F320642

General Info

Members Datasets Scaffolds Average Seq Length
210 121 210 158

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1565163|Ga0436365_1565163_1712_2185
Length 144
Sequence VDWKRVVQFALLGSSDFDQYAVLLVRVSLGLFFAISGANKLFVAASTQTMYETLVEAKAPFPHLMTYFVSAVEFVGGSLLILGFLSSLVSVALLAMRKGLSFLNWLDDFLYLPEVLYALFFIWLICSGPGKFSVDYWLAGKLRR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
39 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
40 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
41 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
56 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
57 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
67 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
68 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
79 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
96 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
97 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
116 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
117 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
118 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.38
Metatranscriptomes 7.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.38
Rhizosphere 92.38
Stem 0
Stem Tuber 0
Unclassified 5.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10555192 3300005289 Bacteria 632
2 Ga0070709_10160785 3300005434 Bacteria 1561
3 Ga0070709_10319182 3300005434 Bacteria 1139
4 Ga0070714_100159654 3300005435 Bacteria 2039
5 Ga0070714_100942925 3300005435 Bacteria 839
6 Ga0070713_100004918 3300005436 Bacteria 9067
7 Ga0070713_100092935 3300005436 Bacteria 2598
8 Ga0070713_100501168 3300005436 Bacteria 1146
9 Ga0070713_100593760 3300005436 Bacteria 1051
10 Ga0070710_10062944 3300005437 Bacteria 2118
11 Ga0070710_10308163 3300005437 Bacteria 1035
12 Ga0070711_100014940 3300005439 Bacteria 4905
13 Ga0070711_100169151 3300005439 Bacteria 1664
14 Ga0070708_100014785 3300005445 Bacteria 6432
15 Ga0070708_100308454 3300005445 Bacteria 1490
16 Ga0070708_101271902 3300005445 Bacteria 688
17 Ga0070662_100763446 3300005457 Bacteria 821
18 Ga0068867_101032114 3300005459 Bacteria 747
19 Ga0070706_100103936 3300005467 Bacteria 2641
20 Ga0070706_100346551 3300005467 Bacteria 1385
21 Ga0070706_100795291 3300005467 Bacteria 876
22 Ga0070707_100077020 3300005468 Bacteria 3217
23 Ga0070698_100010422 3300005471 Bacteria 9924
24 Ga0070698_100294644 3300005471 Bacteria 1553
25 Ga0070698_100334990 3300005471 Bacteria 1444
26 Ga0070698_101037540 3300005471 Bacteria 768
27 Ga0070699_100164624 3300005518 Bacteria 1964
28 Ga0070697_100000483 3300005536 Bacteria 30244
29 Ga0070697_100164013 3300005536 Bacteria 1878
30 Ga0070697_100315075 3300005536 Bacteria 1346
31 Ga0070697_100395545 3300005536 Bacteria 1198
32 Ga0070697_100999075 3300005536 Bacteria 744
33 Ga0070693_100070801 3300005547 Bacteria 2053
