F320801

General Info

Members Datasets Scaffolds Average Seq Length
210 166 164 196

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0000571|Ga0495672_0000571_26271_26945
Length 216
Sequence MGINSGGDRIDRLVLAEGNTGGRVMRERVIADFSRLPLHGMHTASPTWWGTLAFMLIEGTGFALMSLAPTWPIDSPPPGLLPGTLVTLALLASLIPNYMVSRWADQQDLRKVQISMIVMALLGIVPLIIRFFEFPALNVNWDSNAYGSIVWTMLGLHTTHIITDLVDTVVLAALMFTRHGDNPRRFGDVQDNAMYWNFVVLAWLPIYGCIYWIPRL

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
5 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
6 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
7 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
8 2718217882 Rhizobium sp. N741 Isolate Nodule
9 2718217927 Rhizobium sp. N324 Isolate Nodule
10 2718218009 Rhizobium sp. N561 Isolate Nodule
11 2718218363 Rhizobium sp. N113 Isolate Nodule
12 2718218365 Rhizobium sp. N731 Isolate Nodule
13 2718218366 Rhizobium sp. N621 Isolate Nodule
14 2718218423 Rhizobium sp. N941 Isolate Nodule
15 2721755514 Rhizobium sp. N6212 Isolate Nodule
16 2721755809 Rhizobium sp. N541 Isolate Nodule
17 2721755810 Rhizobium sp. N871 Isolate Nodule
18 2728369365 Rhizobium sp. N1341 Isolate Nodule
19 2728369397 Rhizobium sp. N1314 Isolate Nodule
20 2791355260 Rhizobium sp. L9 Isolate Nodule
21 2791355264 Rhizobium sp. S9 Isolate Nodule
22 2791355267 Rhizobium sp. L18 Isolate Nodule
23 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
24 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
25 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
26 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
27 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
28 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
29 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
30 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
31 2842694124 Methylopila sp. R-72369 Isolate Unclassified
32 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
33 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
34 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
35 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
36 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
37 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
38 2996887358 Rhizobium sp. R711 Isolate Nodule
39 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
63 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
65 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
66 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
71 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
72 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
75 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
76 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
77 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
78 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
79 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
80 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
81 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
82 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
83 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
84 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
102 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
114 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
126 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
