclassified 1654
20 Ga0105240_10111090 3300009093 Bacteria 3316
21 Ga0105248_10019211 3300009177 Bacteria 7560
22 Ga0105248_10043145 3300009177 Bacteria 5057
23 Ga0105248_10203846 3300009177 Bacteria 2229
24 Ga0105238_10074415 3300009551 Bacteria 3389
25 Ga0105238_10091029 3300009551 Bacteria 3038
26 Ga0105238_10171229 3300009551 Bacteria 2147
27 Ga0105239_10266996 3300010375 Bacteria 1924
28 Ga0157370_10150402 3300013104 Bacteria 2166
29 Ga0157369_10134259 3300013105 Unclassified 2621
30 Ga0157372_10104115 3300013307 Bacteria 3244
31 Ga0163163_10184005 3300014325 Unclassified 2137
32 Ga0157376_10034190 3300014969 Bacteria 4102
33 Ga0157376_10167910 3300014969 Bacteria 1995
34 Ga0207695_10064592 3300025913 Bacteria 3767
35 Ga0207671_10065815 3300025914 Bacteria 2696
36 Ga0207694_10173364 3300025924 Bacteria 1747
37 Ga0207664_10002045 3300025929 Bacteria 13286
38 Ga0207711_10112180 3300025941 Bacteria 2426
39 Ga0207661_10000018 3300025944 Bacteria 242506
40 Ga0207667_10020721 3300025949 Bacteria 7305
41 Ga0207702_10001457 3300026078 Bacteria 23515
42 Ga0207702_10235082 3300026078 Bacteria 1714
43 Ga0207641_10253327 3300026088 Bacteria 1645
44 Ga0207676_10027959 3300026095 Bacteria 4207
45 Ga0207674_10116808 3300026116 Bacteria 2639
46 Ga0265337_1000178 3300028556 Bacteria 33456
47 Ga0265337_1000767 3300028556 Bacteria 16925
48 Ga0265319_1000082 3300028563 Bacteria 74926
49 Ga0265319_1000211 3300028563 Bacteria 44129
50 Ga0265319_1000383 3300028563 Bacteria 32025
51 Ga0265318_10000417 3300028577 Bacteria 32812
52 Ga0265318_10000799 3300028577 Bacteria 20849
53 Ga0265318_10001134 3300028577 Bacteria 16623
54 Ga0265323_10000181 3300028653 Bacteria 37901
55 Ga0265323_10000316 3300028653 Bacteria 27949
56 Ga0265323_10001126 3300028653 Bacteria 13794
57 Ga0265323_10019014 3300028653 Bacteria 2654
58 Ga0265322_10000028 3300028654 Bacteria 85065
59 Ga0265322_10000400 3300028654 Bacteria 17875
60 Ga0265322_10000531 3300028654 Bacteria 14710
61 Ga0265322_10008228 3300028654 Unclassified 3041
62 Ga0265322_10022165 3300028654 Unclassified 1818
63 Ga0265336_10000152 3300028666 Bacteria 49208
64 Ga0265338_10000040 3300028800 Bacteria 232041
65 Ga0265338_10000245 3300028800 Bacteria 99446
66 Ga0265338_10000295 3300028800 Bacteria 89990
67 Ga0265338_10003487 3300028800 Bacteria 22101
68 Ga0265338_10009275 3300028800 Bacteria 11772
69 Ga0265338_10037952 3300028800 Bacteria 4574
70 Ga0265324_10000481 3300029957 Bacteria 27964
71 Ga0265324_10000484 3300029957 Bacteria 27886
72 Ga0265324_10001659 3300029957 Bacteria 12315
73 Ga0265324_10003048 3300029957 Bacteria 8184
74 Ga0265324_10003765 3300029957 Bacteria 7086
75 Ga0265324_10004359 3300029957 Bacteria 6431
76 Ga0265324_10006352 3300029957 Bacteria 4944
77 Ga0265330_10001419 3300031235 Bacteria 14021
78 Ga0265330_10020587 3300031235 Unclassified 3014
79 Ga0265330_10050085 3300031235 Bacteria 1832
80 Ga0265332_10012876 3300031238 Bacteria 3710
81 Ga0265332_10055297 3300031238 Bacteria 1702
82 Ga0265328_10000745 3300031239 Bacteria 15095
83 Ga0265328_10011171 3300031239 Bacteria 3595
84 Ga0265320_10000564 3300031240 Bacteria 28607
85 Ga0265320_10003152 3300031240 Bacteria 11192
86 Ga0265320_10035483 3300031240 Bacteria 2527
87 Ga0265320_10040938 3300031240 Bacteria 2306
88 Ga0265325_10007303 3300031241 Bacteria 6631
89 Ga0265325_10012556 3300031241 Bacteria 4841
90 Ga0265325_10039666 3300031241 Bacteria 2478
91 Ga0265329_10001143 3300031242 Bacteria 13047
92 Ga0265340_10012730 3300031247 Bacteria 4441
