F320692

General Info

Members Datasets Scaffolds Average Seq Length
210 120 420 109

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0558997|Ga0466961_0558997_193_609
Length 129
Sequence MQRWDILSLAIEPHRPQVLRSDDESRAILMLLPAGEELQEHQVHERAYLLVVDGTVEIAQDGNAIAGGTGCMVHFDPNERRTVRAVTDARLLLVLVPWPGVGHPSRLASAQAPSCTARLSAGQILAPLT

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
16 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
17 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
18 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
19 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
20 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
32 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
33 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
36 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
37 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
38 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
39 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
40 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
46 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
47 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
48 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
52 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
53 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
66 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
72 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
73 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
74 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
77 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
78 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
79 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
80 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
81 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
82 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
83 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
84 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
85 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
88 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
115 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
116 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
117 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.24
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 22.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0558997 3300044693 Bacteria 689
2 Ga0070683_100390598 3300005329 Bacteria 1326
3 Ga0070683_100912966 3300005329 Bacteria 842
4 Ga0070689_101193051 3300005340 Unclassified 683
5 Ga0070714_100034969 3300005435 Bacteria 4209
6 Ga0070714_100156786 3300005435 Bacteria 2056
7 Ga0070714_100165784 3300005435 Bacteria 2002
8 Ga0070714_100859805 3300005435 Bacteria 880
9 Ga0070713_100298436 3300005436 Bacteria 1483
10 Ga0070713_100341027 3300005436 Bacteria 1388
11 Ga0070713_100947877 3300005436 Bacteria 829
12 Ga0070713_101128894 3300005436 Bacteria 758
13 Ga0070710_10317941 3300005437 Bacteria 1021
14 Ga0070710_10336065 3300005437 Bacteria 996
15 Ga0070711_100139199 3300005439 Bacteria 1817
16 Ga0070711_100646112 3300005439 Unclassified 886
17 Ga0070711_101999683 3300005439 Unclassified 510
18 Ga0070694_101553351 3300005444 Bacteria 561
19 Ga0068856_101086182 3300005614 Bacteria 818
20 Ga0068858_100228551 3300005842 Bacteria 1763
21 Ga0081455_10252795 3300005937 Bacteria 1288
22 Ga0070717_10244381 3300006028 Bacteria 1584
23 Ga0070717_10246088 3300006028 Unclassified 1578
24 Ga0070717_10597843 3300006028 Bacteria 1001
25 Ga0070716_100361454 3300006173 Bacteria 1031
26 Ga0070712_100014783 3300006175 Bacteria 5014
27 Ga0070712_100034145 3300006175 Bacteria 3447