129 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
131 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
132 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
138 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
139 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
140 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
141 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
142 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
143 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
144 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
145 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
146 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
147 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
148 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
149 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
150 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
151 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
155 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
156 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
157 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 8005275841 Rhizobium sp. N4311 Isolate Nodule
161 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
162 8005321885 Rhizobium sp. R72 Isolate Nodule
163 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
164 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
165 8018176218 Rhizobium sp. N122 Isolate Nodule
166 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.1
Metatranscriptomes 0
Isolates 21.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.24
Nodule 20.48
Rhizoplane 0.95
Rhizosphere 48.1
Stem 0
Stem Tuber 0
Unclassified 15.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10188941 3300003322 Bacteria 3041
2 rootH1_10098823 3300003323 Bacteria 3305
3 Ga0055540_1000157 3300003792 Bacteria 67204
4 Ga0055531_10084859 3300003794 Bacteria 687
5 Ga0070658_10087750 3300005327 Bacteria 2561
6 Ga0070713_100713425 3300005436 Bacteria 958
7 Ga0070665_101492700 3300005548 Bacteria 684
8 Ga0068856_100683227 3300005614 Unclassified 1047
9 Ga0070717_10019325 3300006028 Bacteria 5341
10 Ga0070717_10425885 3300006028 Bacteria 1194
11 Ga0099824_1016704 3300006942 Bacteria 6581
12 Ga0099822_1026152 3300006943 Bacteria 4976
13 Ga0105240_10044225 3300009093 Bacteria 5662
14 Ga0105239_10037787 3300010375 Bacteria 5291
15 Ga0213875_10004353 3300021388 Bacteria 7801
16 Ga0209233_1001741 3300025261 Bacteria 8404
17 Ga0209455_1027836 3300025272 Bacteria 995
18 Ga0209050_1024260 3300025298 Bacteria 2105
19 Ga0209051_1000032 3300025303 Bacteria 383445
20 Ga0209257_1004866 3300025304 Bacteria 9925
21 Ga0207705_10032883 3300025909 Bacteria 3706
22 Ga0207700_10169157 3300025928 Bacteria 1822
23 Ga0207702_10676152 3300026078 Unclassified 1016
24 Ga0209389_1000189 3300027296 Bacteria 46457
25 Ga0209371_1000995 3300027312 Bacteria 21756
26 Ga0209589_1000002 3300027357 Bacteria 708598
27 Ga0209589_1000845 3300027357 Bacteria 46457
28 Ga0209489_100002 3300027361 Bacteria 708609
29 Ga0209489_101612 3300027361 Bacteria 46456
30 Ga0209700_100002 3300027363 Bacteria 708598
31 Ga0268266_10445899 3300028379 Bacteria 1230
32 Ga0268256_1003477 3300030500 Bacteria 7071
33 Ga0307510_10082825 3300033180 Bacteria 3101
34 Ga0395899_0015119 3300037312 Bacteria 5884