34 Ga0070665_100189170 3300005548 Bacteria 2059
35 Ga0068859_100302429 3300005617 Bacteria 1693
36 Ga0068860_100053057 3300005843 Bacteria 3855
37 Ga0081540_1001797 3300005983 Bacteria 17995
38 Ga0070717_10022767 3300006028 Bacteria 4955
39 Ga0070717_10594745 3300006028 Bacteria 1003
40 Ga0070715_10061220 3300006163 Bacteria 1652
41 Ga0070715_10072891 3300006163 Bacteria 1538
42 Ga0070716_100052523 3300006173 Bacteria 2320
43 Ga0070716_100082351 3300006173 Bacteria 1924
44 Ga0070712_100016741 3300006175 Bacteria 4739
45 Ga0097620_100302440 3300006931 Bacteria 1693
46 Ga0099795_10241439 3300007788 Bacteria 776
47 Ga0105245_10189805 3300009098 Bacteria 1968
48 Ga0105247_10136515 3300009101 Bacteria 1603
49 Ga0105241_10105174 3300009174 Bacteria 2251
50 Ga0105242_10121230 3300009176 Bacteria 2244
51 Ga0105248_10105704 3300009177 Bacteria 3174
52 Ga0105249_10273809 3300009553 Bacteria 1683
53 Ga0099796_10102088 3300010159 Bacteria 1080
54 Ga0105239_10067503 3300010375 Bacteria 3929
55 Ga0157378_10000694 3300013297 Bacteria 31676
56 Ga0163162_10059990 3300013306 Bacteria 3837
57 Ga0157375_10635486 3300013308 Bacteria 1224
58 Ga0213875_10004023 3300021388 Bacteria 8183
59 Ga0224569_101003 3300022732 Bacteria 2410
60 Ga0224569_101236 3300022732 Bacteria 2170
61 Ga0224571_100250 3300022734 Bacteria 2684
62 Ga0224572_1025726 3300024225 Bacteria 1130
63 Ga0224572_1026211 3300024225 Bacteria 1118
64 Ga0224572_1036293 3300024225 Bacteria 933
65 Ga0224572_1042722 3300024225 Bacteria 852
66 Ga0228598_1000472 3300024227 Bacteria 8224
67 Ga0228598_1001302 3300024227 Bacteria 5483
68 Ga0228598_1005456 3300024227 Bacteria 2659
69 Ga0228598_1105812 3300024227 Bacteria 568
70 Ga0207685_10434270 3300025905 Bacteria 680
71 Ga0207699_10147102 3300025906 Bacteria 1555
72 Ga0207699_10156264 3300025906 Bacteria 1514
73 Ga0207684_10004546 3300025910 Bacteria 13037
74 Ga0207684_10052308 3300025910 Bacteria 3466
75 Ga0207684_10111056 3300025910 Bacteria 2347
76 Ga0207693_10000386 3300025915 Bacteria 40440
77 Ga0207693_10044113 3300025915 Bacteria 3504
78 Ga0207693_11196993 3300025915 Bacteria 573
79 Ga0207663_10000510 3300025916 Bacteria 17018
80 Ga0207663_10049629 3300025916 Bacteria 2604
81 Ga0207663_10176698 3300025916 Bacteria 1521
82 Ga0207646_10584312 3300025922 Bacteria 1003
83 Ga0207687_10116973 3300025927 Bacteria 1988
84 Ga0207700_10001777 3300025928 Bacteria 12232
85 Ga0207700_10022442 3300025928 Bacteria 4332
86 Ga0207700_10440222 3300025928 Bacteria 1147
87 Ga0207664_10220334 3300025929 Bacteria 1645
88 Ga0207664_10816022 3300025929 Bacteria 839
89 Ga0207706_11170633 3300025933 Bacteria 640
90 Ga0207665_10021030 3300025939 Bacteria 4288
91 Ga0207665_10152016 3300025939 Bacteria 1659
92 Ga0207665_10927561 3300025939 Bacteria 691
93 Ga0207711_10226963 3300025941 Bacteria 1710
94 Ga0207639_10769981 3300026041 Bacteria 896
95 Ga0265354_1000693 3300028016 Bacteria 5593