93 Ga0265340_10045134 3300031247 Bacteria 2154
94 Ga0265339_10003636 3300031249 Bacteria 10757
95 Ga0265331_10001038 3300031250 Bacteria 21666
96 Ga0265331_10040722 3300031250 Bacteria 2259
97 Ga0265331_10070954 3300031250 Bacteria 1630
98 Ga0265327_10002069 3300031251 Bacteria 22420
99 Ga0265327_10009132 3300031251 Bacteria 7212
100 Ga0265316_10003330 3300031344 Bacteria 16286
101 Ga0265316_10011222 3300031344 Bacteria 8102
102 Ga0265316_10026632 3300031344 Bacteria 4804
103 Ga0265316_10028020 3300031344 Bacteria 4652
104 Ga0265316_10056595 3300031344 Bacteria 3061
105 Ga0265316_10061749 3300031344 Bacteria 2910
106 Ga0265316_10075820 3300031344 Bacteria 2585
107 Ga0265316_10114024 3300031344 Bacteria 2045
108 Ga0265316_10116029 3300031344 Bacteria 2024
109 Ga0265316_10160586 3300031344 Bacteria 1680
110 Ga0265313_10003806 3300031595 Bacteria 11940
111 Ga0265313_10005280 3300031595 Bacteria 9563
112 Ga0265313_10007309 3300031595 Bacteria 7581
113 Ga0265314_10000554 3300031711 Bacteria 47642
114 Ga0265314_10001204 3300031711 Bacteria 29721
115 Ga0265314_10002774 3300031711 Bacteria 17501
116 Ga0265314_10003959 3300031711 Bacteria 14038
117 Ga0265342_10000219 3300031712 Bacteria 64778
118 Ga0265342_10001130 3300031712 Bacteria 25533
119 Ga0265342_10002170 3300031712 Bacteria 17255
120 Ga0316578_10038243 3300031728 Bacteria 2767
121 Ga0373950_0001292 3300034818 Bacteria 3242
122 Ga0373926_0015286 3300035083 Bacteria 2616
123 Ga0373928_0000275 3300035084 Bacteria 10133
124 Ga0373929_0001367 3300035085 Unclassified 4672
125 Ga0373944_0005073 3300035089 Bacteria 3456
126 Ga0373949_0001539 3300035090 Bacteria 6530
127 Ga0373932_0000006 3300035112 Bacteria 208547
128 Ga0373962_0000299 3300035242 Bacteria 10680
129 Ga0373931_0000009 3300035691 Bacteria 349854
130 Ga0373935_0092627 3300035692 Bacteria 1981
131 Ga0373927_0002030 3300035695 Bacteria 14903
132 Ga0373927_0006087 3300035695 Bacteria 8262
133 Ga0373927_0036395 3300035695 Bacteria 3201
134 Ga0373937_0135226 3300036401 Bacteria 2305
135 Ga0373937_0364990 3300036401 Unclassified 1369
136 Ga0316582_0060562 3300036647 Bacteria 2427
137 Ga0373925_0001202 3300037068 Bacteria 22811
138 Ga0373925_0029439 3300037068 Unclassified 4030
139 Ga0373925_0079931 3300037068 Bacteria 2485
140 Ga0451577_0000656 3300042876 Bacteria 54604
141 Ga0451577_0002620 3300042876 Bacteria 21104
142 Ga0451577_0076505 3300042876 Bacteria 2984
143 Ga0451577_0088270 3300042876 Bacteria 2767
144 Ga0451577_0110079 3300042876 Unclassified 2463
145 Ga0451577_0247649 3300042876 Bacteria 1613
146 Ga0453683_0007823 3300044673 Bacteria 7217
147 Ga0453684_0001285 3300044712 Bacteria 74890
148 Ga0453684_0005061 3300044712 Bacteria 26706
149 Ga0453684_0007068 3300044712 Bacteria 20971
150 Ga0453684_0039117 3300044712 Bacteria 6470
151 Ga0453684_0044896 3300044712 Bacteria 5903
152 Ga0453684_0139922 3300044712 Bacteria 2892
153 Ga0451576_0000548 3300045051 Bacteria 80649
154 Ga0451576_0002231 3300045051 Bacteria 29800
155 Ga0451576_0008590 3300045051 Bacteria 11968
156 Ga0451576_0020021 3300045051 Bacteria 7293
157 Ga0451576_0101608 3300045051 Unclassified 2990
158 Ga0451576_0104544 3300045051 Bacteria 2946
159 Ga0495592_0063313 3300046454 Bacteria 2713
160 Ga0495580_0009853 3300046472 Bacteria 7491
161 Ga0495580_0013752 3300046472 Bacteria 6163
162 Ga0495580_0037570 3300046472 Bacteria 3474
163 Ga0495580_0062983 3300046472 Bacteria 2602
164 Ga0495662_0008736 3300046476 Bacteria 4982
165 Ga0495664_0005814 3300046477 Bacteria 6790