35 Ga0395905_0003750 3300037471 Bacteria 16099
36 Ga0395905_0551855 3300037471 Bacteria 1053
37 Ga0436364_0821389 3300037853 Bacteria 1992
38 Ga0436364_1346521 3300037853 Bacteria 19522
39 Ga0395901_0394486 3300038443 Bacteria 1422
40 Ga0436365_0072389 3300039437 Bacteria 2262
41 Ga0436365_0100037 3300039437 Bacteria 13585
42 Ga0436365_1507340 3300039437 Bacteria 1252
43 Ga0436360_0312597 3300039438 Bacteria 4734
44 Ga0436360_0371522 3300039438 Bacteria 1840
45 Ga0436363_0454919 3300039450 Bacteria 5984
46 Ga0451837_1028864 3300041494 Bacteria 3324
47 Ga0451839_0628011 3300041496 Bacteria 3254
48 Ga0451841_0075397 3300041498 Bacteria 3463
49 Ga0451845_0441417 3300041501 Bacteria 3729
50 Ga0451847_0123751 3300041503 Bacteria 3095
51 Ga0451849_0082720 3300041505 Bacteria 6438
52 Ga0451851_0283203 3300041507 Bacteria 1866
53 Ga0451851_0891096 3300041507 Bacteria 1491
54 Ga0451855_1138617 3300041511 Bacteria 3099
55 Ga0466966_0006535 3300044684 Bacteria 7715
56 Ga0466966_0021543 3300044684 Bacteria 4232
57 Ga0466966_0097745 3300044684 Bacteria 1818
58 Ga0466966_0128938 3300044684 Bacteria 1550
59 Ga0466961_0052956 3300044693 Bacteria 2591
60 Ga0466961_0145026 3300044693 Bacteria 1485
61 Ga0466963_0001211 3300044694 Bacteria 13581
62 Ga0466963_0001261 3300044694 Bacteria 13410
63 Ga0466963_0322017 3300044694 Bacteria 1088
64 Ga0466971_0094712 3300044719 Bacteria 1369
65 Ga0466971_0133808 3300044719 Bacteria 1152
66 Ga0466970_0000129 3300044765 Bacteria 34329
67 Ga0466970_0032125 3300044765 Bacteria 2774
68 Ga0466957_0036235 3300044842 Bacteria 2965
69 Ga0466957_0134284 3300044842 Bacteria 1589
70 Ga0466957_0451849 3300044842 Unclassified 885
71 Ga0466959_0004198 3300045049 Bacteria 9604
72 Ga0466959_0169365 3300045049 Bacteria 1532
73 Ga0466958_0014189 3300045836 Bacteria 4548
74 Ga0466967_0004390 3300045976 Bacteria 9499
75 Ga0466967_0043865 3300045976 Bacteria 3875
76 Ga0466967_1905932 3300045976 Bacteria 591
77 Ga0495590_0000303 3300046457 Bacteria 25891
78 Ga0495638_0005742 3300046460 Bacteria 9135
79 Ga0495638_0005881 3300046460 Bacteria 9020
80 Ga0495605_0003143 3300046474 Bacteria 9942
81 Ga0495584_0000908 3300046491 Bacteria 18912
82 Ga0495596_0065257 3300046500 Bacteria 1416
83 Ga0495606_0000472 3300046507 Bacteria 65989
84 Ga0495606_0006892 3300046507 Bacteria 10344
85 Ga0495606_0016703 3300046507 Bacteria 5582
86 Ga0495606_0393219 3300046507 Bacteria 724
87 Ga0495610_0042793 3300046512 Bacteria 2262
88 Ga0495610_0046102 3300046512 Bacteria 2153
89 Ga0495616_0138331 3300046513 Bacteria 1111
90 Ga0495620_0049301 3300046515 Bacteria 1803
91 Ga0495632_0000932 3300046519 Bacteria 25647
92 Ga0495632_0016890 3300046519 Bacteria 4045
93 Ga0495643_0002688 3300046522 Bacteria 13719
94 Ga0495643_0024269 3300046522 Bacteria 3441
95 Ga0495642_0009625 3300046528 Bacteria 3698
96 Ga0495609_0009680 3300046538 Bacteria 4650
97 Ga0495597_0001808 3300046542 Bacteria 14651
98 Ga0495667_0331309 3300046559 Bacteria 963
99 Ga0495668_0000480 3300046616 Bacteria 50062
100 Ga0495668_0010341 3300046616 Bacteria 5651
101 Ga0495611_0029415 3300046648 Bacteria 2409
102 Ga0495625_0001833 3300046660 Bacteria 24310
103 Ga0495625_0033647 3300046660 Bacteria 3788
104 Ga0495625_0310193 3300046660 Bacteria 1007
105 Ga0495657_0512112 3300046675 Bacteria 699
106 Ga0495646_0320284 3300046680 Bacteria 817