96 Ga0265356_1001502 3300028017 Bacteria 3414
97 Ga0265356_1001791 3300028017 Bacteria 3036
98 Ga0265355_1004047 3300028036 Bacteria 1095
99 Ga0268266_10188623 3300028379 Bacteria 1881
100 Ga0268264_10007173 3300028381 Bacteria 9334
101 Ga0265318_10138491 3300028577 Bacteria 894
102 Ga0265338_10005180 3300028800 Bacteria 17115
103 Ga0265338_10084532 3300028800 Bacteria 2648
104 Ga0265338_10187694 3300028800 Bacteria 1570
105 Ga0265338_10398495 3300028800 Bacteria 981
106 Ga0265762_1001779 3300030760 Bacteria 3913
107 Ga0265762_1002969 3300030760 Bacteria 3032
108 Ga0265762_1003083 3300030760 Bacteria 2977
109 Ga0265762_1036635 3300030760 Bacteria 948
110 Ga0265762_1096770 3300030760 Unclassified 650
111 Ga0265770_1001876 3300030878 Bacteria 2865
112 Ga0265770_1011847 3300030878 Bacteria 1285
113 Ga0265765_1000419 3300030879 Bacteria 3280
114 Ga0265765_1034206 3300030879 Bacteria 658
115 Ga0265765_1039795 3300030879 Unclassified 622
116 Ga0265760_10007433 3300031090 Bacteria 3132
117 Ga0265760_10009602 3300031090 Bacteria 2763
118 Ga0265760_10136610 3300031090 Unclassified 796
119 Ga0265760_10150464 3300031090 Bacteria 763
120 Ga0265760_10186522 3300031090 Unclassified 695
121 Ga0265330_10029191 3300031235 Bacteria 2482
122 Ga0265332_10006802 3300031238 Bacteria 5184
123 Ga0265328_10018558 3300031239 Bacteria 2679
124 Ga0265328_10042744 3300031239 Bacteria 1668
125 Ga0265320_10033294 3300031240 Bacteria 2632
126 Ga0265325_10003982 3300031241 Bacteria 9451
127 Ga0265325_10005410 3300031241 Bacteria 7885
128 Ga0265325_10006675 3300031241 Bacteria 6983
129 Ga0265340_10007183 3300031247 Bacteria 6068
130 Ga0265340_10010850 3300031247 Bacteria 4861
131 Ga0265340_10071097 3300031247 Bacteria 1650
132 Ga0265339_10018639 3300031249 Bacteria 4089
133 Ga0265339_10023757 3300031249 Unclassified 3541
134 Ga0265339_10033462 3300031249 Bacteria 2894
135 Ga0265339_10048539 3300031249 Bacteria 2327
136 Ga0265316_10111787 3300031344 Bacteria 2068
137 Ga0265316_10155800 3300031344 Bacteria 1710
138 Ga0265313_10006046 3300031595 Bacteria 8728
139 Ga0265314_10179340 3300031711 Bacteria 1271
140 Ga0265342_10076975 3300031712 Unclassified 1933
141 Ga0265342_10579726 3300031712 Unclassified 567
142 Ga0316053_104660 3300032120 Bacteria 850
143 Ga0316215_1007603 3300033544 Bacteria 1058
144 Ga0316212_1024043 3300033547 Bacteria 854
145 Ga0373926_0039888 3300035083 Bacteria 1675
146 Ga0373944_0057976 3300035089 Bacteria 1236
147 Ga0373953_0011752 3300035117 Bacteria 3084
148 Ga0373954_0002185 3300035118 Bacteria 8132
149 Ga0373956_0001390 3300035119 Bacteria 10008
150 Ga0373943_0105596 3300035170 Bacteria 1479
151 Ga0373946_0026964 3300035171 Bacteria 2270
152 Ga0373927_0001418 3300035695 Bacteria 18085
153 Ga0373927_0086979 3300035695 Bacteria 2029
154 Ga0373927_0248854 3300035695 Bacteria 1168
155 Ga0373933_0000295 3300035724 Bacteria 32120
156 Ga0373933_0003706 3300035724 Bacteria 8451