166 Ga0495608_0041035 3300046511 Bacteria 3098
167 Ga0495628_0094320 3300046516 Bacteria 2313
168 Ga0495628_0125156 3300046516 Bacteria 1970
169 Ga0495630_0022848 3300046517 Bacteria 4619
170 Ga0495630_0044860 3300046517 Bacteria 3304
171 Ga0495652_0030251 3300046529 Bacteria 4750
172 Ga0495652_0132186 3300046529 Bacteria 1974
173 Ga0495640_0023038 3300046533 Bacteria 4546
174 Ga0495640_0173493 3300046533 Bacteria 1377
175 Ga0495587_0033830 3300046536 Bacteria 3084
176 Ga0495645_0007777 3300046543 Bacteria 7457
177 Ga0495645_0072879 3300046543 Bacteria 2474
178 Ga0495645_0095766 3300046543 Bacteria 2116
179 Ga0495667_0041409 3300046559 Bacteria 3055
180 Ga0495667_0138677 3300046559 Unclassified 1567
181 Ga0495634_0038626 3300046642 Bacteria 3254
182 Ga0495635_0058259 3300046663 Bacteria 2657
183 Ga0495635_0133565 3300046663 Bacteria 1692
184 Ga0495635_0171552 3300046663 Bacteria 1475
185 Ga0495657_0030846 3300046675 Bacteria 3751
186 Ga0495600_0023686 3300046809 Bacteria 3950
187 Ga0495604_0042704 3300047317 Bacteria 3552
188 Ga0495604_0087701 3300047317 Unclassified 2317
189 Ga0495636_0041910 3300047318 Bacteria 1901
190 Ga0495674_0015434 3300047319 Bacteria 7138
191 Ga0495674_0071755 3300047319 Unclassified 2988
192 Ga0495674_0093135 3300047319 Bacteria 2571
193 Ga0495674_0239244 3300047319 Bacteria 1496
194 Ga0495675_0057423 3300047444 Bacteria 2468
195 Ga0495675_0070342 3300047444 Bacteria 2209
196 Ga0495684_0001197 3300047471 Bacteria 20871
197 Ga0495684_0008184 3300047471 Bacteria 8092
198 Ga0495684_0055156 3300047471 Unclassified 3031
199 Ga0495602_0007921 3300048088 Bacteria 11104
200 Ga0495602_0040720 3300048088 Bacteria 4255
201 Ga0501031_0000331 3300049568 Bacteria 27355
202 Ga0501032_0107493 3300049569 Bacteria 1847
203 Ga0501033_0011186 3300049570 Bacteria 6874
204 Ga0501046_0022982 3300049580 Bacteria 5133
205 Ga0501047_0002311 3300049581 Bacteria 18235
206 Ga0501035_0001919 3300049822 Bacteria 20852
207 Ga0501044_0000207 3300049823 Bacteria 74769
208 Ga0501044_0009827 3300049823 Bacteria 10399
209 nmdc:mga06r32_53633_c1 3300050510 Unclassified 3863
210 Ga0501082_0001212 3300060353 Bacteria 22668
211 Ga0501083_0000562
212 Ga0070683_100000013
213 Ga0070683_100059050
214 Ga0070673_100105141
215 Ga0070714_100008582
216 Ga0070713_100028118
217 Ga0070684_100000015
218 Ga0070684_100101363
219 Ga0068855_100053461
220 Ga0068856_100007084
221 Ga0068856_100011530
222 Ga0068859_100088286
223 Ga0068859_100316621
224 Ga0068864_100009566
225 Ga0068863_100242128
226 Ga0070717_10013054
227 Ga0075431_100020509
228 Ga0097620_100088286
229 Ga0097620_100316617
230 Ga0105240_10111090
231 Ga0105248_10019211
232 Ga0105248_10043145
233 Ga0105248_10203846
234 Ga0105238_10074415
235 Ga0105238_10091029
236 Ga0105238_10171229
237 Ga0105239_10266996
238 Ga0157370_10150402
239 Ga0157369_10134259
240 Ga0157372_10104115
241 Ga0163163_10184005
242 Ga0157376_10034190
243 Ga0157376_10167910
244 Ga0207695_10064592
245 Ga0207671_10065815
246 Ga0207694_10173364
247 Ga0207664_10002045
248 Ga0207711_10112180
249 Ga0207661_10000018
250 Ga0207667_10020721
251 Ga0207702_10001457
252 Ga0207702_10235082
253 Ga0207641_10253327
254 Ga0207676_10027959
255 Ga0207674_10116808
256 Ga0265337_1000178
257 Ga0265337_1000767
258 Ga0265319_1000082
259 Ga0265319_1000211
260 Ga0265319_1000383
261 Ga0265318_10000417
262 Ga0265318_10000799
263 Ga0265318_10001134
264 Ga0265323_10000181
265 Ga0265323_10000316
266 Ga0265323_10001126
267 Ga0265323_10019014