107 Ga0495669_0000409 3300046684 Bacteria 20850
108 Ga0495671_0003644 3300046692 Bacteria 9384
109 Ga0495649_0000334 3300046694 Bacteria 40569
110 Ga0495649_0303728 3300046694 Bacteria 812
111 Ga0495589_0001731 3300046794 Bacteria 12402
112 Ga0495589_0004028 3300046794 Bacteria 7875
113 Ga0495604_0095649 3300047317 Bacteria 2194
114 Ga0495674_0102502 3300047319 Bacteria 2434
115 Ga0495674_0409390 3300047319 Bacteria 1094
116 Ga0495672_0000571 3300047320 Bacteria 41596
117 Ga0495683_0003337 3300047323 Bacteria 9384
118 Ga0495677_0037203 3300047445 Bacteria 1778
119 Ga0495684_0026453 3300047471 Bacteria 4460
120 Ga0495686_0210702 3300047472 Bacteria 1110
121 Ga0495686_0225648 3300047472 Bacteria 1063
122 Ga0495602_0101960 3300048088 Bacteria 2353
123 Ga0495626_0016603 3300048091 Bacteria 3736
124 Ga0496110_0183989 3300048913 Bacteria 1897
125 Ga0496114_0459966 3300048917 Bacteria 1126
126 Ga0496116_0008440 3300048919 Bacteria 8934
127 Ga0496121_0317061 3300048924 Bacteria 1051
128 Ga0496124_0011724 3300048927 Bacteria 8744
129 Ga0496124_0037617 3300048927 Bacteria 4207
130 Ga0496125_0370121 3300048928 Bacteria 848
131 Ga0496126_0203403 3300048929 Bacteria 1671
132 Ga0495682_0001986 3300049460 Bacteria 10116
133 Ga0501039_0072107 3300049575 Bacteria 2684
134 Ga0501047_0132185 3300049581 Bacteria 2376
135 Ga0501068_0108099 3300049584 Bacteria 1728
136 Ga0501080_0104107 3300049742 Bacteria 2632
137 Ga0501241_005792 3300049758 Bacteria 2293
138 Ga0500578_0017640 3300053086 Bacteria 4586
139 Ga0500643_024345 3300053087 Bacteria 1923
140 Ga0500651_0000075 3300053093 Bacteria 63708
141 Ga0500650_0052647 3300053098 Bacteria 1892
142 Ga0500562_000210 3300053108 Bacteria 15821
143 Ga0500562_000341 3300053108 Bacteria 11201
144 Ga0500562_007944 3300053108 Bacteria 2678
145 Ga0500569_027193 3300053109 Bacteria 1574
146 Ga0500642_0113548 3300053130 Bacteria 1265
147 Ga0500658_0000396 3300053134 Bacteria 18969
148 Ga0500658_0008965 3300053134 Bacteria 3692
149 Ga0500658_0057635 3300053134 Bacteria 1606
150 Ga0500561_0020564 3300053137 Bacteria 1545
151 Ga0500588_0233175 3300053146 Unclassified 688
152 Ga0500589_023353 3300053147 Bacteria 2850
153 Ga0500604_0000215 3300053151 Bacteria 16627
154 Ga0500604_0010847 3300053151 Bacteria 2442
155 Ga0500616_0000432 3300053153 Bacteria 55714
156 Ga0500622_0002027 3300053156 Bacteria 15131
157 Ga0500622_0004138 3300053156 Bacteria 9285
158 Ga0500622_0032015 3300053156 Bacteria 2758
159 Ga0500627_0032820 3300053158 Bacteria 2190
160 Ga0500634_0108470 3300053161 Bacteria 1375
161 Ga0500645_063788 3300053730 Bacteria 1063
162 Ga0500599_000728 3300053736 Bacteria 3581
163 Ga0501082_0409520 3300060353 Bacteria 1184
164 Ga0466962_0140388 3300061719 Bacteria 1170

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_1905932 Ga0466967_1905932_21_542 173
2 3300047472 Ga0495686_0210702 Ga0495686_0210702_113_715 178
3 3300049758 Ga0501241_005792 Ga0501241_005792_1565_2167 184
4 3300037853 Ga0436364_0821389 Ga0436364_0821389_1399_1962 187
5 3300039437 Ga0436365_1507340 Ga0436365_1507340_57_620 187
6 3300039450 Ga0436363_0454919 Ga0436363_0454919_886_1449 187
7 3300003323 rootH1_10098823 rootH1_100988231 188
8 3300048913 Ga0496110_0183989 Ga0496110_0183989_212_781 189
9 3300037471 Ga0395905_0003750 Ga0395905_0003750_965_1567 190
10 3300048929 Ga0496126_0203403 Ga0496126_0203403_188_790 190