157 Ga0373947_0011885 3300035725 Bacteria 4987
158 Ga0373937_0000015 3300036401 Bacteria 148228
159 Ga0373937_0003064 3300036401 Bacteria 13975
160 Ga0373925_0000082 3300037068 Bacteria 101345
161 Ga0373925_0095332 3300037068 Bacteria 2279
162 Ga0436364_0779640 3300037853 Bacteria 1208
163 Ga0436364_0791442 3300037853 Bacteria 14234
164 Ga0436364_1088216 3300037853 Unclassified 606
165 Ga0436364_1438067 3300037853 Bacteria 21544
166 Ga0436365_0346303 3300039437 Bacteria 1110
167 Ga0436365_1467674 3300039437 Bacteria 1521
168 Ga0436365_1565163 3300039437 Bacteria 2287
169 Ga0436360_0189328 3300039438 Bacteria 895
170 Ga0436360_0566025 3300039438 Bacteria 779
171 Ga0436360_0922277 3300039438 Bacteria 2698
172 Ga0436361_0250997 3300039447 Bacteria 746
173 Ga0436361_0541123 3300039447 Unclassified 616
174 Ga0436361_0957092 3300039447 Bacteria 993
175 Ga0436361_1099977 3300039447 Bacteria 1057
176 Ga0436363_0207109 3300039450 Bacteria 1626
177 Ga0436362_0103311 3300039453 Bacteria 2689
178 Ga0436362_0207932 3300039453 Bacteria 858
179 Ga0436362_0830979 3300039453 Bacteria 740
180 Ga0453683_0009914 3300044673 Bacteria 6339
181 Ga0495651_0020689 3300046462 Bacteria 5108
182 Ga0495651_0026616 3300046462 Bacteria 4505
183 Ga0495653_0312483 3300046463 Bacteria 1021
184 Ga0495580_0031154 3300046472 Bacteria 3857
185 Ga0495580_0062073 3300046472 Bacteria 2623
186 Ga0495580_0255171 3300046472 Bacteria 1200
187 Ga0495580_0499536 3300046472 Bacteria 812
188 Ga0495582_0205539 3300046473 Bacteria 1125
189 Ga0495608_0066374 3300046511 Bacteria 2363
190 Ga0495630_0231054 3300046517 Bacteria 1413
191 Ga0495652_0009556 3300046529 Bacteria 8806
192 Ga0495665_0122611 3300046531 Bacteria 1361
193 Ga0495587_0000081 3300046536 Bacteria 74942
194 Ga0495587_0002201 3300046536 Bacteria 13033
195 Ga0495588_0191584 3300046674 Bacteria 1080
196 Ga0495657_0125923 3300046675 Bacteria 1609
197 Ga0495646_0053934 3300046680 Unclassified 2421
198 Ga0495581_0603690 3300047315 Bacteria 636
199 Ga0495604_0001121 3300047317 Bacteria 22236
200 Ga0495675_0000105 3300047444 Bacteria 60274
201 Ga0495684_0003920 3300047471 Bacteria 11597
202 Ga0495602_0000101 3300048088 Bacteria 81181
203 Ga0495602_0030929 3300048088 Bacteria 5068
204 Ga0496101_0181040 3300048904 Bacteria 1623
205 Ga0496102_0004895 3300048905 Bacteria 11341
206 Ga0496104_0119622 3300048907 Bacteria 2529
207 Ga0496115_0016739 3300048918 Bacteria 5587
208 Ga0496115_0234938 3300048918 Bacteria 1511
209 nmdc:mga08x19_699348_c1 3300050514 Bacteria 719
210 Ga0495619_0255903 3300053085 Bacteria 1213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005536 Ga0070697_100999075 Ga0070697_1009990752 137
2 3300037853 Ga0436364_1438067 Ga0436364_1438067_16686_17159 144
3 3300039437 Ga0436365_1565163 Ga0436365_1565163_1712_2185 144
4 3300037853 Ga0436364_1088216 Ga0436364_1088216_31_474 147
5 3300039438 Ga0436360_0922277 Ga0436360_0922277_636_1082 148