28 Ga0070712_100651409 3300006175 Unclassified 895
29 Ga0111539_10029671 3300009094 Bacteria 6659
30 Ga0111539_10249649 3300009094 Bacteria 2066
31 Ga0111539_10868587 3300009094 Bacteria 1049
32 Ga0157375_12346925 3300013308 Bacteria 636
33 Ga0163163_11442628 3300014325 Bacteria 750
34 Ga0206354_10368703 3300020081 Bacteria 602
35 Ga0213873_10260681 3300021358 Unclassified 551
36 Ga0213876_10003688 3300021384 Bacteria 8693
37 Ga0213875_10135491 3300021388 Bacteria 1152
38 Ga0207692_10005891 3300025898 Bacteria 4941
39 Ga0207699_10075405 3300025906 Bacteria 2075
40 Ga0207699_11277363 3300025906 Bacteria 543
41 Ga0207693_10002893 3300025915 Bacteria 14855
42 Ga0207693_10127828 3300025915 Unclassified 1998
43 Ga0207700_10052711 3300025928 Bacteria 3043
44 Ga0207700_10480636 3300025928 Bacteria 1098
45 Ga0207700_10980022 3300025928 Bacteria 757
46 Ga0207664_10061016 3300025929 Bacteria 3007
47 Ga0207664_10128283 3300025929 Bacteria 2132
48 Ga0207664_10458248 3300025929 Unclassified 1139
49 Ga0207664_10667127 3300025929 Bacteria 935
50 Ga0207664_10859584 3300025929 Bacteria 815
51 Ga0207690_10995247 3300025932 Bacteria 697
52 Ga0207665_10404341 3300025939 Bacteria 1040
53 Ga0207702_10536155 3300026078 Bacteria 1144
54 Ga0207648_10410218 3300026089 Bacteria 1229
55 Ga0207428_10113189 3300027907 Bacteria 2086
56 Ga0207428_10461728 3300027907 Bacteria 925
57 Ga0307408_100362977 3300031548 Bacteria 1233
58 Ga0307413_10314321 3300031824 Bacteria 1194
59 Ga0307416_102268463 3300032002 Bacteria 644
60 Ga0373923_0183582 3300035111 Bacteria 962
61 Ga0373943_0388178 3300035170 Unclassified 805
62 Ga0373924_0141167 3300035410 Bacteria 1051
63 Ga0373947_0664906 3300035725 Unclassified 710
64 Ga0373937_0055830 3300036401 Bacteria 3626
65 Ga0373925_0499362 3300037068 Bacteria 999
66 Ga0395899_0749806 3300037312 Bacteria 608
67 Ga0395898_0358432 3300037466 Bacteria 1391
68 Ga0436364_0271109 3300037853 Bacteria 1112
69 Ga0436364_0578591 3300037853 Unclassified 759
70 Ga0436364_1217664 3300037853 Bacteria 1435
71 Ga0436364_1335086 3300037853 Bacteria 2212
72 Ga0436364_1460562 3300037853 Unclassified 1359
73 Ga0395901_0243450 3300038443 Bacteria 1875
74 Ga0436365_0202901 3300039437 Bacteria 32522
75 Ga0436365_0558855 3300039437 Bacteria 2204
76 Ga0436365_1206243 3300039437 Bacteria 1507
77 Ga0436365_1802904 3300039437 Unclassified 855
78 Ga0436363_0775923 3300039450 Bacteria 701
79 Ga0436363_0892970 3300039450 Bacteria 1480
80 Ga0436363_1075205 3300039450 Bacteria 1037
81 Ga0436363_1339553 3300039450 Unclassified 1439
82 Ga0436363_1626955 3300039450 Unclassified 583
83 Ga0436362_0362761 3300039453 Unclassified 591
84 Ga0436362_0692758 3300039453 Bacteria 1437
85 Ga0466972_0623333 3300044658 Unclassified 510
86 Ga0466965_0107474 3300044683 Bacteria 1432
87 Ga0466965_0343843 3300044683 Bacteria 816
88 Ga0466966_0292302 3300044684 Bacteria 979
89 Ga0466966_0592715 3300044684 Bacteria 667
90 Ga0466961_0093934 3300044693 Bacteria 1893
91 Ga0466961_0201265 3300044693 Bacteria 1232
92 Ga0466961_0279854 3300044693 Unclassified 1021
93 Ga0466961_0510999 3300044693 Unclassified 725
94 Ga0466963_0002119 3300044694 Bacteria 10973
95 Ga0466963_0107683 3300044694 Bacteria 1911
96 Ga0466963_0223527 3300044694 Unclassified 1319
97 Ga0466963_0267110 3300044694 Bacteria 1202
98 Ga0466964_0184317 3300044706 Bacteria 992
99 Ga0466964_0235179 3300044706 Bacteria 896
100 Ga0466964_0350717 3300044706 Bacteria 758
101 Ga0466964_0627831 3300044706 Unclassified 592
102 Ga0466971_0004077 3300044719 Bacteria 6289
103 Ga0466971_0144922 3300044719 Bacteria 1107
104 Ga0466971_0290088 3300044719 Bacteria 784
105 Ga0466968_0053945 3300044735 Bacteria 1723
106 Ga0466968_0107866 3300044735 Bacteria 1249