11 3300010375 Ga0105239_10037787 Ga0105239_100377873 191
12 3300033180 Ga0307510_10082825 Ga0307510_100828253 191
13 3300046460 Ga0495638_0005881 Ga0495638_0005881_6564_7166 191
14 3300046500 Ga0495596_0065257 Ga0495596_0065257_529_1131 191
15 3300046507 Ga0495606_0006892 Ga0495606_0006892_1316_1918 191
16 3300046519 Ga0495632_0016890 Ga0495632_0016890_721_1323 191
17 3300046616 Ga0495668_0010341 Ga0495668_0010341_3796_4398 191
18 3300046660 Ga0495625_0033647 Ga0495625_0033647_1987_2589 191
19 3300046675 Ga0495657_0512112 Ga0495657_0512112_53_655 191
20 3300046680 Ga0495646_0320284 Ga0495646_0320284_143_745 191
21 3300046694 Ga0495649_0303728 Ga0495649_0303728_19_621 191
22 3300046794 Ga0495589_0004028 Ga0495589_0004028_5120_5722 191
23 3300047317 Ga0495604_0095649 Ga0495604_0095649_1246_1848 191
24 3300047319 Ga0495674_0409390 Ga0495674_0409390_199_801 191
25 3300048088 Ga0495602_0101960 Ga0495602_0101960_451_1053 191
26 3300048928 Ga0496125_0370121 Ga0496125_0370121_116_718 191
27 3300053108 Ga0500562_000341 Ga0500562_000341_8589_9191 191
28 3300053108 Ga0500562_007944 Ga0500562_007944_756_1358 191
29 3300053109 Ga0500569_027193 Ga0500569_027193_406_1008 191
30 3300053134 Ga0500658_0008965 Ga0500658_0008965_2936_3538 191
31 3300053137 Ga0500561_0020564 Ga0500561_0020564_473_1075 191
32 3300053156 Ga0500622_0002027 Ga0500622_0002027_9374_9976 191
33 3300053156 Ga0500622_0032015 Ga0500622_0032015_1165_1767 191
34 3300053730 Ga0500645_063788 Ga0500645_063788_409_1011 191
35 3300053736 Ga0500599_000728 Ga0500599_000728_698_1300 191
36 3300005327 Ga0070658_10087750 Ga0070658_100877502 192
37 3300025909 Ga0207705_10032883 Ga0207705_100328835 192
38 3300037853 Ga0436364_1346521 Ga0436364_1346521_7453_8031 192
39 3300046457 Ga0495590_0000303 Ga0495590_0000303_11921_12523 192
40 3300046460 Ga0495638_0005742 Ga0495638_0005742_272_874 192
41 3300046474 Ga0495605_0003143 Ga0495605_0003143_8763_9365 192
42 3300046491 Ga0495584_0000908 Ga0495584_0000908_9265_9867 192
43 3300046507 Ga0495606_0000472 Ga0495606_0000472_65342_65944 192
44 3300046512 Ga0495610_0046102 Ga0495610_0046102_956_1558 192
45 3300046513 Ga0495616_0138331 Ga0495616_0138331_175_777 192
46 3300046519 Ga0495632_0000932 Ga0495632_0000932_12071_12673 192
47 3300046522 Ga0495643_0024269 Ga0495643_0024269_514_1116 192
48 3300046528 Ga0495642_0009625 Ga0495642_0009625_2285_2887 192
49 3300046538 Ga0495609_0009680 Ga0495609_0009680_3878_4480 192
50 3300046542 Ga0495597_0001808 Ga0495597_0001808_7716_8318 192
51 3300046616 Ga0495668_0000480 Ga0495668_0000480_46149_46751 192
52 3300046648 Ga0495611_0029415 Ga0495611_0029415_787_1389 192
53 3300046660 Ga0495625_0001833 Ga0495625_0001833_6267_6869 192
54 3300046684 Ga0495669_0000409 Ga0495669_0000409_6029_6631 192
55 3300046692 Ga0495671_0003644 Ga0495671_0003644_3774_4376 192
56 3300046694 Ga0495649_0000334 Ga0495649_0000334_28923_29525 192
57 3300046794 Ga0495589_0001731 Ga0495589_0001731_9653_10255 192
58 3300047320 Ga0495672_0000571 Ga0495672_0000571_26271_26945 192
59 3300047323 Ga0495683_0003337 Ga0495683_0003337_4716_5318 192
60 3300047445 Ga0495677_0037203 Ga0495677_0037203_627_1229 192
61 3300048091 Ga0495626_0016603 Ga0495626_0016603_316_918 192
62 3300049460 Ga0495682_0001986 Ga0495682_0001986_7933_8535 192
63 3300053086 Ga0500578_0017640 Ga0500578_0017640_2833_3435 192