6 3300039447 Ga0436361_0957092 Ga0436361_0957092_360_806 148
7 3300039453 Ga0436362_0103311 Ga0436362_0103311_1058_1504 148
8 3300005435 Ga0070714_100159654 Ga0070714_1001596543 154
9 3300005437 Ga0070710_10062944 Ga0070710_100629443 154
10 3300025916 Ga0207663_10049629 Ga0207663_100496292 154
11 3300025929 Ga0207664_10220334 Ga0207664_102203343 154
12 3300046472 Ga0495580_0255171 Ga0495580_0255171_531_1010 154
13 3300046531 Ga0495665_0122611 Ga0495665_0122611_46_525 154
14 3300046674 Ga0495588_0191584 Ga0495588_0191584_334_807 154
15 3300047315 Ga0495581_0603690 Ga0495581_0603690_132_611 154
16 3300031235 Ga0265330_10029191 Ga0265330_100291912 155
17 3300031238 Ga0265332_10006802 Ga0265332_100068023 155
18 3300031239 Ga0265328_10018558 Ga0265328_100185586 155
19 3300031241 Ga0265325_10003982 Ga0265325_100039826 155
20 3300031247 Ga0265340_10010850 Ga0265340_100108502 155
21 3300031249 Ga0265339_10023757 Ga0265339_100237575 155
22 3300031344 Ga0265316_10111787 Ga0265316_101117875 155
23 3300031595 Ga0265313_10006046 Ga0265313_1000604610 155
24 3300031711 Ga0265314_10179340 Ga0265314_101793403 155
25 3300039450 Ga0436363_0207109 Ga0436363_0207109_352_834 155
26 3300005548 Ga0070665_100189170 Ga0070665_1001891703 156
27 3300024225 Ga0224572_1042722 Ga0224572_10427221 156
28 3300028379 Ga0268266_10188623 Ga0268266_101886232 156
29 3300030878 Ga0265770_1011847 Ga0265770_10118472 156
30 3300005289 Ga0065704_10555192 Ga0065704_105551921 157
31 3300005434 Ga0070709_10160785 Ga0070709_101607852 157
32 3300005434 Ga0070709_10319182 Ga0070709_103191822 157
33 3300005435 Ga0070714_100942925 Ga0070714_1009429251 157
34 3300005436 Ga0070713_100004918 Ga0070713_10000491815 157
35 3300005436 Ga0070713_100092935 Ga0070713_1000929353 157
36 3300005436 Ga0070713_100501168 Ga0070713_1005011681 157
37 3300005436 Ga0070713_100593760 Ga0070713_1005937601 157
38 3300005437 Ga0070710_10308163 Ga0070710_103081631 157
39 3300005439 Ga0070711_100014940 Ga0070711_1000149404 157
40 3300005439 Ga0070711_100169151 Ga0070711_1001691513 157
41 3300005445 Ga0070708_100014785 Ga0070708_1000147855 157
42 3300005445 Ga0070708_100308454 Ga0070708_1003084543 157
43 3300005445 Ga0070708_101271902 Ga0070708_1012719021 157
44 3300005457 Ga0070662_100763446 Ga0070662_1007634462 157
45 3300005459 Ga0068867_101032114 Ga0068867_1010321141 157
46 3300005467 Ga0070706_100103936 Ga0070706_1001039364 157
47 3300005467 Ga0070706_100346551 Ga0070706_1003465512 157
48 3300005467 Ga0070706_100795291 Ga0070706_1007952912 157
49 3300005468 Ga0070707_100077020 Ga0070707_1000770204 157
50 3300005471 Ga0070698_100010422 Ga0070698_10001042212 157
51 3300005471 Ga0070698_100294644 Ga0070698_1002946442 157
52 3300005471 Ga0070698_100334990 Ga0070698_1003349902 157
53 3300005471 Ga0070698_101037540 Ga0070698_1010375401 157
54 3300005518 Ga0070699_100164624 Ga0070699_1001646243 157