107 Ga0466968_0112266 3300044735 Bacteria 1226
108 Ga0466968_0351400 3300044735 Bacteria 716
109 Ga0466970_0146648 3300044765 Bacteria 1302
110 Ga0466957_0000131 3300044842 Bacteria 31453
111 Ga0466957_0038532 3300044842 Bacteria 2880
112 Ga0466957_0291166 3300044842 Bacteria 1095
113 Ga0466957_0412685 3300044842 Bacteria 925
114 Ga0466957_0685446 3300044842 Unclassified 722
115 Ga0466960_0254187 3300044901 Bacteria 977
116 Ga0466960_0817092 3300044901 Bacteria 565
117 Ga0466959_0028604 3300045049 Unclassified 4133
118 Ga0466959_0163614 3300045049 Unclassified 1563
119 Ga0466959_0474001 3300045049 Bacteria 847
120 Ga0466959_0476434 3300045049 Bacteria 845
121 Ga0466959_0860048 3300045049 Bacteria 605
122 Ga0466958_0004461 3300045836 Bacteria 7391
123 Ga0466958_0054173 3300045836 Bacteria 2433
124 Ga0466958_0075128 3300045836 Bacteria 2072
125 Ga0466958_0078080 3300045836 Bacteria 2034
126 Ga0466958_0096565 3300045836 Bacteria 1833
127 Ga0466967_0017365 3300045976 Bacteria 5710
128 Ga0466967_0020935 3300045976 Bacteria 5298
129 Ga0466967_0169782 3300045976 Bacteria 2052
130 Ga0466967_0185396 3300045976 Bacteria 1965
131 Ga0466967_0203311 3300045976 Bacteria 1876
132 Ga0466967_0458360 3300045976 Bacteria 1247
133 Ga0466967_0500335 3300045976 Bacteria 1192
134 Ga0466967_0608479 3300045976 Bacteria 1079
135 Ga0466967_0682435 3300045976 Bacteria 1017
136 Ga0466967_0757140 3300045976 Bacteria 963
137 Ga0466967_0991003 3300045976 Unclassified 837
138 Ga0466967_1999106 3300045976 Unclassified 576
139 Ga0495641_0540317 3300046461 Bacteria 532
140 Ga0495651_0068851 3300046462 Bacteria 2697
141 Ga0495653_0012615 3300046463 Bacteria 6902
142 Ga0495653_0409296 3300046463 Unclassified 860
143 Ga0495580_1059031 3300046472 Bacteria 515
144 Ga0495662_0300861 3300046476 Unclassified 789
145 Ga0495664_0085681 3300046477 Bacteria 1892
146 Ga0495608_0022375 3300046511 Bacteria 4333
147 Ga0495618_0098999 3300046514 Bacteria 1866
148 Ga0495628_0790510 3300046516 Unclassified 664
149 Ga0495630_0384753 3300046517 Unclassified 1075
150 Ga0495652_0024386 3300046529 Bacteria 5355
151 Ga0495652_0734286 3300046529 Unclassified 662
152 Ga0495640_0017284 3300046533 Bacteria 5377
153 Ga0495645_0522736 3300046543 Unclassified 739
154 Ga0495667_0000839 3300046559 Bacteria 19841
155 Ga0495635_0106767 3300046663 Bacteria 1912
156 Ga0495657_0005350 3300046675 Bacteria 10153
157 Ga0495599_0011726 3300046678 Bacteria 5387
158 Ga0495623_0391914 3300046679 Unclassified 749
159 Ga0495646_0059490 3300046680 Bacteria 2281
160 Ga0495600_0010024 3300046809 Bacteria 5873
161 Ga0495604_0002703 3300047317 Bacteria 14223
162 Ga0495604_0060342 3300047317 Unclassified 2905
163 Ga0495674_0023279 3300047319 Bacteria 5711
164 Ga0495674_0106387 3300047319 Unclassified 2383
165 Ga0495676_0615166 3300047321 Unclassified 707
166 Ga0495680_0003604 3300047322 Bacteria 15155
167 Ga0495680_0031311 3300047322 Unclassified 4332
168 Ga0495675_0016663 3300047444 Bacteria 4646
169 Ga0495684_0039896 3300047471 Bacteria 3599
170 Ga0495593_0141223 3300047673 Unclassified 1220
171 Ga0495602_0015764 3300048088 Bacteria 7613
172 Ga0496102_0602946 3300048905 Unclassified 1021
173 Ga0496104_0016635 3300048907 Bacteria 6684
174 Ga0496105_0630036 3300048908 Unclassified 829
175 Ga0496105_0860733 3300048908 Unclassified 685
176 Ga0496106_0811876 3300048909 Unclassified 742
177 Ga0496108_0313464 3300048911 Bacteria 1367
178 Ga0496108_0601770 3300048911 Unclassified 958
179 Ga0496109_0905596 3300048912 Bacteria 820
180 Ga0496111_0116587 3300048914 Unclassified 1970
181 Ga0496111_0598518 3300048914 Bacteria 807
182 Ga0496112_0750786 3300048915 Bacteria 902
183 Ga0501031_0260287 3300049568 Bacteria 1127