64 3300053093 Ga0500651_0000075 Ga0500651_0000075_41519_42121 192
65 3300053098 Ga0500650_0052647 Ga0500650_0052647_1245_1847 192
66 3300053108 Ga0500562_000210 Ga0500562_000210_5343_5945 192
67 3300053130 Ga0500642_0113548 Ga0500642_0113548_225_827 192
68 3300053134 Ga0500658_0000396 Ga0500658_0000396_6336_6938 192
69 3300053146 Ga0500588_0233175 Ga0500588_0233175_34_636 192
70 3300053147 Ga0500589_023353 Ga0500589_023353_457_1059 192
71 3300053151 Ga0500604_0010847 Ga0500604_0010847_627_1229 192
72 3300053156 Ga0500622_0004138 Ga0500622_0004138_3311_3913 192
73 3300053158 Ga0500627_0032820 Ga0500627_0032820_184_786 192
74 3300053161 Ga0500634_0108470 Ga0500634_0108470_710_1312 192
75 3300006028 Ga0070717_10425885 Ga0070717_104258852 193
76 3300037312 Ga0395899_0015119 Ga0395899_0015119_2458_3060 193
77 3300038443 Ga0395901_0394486 Ga0395901_0394486_758_1360 193
78 iso_pu_bacteria 2509276021 2509390460 196
79 iso_pu_bacteria 2513237088 2513597789 196
80 iso_pu_bacteria 2513237098 2513671290 196
81 iso_pu_bacteria 2516653077 2517042817 196
82 iso_pu_bacteria 2524023209 2524457402 196
83 iso_pu_bacteria 2534681796 2535518323 196
84 iso_pu_bacteria 2585427633 2585996000 196
85 iso_pu_bacteria 2718217882 2719184583 196
86 iso_pu_bacteria 2718217927 2719388819 196
87 iso_pu_bacteria 2718218009 2719728603 196
88 iso_pu_bacteria 2718218363 2721144294 196
89 iso_pu_bacteria 2718218365 2721161087 196
90 iso_pu_bacteria 2718218366 2721161664 196
91 iso_pu_bacteria 2718218423 2721402867 196
92 iso_pu_bacteria 2721755514 2722842809 196
93 iso_pu_bacteria 2721755809 2724034933 196
94 iso_pu_bacteria 2721755810 2724041628 196
95 iso_pu_bacteria 2728369365 2730160698 196
96 iso_pu_bacteria 2728369397 2730301195 196
97 iso_pu_bacteria 2791355260 2793322599 196
98 iso_pu_bacteria 2791355264 2793345473 196
99 iso_pu_bacteria 2791355267 2793370995 196
100 iso_pu_bacteria 2818991448 2819610816 196
101 iso_pu_bacteria 2838022645 2838024692 196
102 iso_pu_bacteria 2841864319 2841866220 196
103 iso_pu_bacteria 2842198810 2842200203 196
104 iso_pu_bacteria 2842298080 2842299041 196
105 iso_pu_bacteria 2842341865 2842342117 196
106 iso_pu_bacteria 2842357229 2842358506 196
107 iso_pu_bacteria 2842363717 2842365906 196
108 iso_pu_bacteria 2842694124 2842697976 196
109 iso_pu_bacteria 2881665667 2881673000 196
110 iso_pu_bacteria 2903768456 2903768705 196
111 iso_pu_bacteria 2919100787 2919105129 196
112 iso_pu_bacteria 2920760137 2920760605 196
113 iso_pu_bacteria 2922361189 2922367169 196
114 iso_pu_bacteria 2929199973 2929206198 196
115 iso_pu_bacteria 2996887358 2996893186 196
116 iso_pu_bacteria 3005409236 3005416587 196
117 iso_pu_bacteria 8005275841 8005276230 196
118 iso_pu_bacteria 8005314921 8005320202 196
119 iso_pu_bacteria 8005321885 8005327713 196
120 iso_pu_bacteria 8005542996 8005549225 196
121 iso_pu_bacteria 8005645114 8005651463 196
122 iso_pu_bacteria 8018176218 8018179330 196
123 iso_pu_bacteria 8056673599 8056676610 196
124 3300046559 Ga0495667_0331309 Ga0495667_0331309_242_841 199
125 3300047319 Ga0495674_0102502 Ga0495674_0102502_276_875 199
126 3300047471 Ga0495684_0026453 Ga0495684_0026453_659_1258 199
127 3300003322 rootL2_10188941 rootL2_101889412 200
128 3300003792 Ga0055540_1000157 Ga0055540_100015763 200
129 3300003794 Ga0055531_10084859 Ga0055531_100848591 200