55 3300005536 Ga0070697_100000483 Ga0070697_10000048331 157
56 3300005536 Ga0070697_100164013 Ga0070697_1001640133 157
57 3300005536 Ga0070697_100315075 Ga0070697_1003150752 157
58 3300005536 Ga0070697_100395545 Ga0070697_1003955452 157
59 3300005547 Ga0070693_100070801 Ga0070693_1000708012 157
60 3300005617 Ga0068859_100302429 Ga0068859_1003024292 157
61 3300005843 Ga0068860_100053057 Ga0068860_1000530574 157
62 3300005983 Ga0081540_1001797 Ga0081540_10017979 157
63 3300006028 Ga0070717_10022767 Ga0070717_100227675 157
64 3300006028 Ga0070717_10594745 Ga0070717_105947452 157
65 3300006163 Ga0070715_10061220 Ga0070715_100612202 157
66 3300006163 Ga0070715_10072891 Ga0070715_100728913 157
67 3300006173 Ga0070716_100052523 Ga0070716_1000525233 157
68 3300006173 Ga0070716_100082351 Ga0070716_1000823512 157
69 3300006175 Ga0070712_100016741 Ga0070712_1000167412 157
70 3300006931 Ga0097620_100302440 Ga0097620_1003024402 157
71 3300007788 Ga0099795_10241439 Ga0099795_102414391 157
72 3300009098 Ga0105245_10189805 Ga0105245_101898051 157
73 3300009101 Ga0105247_10136515 Ga0105247_101365152 157
74 3300009174 Ga0105241_10105174 Ga0105241_101051743 157
75 3300009176 Ga0105242_10121230 Ga0105242_101212304 157
76 3300009177 Ga0105248_10105704 Ga0105248_101057043 157
77 3300009553 Ga0105249_10273809 Ga0105249_102738092 157
78 3300010159 Ga0099796_10102088 Ga0099796_101020881 157
79 3300010375 Ga0105239_10067503 Ga0105239_100675034 157
80 3300013297 Ga0157378_10000694 Ga0157378_100006947 157
81 3300013306 Ga0163162_10059990 Ga0163162_100599902 157
82 3300013308 Ga0157375_10635486 Ga0157375_106354862 157
83 3300021388 Ga0213875_10004023 Ga0213875_1000402311 157
84 3300022732 Ga0224569_101003 Ga0224569_1010033 157
85 3300022732 Ga0224569_101236 Ga0224569_1012363 157
86 3300022734 Ga0224571_100250 Ga0224571_1002503 157
87 3300024225 Ga0224572_1025726 Ga0224572_10257262 157
88 3300024225 Ga0224572_1026211 Ga0224572_10262112 157
89 3300024225 Ga0224572_1036293 Ga0224572_10362932 157
90 3300024227 Ga0228598_1000472 Ga0228598_100047211 157
91 3300024227 Ga0228598_1001302 Ga0228598_10013022 157
92 3300024227 Ga0228598_1005456 Ga0228598_10054562 157
93 3300024227 Ga0228598_1105812 Ga0228598_11058121 157
94 3300025905 Ga0207685_10434270 Ga0207685_104342702 157
95 3300025906 Ga0207699_10147102 Ga0207699_101471023 157
96 3300025906 Ga0207699_10156264 Ga0207699_101562642 157
97 3300025910 Ga0207684_10004546 Ga0207684_100045464 157
98 3300025910 Ga0207684_10052308 Ga0207684_100523081 157
99 3300025910 Ga0207684_10111056 Ga0207684_101110563 157
100 3300025915 Ga0207693_10000386 Ga0207693_1000038632 157
101 3300025915 Ga0207693_10044113 Ga0207693_100441134 157
102 3300025915 Ga0207693_11196993 Ga0207693_111969931 157
103 3300025916 Ga0207663_10000510 Ga0207663_100005105 157
104 3300025916 Ga0207663_10176698 Ga0207663_101766983 157
105 3300025922 Ga0207646_10584312 Ga0207646_105843122 157