184 Ga0501032_0356977 3300049569 Bacteria 941
185 Ga0501033_0527913 3300049570 Bacteria 815
186 Ga0501036_0242131 3300049572 Bacteria 1513
187 Ga0501039_0159888 3300049575 Bacteria 1770
188 Ga0501041_0250476 3300049577 Bacteria 1113
189 Ga0501046_0407728 3300049580 Bacteria 981
190 Ga0501048_0783361 3300049582 Bacteria 685
191 Ga0501071_0087109 3300049587 Bacteria 2291
192 Ga0501072_0339564 3300049588 Bacteria 1193
193 Ga0501075_0683709 3300049591 Bacteria 782
194 Ga0501076_0459596 3300049592 Bacteria 1048
195 Ga0501081_0635014 3300049743 Bacteria 800
196 Ga0501044_0075600 3300049823 Bacteria 3420
197 Ga0501045_0096023 3300049824 Bacteria 2193
198 nmdc:mga08y16_241753_c1 3300050511 Bacteria 1866
199 nmdc:mga08y16_588239_c1 3300050511 Bacteria 1123
200 Ga0495601_0087146 3300053077 Unclassified 2007
201 Ga0495601_0493897 3300053077 Bacteria 790
202 Ga0495612_0123833 3300053078 Bacteria 1113
203 Ga0495655_0126473 3300053083 Bacteria 783
204 Ga0495595_0073678 3300053084 Bacteria 1617
205 Ga0495619_0041169 3300053085 Unclassified 3021
206 Ga0501084_0255517 3300054114 Bacteria 1479
207 Ga0466962_0022494 3300061719 Unclassified 3029
208 Ga0466962_0055653 3300061719 Bacteria 1890
209 Ga0466962_0187716 3300061719 Bacteria 1008
210 Ga0530510_0239662 3300061734 Bacteria 1350
211 Ga0466961_0558997
212 Ga0070683_100390598
213 Ga0070683_100912966
214 Ga0070689_101193051
215 Ga0070714_100034969
216 Ga0070714_100156786
217 Ga0070714_100165784
218 Ga0070714_100859805
219 Ga0070713_100298436
220 Ga0070713_100341027
221 Ga0070713_100947877
222 Ga0070713_101128894
223 Ga0070710_10317941
224 Ga0070710_10336065
225 Ga0070711_100139199
226 Ga0070711_100646112
227 Ga0070711_101999683
228 Ga0070694_101553351
229 Ga0068856_101086182
230 Ga0068858_100228551
231 Ga0081455_10252795
232 Ga0070717_10244381
233 Ga0070717_10246088
234 Ga0070717_10597843
235 Ga0070716_100361454
236 Ga0070712_100014783
237 Ga0070712_100034145
238 Ga0070712_100651409
239 Ga0111539_10029671
240 Ga0111539_10249649
241 Ga0111539_10868587
242 Ga0157375_12346925
243 Ga0163163_11442628
244 Ga0206354_10368703
245 Ga0213873_10260681
246 Ga0213876_10003688
247 Ga0213875_10135491
248 Ga0207692_10005891
249 Ga0207699_10075405
250 Ga0207699_11277363
251 Ga0207693_10002893
252 Ga0207693_10127828
253 Ga0207700_10052711
254 Ga0207700_10480636
255 Ga0207700_10980022
256 Ga0207664_10061016
257 Ga0207664_10128283
258 Ga0207664_10458248
259 Ga0207664_10667127
260 Ga0207664_10859584
261 Ga0207690_10995247
262 Ga0207665_10404341
263 Ga0207702_10536155
264 Ga0207648_10410218
265 Ga0207428_10113189
266 Ga0207428_10461728
267 Ga0307408_100362977
268 Ga0307413_10314321
269 Ga0307416_102268463
270 Ga0373923_0183582
271 Ga0373943_0388178
272 Ga0373924_0141167
273 Ga0373947_0664906
274 Ga0373937_0055830
275 Ga0373925_0499362
276 Ga0395899_0749806
277 Ga0395898_0358432
278 Ga0436364_0271109
279 Ga0436364_0578591
280 Ga0436364_1217664
281 Ga0436364_1335086
282 Ga0436364_1460562
283 Ga0395901_0243450
284 Ga0436365_0202901
285 Ga0436365_0558855
286 Ga0436365_1206243
287 Ga0436365_1802904
288 Ga0436363_0775923
289 Ga0436363_0892970
290 Ga0436363_1075205
291 Ga0436363_1339553
292 Ga0436363_1626955
293 Ga0436362_0362761
294 Ga0436362_0692758
295 Ga0466972_0623333
296 Ga0466965_0107474
297 Ga0466965_0343843
298 Ga0466966_0292302
299 Ga0466966_0592715
300 Ga0466961_0093934
301 Ga0466961_0201265
302 Ga0466961_0279854
303 Ga0466961_0510999
304 Ga0466963_0002119
305 Ga0466963_0107683
306 Ga0466963_0223527
307 Ga0466963_0267110
308 Ga0466964_0184317
309 Ga0466964_0235179
310 Ga0466964_0350717
311 Ga0466964_0627831
312 Ga0466971_0004077
313 Ga0466971_0144922
314 Ga0466971_0290088
315 Ga0466968_0053945
316 Ga0466968_0107866