130 3300005436 Ga0070713_100713425 Ga0070713_1007134252 200
131 3300005548 Ga0070665_101492700 Ga0070665_1014927001 200
132 3300005614 Ga0068856_100683227 Ga0068856_1006832272 200
133 3300006028 Ga0070717_10019325 Ga0070717_100193254 200
134 3300006942 Ga0099824_1016704 Ga0099824_10167042 200
135 3300006943 Ga0099822_1026152 Ga0099822_10261522 200
136 3300009093 Ga0105240_10044225 Ga0105240_100442255 200
137 3300021388 Ga0213875_10004353 Ga0213875_100043536 200
138 3300025261 Ga0209233_1001741 Ga0209233_10017415 200
139 3300025272 Ga0209455_1027836 Ga0209455_10278362 200
140 3300025298 Ga0209050_1024260 Ga0209050_10242602 200
141 3300025303 Ga0209051_1000032 Ga0209051_1000032127 200
142 3300025304 Ga0209257_1004866 Ga0209257_10048667 200
143 3300025928 Ga0207700_10169157 Ga0207700_101691572 200
144 3300026078 Ga0207702_10676152 Ga0207702_106761522 200
145 3300027296 Ga0209389_1000189 Ga0209389_100018933 200
146 3300027312 Ga0209371_1000995 Ga0209371_100099514 200
147 3300027357 Ga0209589_1000002 Ga0209589_1000002356 200
148 3300027357 Ga0209589_1000845 Ga0209589_100084533 200
149 3300027361 Ga0209489_100002 Ga0209489_100002356 200
150 3300027361 Ga0209489_101612 Ga0209489_10161233 200
151 3300027363 Ga0209700_100002 Ga0209700_100002356 200
152 3300028379 Ga0268266_10445899 Ga0268266_104458991 200
153 3300030500 Ga0268256_1003477 Ga0268256_10034774 200
154 3300037471 Ga0395905_0551855 Ga0395905_0551855_138_740 200
155 3300039437 Ga0436365_0072389 Ga0436365_0072389_134_736 200
156 3300039437 Ga0436365_0100037 Ga0436365_0100037_11049_11651 200
157 3300039438 Ga0436360_0312597 Ga0436360_0312597_3292_3894 200
158 3300039438 Ga0436360_0371522 Ga0436360_0371522_863_1465 200
159 3300041494 Ga0451837_1028864 Ga0451837_1028864_1978_2580 200
160 3300041496 Ga0451839_0628011 Ga0451839_0628011_852_1454 200
161 3300041498 Ga0451841_0075397 Ga0451841_0075397_2057_2659 200
162 3300041501 Ga0451845_0441417 Ga0451845_0441417_2007_2609 200
163 3300041503 Ga0451847_0123751 Ga0451847_0123751_548_1150 200
164 3300041505 Ga0451849_0082720 Ga0451849_0082720_3076_3678 200
165 3300041507 Ga0451851_0283203 Ga0451851_0283203_734_1336 200
166 3300041507 Ga0451851_0891096 Ga0451851_0891096_742_1380 200
167 3300041511 Ga0451855_1138617 Ga0451855_1138617_1139_1741 200
168 3300044684 Ga0466966_0006535 Ga0466966_0006535_5834_6436 200
169 3300044684 Ga0466966_0021543 Ga0466966_0021543_2931_3533 200
170 3300044684 Ga0466966_0097745 Ga0466966_0097745_812_1414 200
171 3300044684 Ga0466966_0128938 Ga0466966_0128938_654_1256 200
172 3300044693 Ga0466961_0052956 Ga0466961_0052956_1233_1835 200
173 3300044693 Ga0466961_0145026 Ga0466961_0145026_557_1159 200
174 3300044694 Ga0466963_0001211 Ga0466963_0001211_5544_6146 200
175 3300044694 Ga0466963_0001261 Ga0466963_0001261_12597_13199 200
176 3300044694 Ga0466963_0322017 Ga0466963_0322017_264_866 200
177 3300044719 Ga0466971_0094712 Ga0466971_0094712_685_1287 200
178 3300044719 Ga0466971_0133808 Ga0466971_0133808_244_846 200
179 3300044765 Ga0466970_0000129 Ga0466970_0000129_14683_15285 200
180 3300044765 Ga0466970_0032125 Ga0466970_0032125_1129_1731 200
181 3300044842 Ga0466957_0036235 Ga0466957_0036235_1063_1665 200
182 3300044842 Ga0466957_0134284 Ga0466957_0134284_180_782 200
183 3300044842 Ga0466957_0451849 Ga0466957_0451849_185_787 200