268 Ga0265322_10000028
269 Ga0265322_10000400
270 Ga0265322_10000531
271 Ga0265322_10008228
272 Ga0265322_10022165
273 Ga0265336_10000152
274 Ga0265338_10000040
275 Ga0265338_10000245
276 Ga0265338_10000295
277 Ga0265338_10003487
278 Ga0265338_10009275
279 Ga0265338_10037952
280 Ga0265324_10000481
281 Ga0265324_10000484
282 Ga0265324_10001659
283 Ga0265324_10003048
284 Ga0265324_10003765
285 Ga0265324_10004359
286 Ga0265324_10006352
287 Ga0265330_10001419
288 Ga0265330_10020587
289 Ga0265330_10050085
290 Ga0265332_10012876
291 Ga0265332_10055297
292 Ga0265328_10000745
293 Ga0265328_10011171
294 Ga0265320_10000564
295 Ga0265320_10003152
296 Ga0265320_10035483
297 Ga0265320_10040938
298 Ga0265325_10007303
299 Ga0265325_10012556
300 Ga0265325_10039666
301 Ga0265329_10001143
302 Ga0265340_10012730
303 Ga0265340_10045134
304 Ga0265339_10003636
305 Ga0265331_10001038
306 Ga0265331_10040722
307 Ga0265331_10070954
308 Ga0265327_10002069
309 Ga0265327_10009132
310 Ga0265316_10003330
311 Ga0265316_10011222
312 Ga0265316_10026632
313 Ga0265316_10028020
314 Ga0265316_10056595
315 Ga0265316_10061749
316 Ga0265316_10075820
317 Ga0265316_10114024
318 Ga0265316_10116029
319 Ga0265316_10160586
320 Ga0265313_10003806
321 Ga0265313_10005280
322 Ga0265313_10007309
323 Ga0265314_10000554
324 Ga0265314_10001204
325 Ga0265314_10002774
326 Ga0265314_10003959
327 Ga0265342_10000219
328 Ga0265342_10001130
329 Ga0265342_10002170
330 Ga0316578_10038243
331 Ga0373950_0001292
332 Ga0373926_0015286
333 Ga0373928_0000275
334 Ga0373929_0001367
335 Ga0373944_0005073
336 Ga0373949_0001539
337 Ga0373932_0000006
338 Ga0373962_0000299
339 Ga0373931_0000009
340 Ga0373935_0092627
341 Ga0373927_0002030
342 Ga0373927_0006087
343 Ga0373927_0036395
344 Ga0373937_0135226
345 Ga0373937_0364990
346 Ga0316582_0060562
347 Ga0373925_0001202
348 Ga0373925_0029439
349 Ga0373925_0079931
350 Ga0451577_0000656
351 Ga0451577_0002620
352 Ga0451577_0076505
353 Ga0451577_0088270
354 Ga0451577_0110079
355 Ga0451577_0247649
356 Ga0453683_0007823
357 Ga0453684_0001285
358 Ga0453684_0005061
359 Ga0453684_0007068
360 Ga0453684_0039117
361 Ga0453684_0044896
362 Ga0453684_0139922
363 Ga0451576_0000548
364 Ga0451576_0002231
365 Ga0451576_0008590
366 Ga0451576_0020021
367 Ga0451576_0101608
368 Ga0451576_0104544
369 Ga0495592_0063313
370 Ga0495580_0009853
371 Ga0495580_0013752
372 Ga0495580_0037570
373 Ga0495580_0062983
374 Ga0495662_0008736
375 Ga0495664_0005814
376 Ga0495608_0041035
377 Ga0495628_0094320
378 Ga0495628_0125156
379 Ga0495630_0022848
380 Ga0495630_0044860
381 Ga0495652_0030251
382 Ga0495652_0132186
383 Ga0495640_0023038
384 Ga0495640_0173493
385 Ga0495587_0033830
386 Ga0495645_0007777
387 Ga0495645_0072879
388 Ga0495645_0095766
389 Ga0495667_0041409
390 Ga0495667_0138677
391 Ga0495634_0038626
392 Ga0495635_0058259
393 Ga0495635_0133565
394 Ga0495635_0171552
395 Ga0495657_0030846
396 Ga0495600_0023686
397 Ga0495604_0042704
398 Ga0495604_0087701
399 Ga0495636_0041910
400 Ga0495674_0015434
401 Ga0495674_0071755
402 Ga0495674_0093135
403 Ga0495674_0239244
404 Ga0495675_0057423
405 Ga0495675_0070342
406 Ga0495684_0001197
407 Ga0495684_0008184
408 Ga0495684_0055156
409 Ga0495602_0007921
410 Ga0495602_0040720
411 Ga0501031_0000331
412 Ga0501032_0107493
413 Ga0501033_0011186
414 Ga0501046_0022982
415 Ga0501047_0002311
416 Ga0501035_0001919
417 Ga0501044_0000207
418 Ga0501044_0009827
419 nmdc:mga06r32_53633_c1
420 Ga0501082_0001212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01512