317 Ga0466968_0112266
318 Ga0466968_0351400
319 Ga0466970_0146648
320 Ga0466957_0000131
321 Ga0466957_0038532
322 Ga0466957_0291166
323 Ga0466957_0412685
324 Ga0466957_0685446
325 Ga0466960_0254187
326 Ga0466960_0817092
327 Ga0466959_0028604
328 Ga0466959_0163614
329 Ga0466959_0474001
330 Ga0466959_0476434
331 Ga0466959_0860048
332 Ga0466958_0004461
333 Ga0466958_0054173
334 Ga0466958_0075128
335 Ga0466958_0078080
336 Ga0466958_0096565
337 Ga0466967_0017365
338 Ga0466967_0020935
339 Ga0466967_0169782
340 Ga0466967_0185396
341 Ga0466967_0203311
342 Ga0466967_0458360
343 Ga0466967_0500335
344 Ga0466967_0608479
345 Ga0466967_0682435
346 Ga0466967_0757140
347 Ga0466967_0991003
348 Ga0466967_1999106
349 Ga0495641_0540317
350 Ga0495651_0068851
351 Ga0495653_0012615
352 Ga0495653_0409296
353 Ga0495580_1059031
354 Ga0495662_0300861
355 Ga0495664_0085681
356 Ga0495608_0022375
357 Ga0495618_0098999
358 Ga0495628_0790510
359 Ga0495630_0384753
360 Ga0495652_0024386
361 Ga0495652_0734286
362 Ga0495640_0017284
363 Ga0495645_0522736
364 Ga0495667_0000839
365 Ga0495635_0106767
366 Ga0495657_0005350
367 Ga0495599_0011726
368 Ga0495623_0391914
369 Ga0495646_0059490
370 Ga0495600_0010024
371 Ga0495604_0002703
372 Ga0495604_0060342
373 Ga0495674_0023279
374 Ga0495674_0106387
375 Ga0495676_0615166
376 Ga0495680_0003604
377 Ga0495680_0031311
378 Ga0495675_0016663
379 Ga0495684_0039896
380 Ga0495593_0141223
381 Ga0495602_0015764
382 Ga0496102_0602946
383 Ga0496104_0016635
384 Ga0496105_0630036
385 Ga0496105_0860733
386 Ga0496106_0811876
387 Ga0496108_0313464
388 Ga0496108_0601770
389 Ga0496109_0905596
390 Ga0496111_0116587
391 Ga0496111_0598518
392 Ga0496112_0750786
393 Ga0501031_0260287
394 Ga0501032_0356977
395 Ga0501033_0527913
396 Ga0501036_0242131
397 Ga0501039_0159888
398 Ga0501041_0250476
399 Ga0501046_0407728
400 Ga0501048_0783361
401 Ga0501071_0087109
402 Ga0501072_0339564
403 Ga0501075_0683709
404 Ga0501076_0459596
405 Ga0501081_0635014
406 Ga0501044_0075600
407 Ga0501045_0096023
408 nmdc:mga08y16_241753_c1
409 nmdc:mga08y16_588239_c1
410 Ga0495601_0087146
411 Ga0495601_0493897
412 Ga0495612_0123833
413 Ga0495655_0126473
414 Ga0495595_0073678
415 Ga0495619_0041169
416 Ga0501084_0255517
417 Ga0466962_0022494
418 Ga0466962_0055653
419 Ga0466962_0187716
420 Ga0530510_0239662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

28

97

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2cau-assembly1.cif.gz_A canavalin from jack bean 0.9153 35 102
6a54-assembly1.cif.gz_A crystal structure of dddk mutant y64a 0.8934 24 103
6a55-assembly1.cif.gz_B crystal structure of dddk mutant y122a 0.8814 24 103
2q1z-assembly1.cif.gz_B crystal structure of rhodobacter sphaeroides sige in complex with the anti-sigma chrr 0.8805 24 101
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.8796 34 102
ID Description Score Start End Superfamily
af_I1L9C7_24_223_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9192 34 101 2.60.120.10
af_P32677_1_166_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9062 50 101 2.60.120.10
af_Q688L5_29_227_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8983 34 103 2.60.120.10
af_C6T0Q1_25_220_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8957 34 103 2.60.120.10
af_I1N5B5_339_414_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8926 34 102 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3D1S0N5-F1-model_v4 Pirin family protein 0.9376 35 103
AF-A0A2A7NW75-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.9286 25 101
AF-A0A1Q4HGY7-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.9263 24 101
AF-A0A1V0KRH6-F1-model_v4 deleted 0.9253 35 104
AF-U4KBX0-F1-model_v4 Putative Transcriptional activator 0.9138 24 102

Map