184 3300045049 Ga0466959_0004198 Ga0466959_0004198_1252_1854 200
185 3300045049 Ga0466959_0169365 Ga0466959_0169365_914_1516 200
186 3300045836 Ga0466958_0014189 Ga0466958_0014189_170_772 200
187 3300045976 Ga0466967_0004390 Ga0466967_0004390_1433_2035 200
188 3300045976 Ga0466967_0043865 Ga0466967_0043865_1257_1859 200
189 3300046507 Ga0495606_0016703 Ga0495606_0016703_3124_3726 200
190 3300046507 Ga0495606_0393219 Ga0495606_0393219_76_678 200
191 3300046512 Ga0495610_0042793 Ga0495610_0042793_229_831 200
192 3300046515 Ga0495620_0049301 Ga0495620_0049301_821_1423 200
193 3300046522 Ga0495643_0002688 Ga0495643_0002688_9980_10582 200
194 3300046660 Ga0495625_0310193 Ga0495625_0310193_377_979 200
195 3300047472 Ga0495686_0225648 Ga0495686_0225648_355_957 200
196 3300048917 Ga0496114_0459966 Ga0496114_0459966_465_1067 200
197 3300048919 Ga0496116_0008440 Ga0496116_0008440_6240_6842 200
198 3300048924 Ga0496121_0317061 Ga0496121_0317061_38_640 200
199 3300048927 Ga0496124_0011724 Ga0496124_0011724_167_769 200
200 3300048927 Ga0496124_0037617 Ga0496124_0037617_832_1434 200
201 3300049575 Ga0501039_0072107 Ga0501039_0072107_912_1550 200
202 3300049581 Ga0501047_0132185 Ga0501047_0132185_1679_2281 200
203 3300049584 Ga0501068_0108099 Ga0501068_0108099_935_1537 200
204 3300049742 Ga0501080_0104107 Ga0501080_0104107_1936_2538 200
205 3300053087 Ga0500643_024345 Ga0500643_024345_337_939 200
206 3300053134 Ga0500658_0057635 Ga0500658_0057635_546_1250 200
207 3300053151 Ga0500604_0000215 Ga0500604_0000215_10834_11538 200
208 3300053153 Ga0500616_0000432 Ga0500616_0000432_37033_37635 200
209 3300060353 Ga0501082_0409520 Ga0501082_0409520_26_628 200
210 3300061719 Ga0466962_0140388 Ga0466962_0140388_201_803 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

65

214

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.918 21 197
8hcr-assembly1.cif.gz_S cryo-em structure of the mycobacterium tuberculosis cytochrome bcc:aa3 supercomplex and a novel inhibitor targeting subunit cytochrome ci 0.9113 21 197
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.8982 16 197
1ocr-assembly1.cif.gz_C bovine heart cytochrome c oxidase in the fully reduced state 0.8948 25 197
7jrp-assembly1.cif.gz_c plant mitochondrial complex sc iii2+iv from vigna radiata 0.8936 25 200
ID Description Score Start End Superfamily
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9278 21 197 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8938 25 198 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8894 21 197 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.889 21 197 1.20.120.80
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8763 26 197 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A7V3F8T3-F1-model_v4 Cytochrome C oxidase subunit III 0.9784 24 200 GO:0004129
GO:0005886
GO:0019646
AF-A0A4Q2J519-F1-model_v4 Cytochrome C oxidase subunit III 0.976 29 200 GO:0004129
GO:0005886
GO:0019646
AF-A0A654D1R5-F1-model_v4 Cytochrome C oxidase subunit III 0.9745 70 199 GO:0004129
GO:0005886
GO:0022904
AF-A0A537R857-F1-model_v4 Cytochrome c oxidase subunit I 0.9736 48 199 GO:0004129
GO:0005886
GO:0019646
AF-A0A3S1K766-F1-model_v4 Cytochrome C oxidase subunit III 0.9717 33 200 GO:0004129
GO:0005886
GO:0019646

Feature Viewer

pLDDT pTM Quality
89.87 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map