Complex1_51K

Respiratory-chain NADH dehydrogenase 51 Kd subunit

43

184

0.99

PF13534

Fer4_17

4Fe-4S dicluster domain

285

347

0.97

PF13375

RnfC_N

RnfC Barrel sandwich hybrid domain

392

473

0.9

PF10531

SLBB

SLBB domain

195

243

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ahx-assembly1.cif.gz_C cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.8693 2 326
7zc6-assembly1.cif.gz_C na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.8665 2 324
8dss-assembly1.cif.gz_A x-ray crystal structure of geobacillus stearothermophilus comea 0.7829 156 228
4u9o-assembly1.cif.gz_A crystal structure of nqra from vibrio cholerae 0.7681 27 225
4u9q-assembly2.cif.gz_B crystal structure of nqra in spacegroup p21 0.7674 27 225
ID Description Score Start End Superfamily
af_P77611_144_292_3.40.50.11540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.9387 11 154 3.40.50.11540
af_P77611_144_292_3.40.50.11540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.9026 11 154 3.40.50.11540
2fug103 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.8348 156 225 3.10.20.600
af_P31979_241_332_3.10.20.600 Alpha Beta;Roll;Ubiquitin-like (UB roll); 0.7968 154 213 3.10.20.600
2fugA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH-ubiquinone oxidoreductase 51kDa subunit 0.7938 12 150 3.40.50.11540
ID Description Score Start End GO Terms
AF-A0A660YWY9-F1-model_v4 NADH dehydrogenase subunit 0.979 2 228 GO:0009055
GO:0016020
GO:0046872
GO:0051539
AF-A0A3C1VEF8-F1-model_v4 NADH dehydrogenase subunit 0.9759 2 436 GO:0009055
GO:0016020
GO:0046872
GO:0051539
AF-A0A6H9LR21-F1-model_v4 NADH dehydrogenase subunit 0.9746 2 436 GO:0009055
GO:0016020
GO:0046872
GO:0051539
AF-A0A7V3WQA9-F1-model_v4 NADH dehydrogenase subunit 0.9745 2 436 GO:0009055
GO:0016020
GO:0046872
GO:0051539
AF-A0A7C4G697-F1-model_v4 NADH dehydrogenase subunit 0.9733 75 436 GO:0009055
GO:0016020
GO:0046872
GO:0051539

Map