106 3300025927 Ga0207687_10116973 Ga0207687_101169732 157
107 3300025928 Ga0207700_10001777 Ga0207700_100017778 157
108 3300025928 Ga0207700_10022442 Ga0207700_100224422 157
109 3300025928 Ga0207700_10440222 Ga0207700_104402223 157
110 3300025929 Ga0207664_10816022 Ga0207664_108160221 157
111 3300025933 Ga0207706_11170633 Ga0207706_111706331 157
112 3300025939 Ga0207665_10021030 Ga0207665_100210302 157
113 3300025939 Ga0207665_10152016 Ga0207665_101520162 157
114 3300025939 Ga0207665_10927561 Ga0207665_109275612 157
115 3300025941 Ga0207711_10226963 Ga0207711_102269633 157
116 3300026041 Ga0207639_10769981 Ga0207639_107699812 157
117 3300028016 Ga0265354_1000693 Ga0265354_10006936 157
118 3300028017 Ga0265356_1001502 Ga0265356_10015023 157
119 3300028017 Ga0265356_1001791 Ga0265356_10017912 157
120 3300028036 Ga0265355_1004047 Ga0265355_10040471 157
121 3300028381 Ga0268264_10007173 Ga0268264_100071735 157
122 3300028577 Ga0265318_10138491 Ga0265318_101384912 157
123 3300028800 Ga0265338_10005180 Ga0265338_1000518016 157
124 3300028800 Ga0265338_10084532 Ga0265338_100845322 157
125 3300028800 Ga0265338_10187694 Ga0265338_101876942 157
126 3300028800 Ga0265338_10398495 Ga0265338_103984951 157
127 3300030760 Ga0265762_1001779 Ga0265762_10017791 157
128 3300030760 Ga0265762_1002969 Ga0265762_10029694 157
129 3300030760 Ga0265762_1003083 Ga0265762_10030832 157
130 3300030760 Ga0265762_1036635 Ga0265762_10366352 157
131 3300030760 Ga0265762_1096770 Ga0265762_10967701 157
132 3300030878 Ga0265770_1001876 Ga0265770_10018763 157
133 3300030879 Ga0265765_1000419 Ga0265765_10004195 157
134 3300030879 Ga0265765_1034206 Ga0265765_10342061 157
135 3300030879 Ga0265765_1039795 Ga0265765_10397951 157
136 3300031090 Ga0265760_10007433 Ga0265760_100074333 157
137 3300031090 Ga0265760_10009602 Ga0265760_100096021 157
138 3300031090 Ga0265760_10136610 Ga0265760_101366101 157
139 3300031090 Ga0265760_10150464 Ga0265760_101504641 157
140 3300031090 Ga0265760_10186522 Ga0265760_101865221 157
141 3300031239 Ga0265328_10042744 Ga0265328_100427443 157
142 3300031240 Ga0265320_10033294 Ga0265320_100332944 157
143 3300031241 Ga0265325_10005410 Ga0265325_100054105 157
144 3300031241 Ga0265325_10006675 Ga0265325_100066756 157
145 3300031247 Ga0265340_10007183 Ga0265340_100071832 157
146 3300031247 Ga0265340_10071097 Ga0265340_100710973 157
147 3300031249 Ga0265339_10018639 Ga0265339_100186393 157
148 3300031249 Ga0265339_10033462 Ga0265339_100334622 157
149 3300031249 Ga0265339_10048539 Ga0265339_100485392 157
150 3300031344 Ga0265316_10155800 Ga0265316_101558001 157
151 3300031712 Ga0265342_10076975 Ga0265342_100769753 157
152 3300031712 Ga0265342_10579726 Ga0265342_105797261 157
153 3300032120 Ga0316053_104660 Ga0316053_1046601 157
154 3300033544 Ga0316215_1007603 Ga0316215_10076032 157
155 3300033547 Ga0316212_1024043 Ga0316212_10240432 157
156 3300035083 Ga0373926_0039888 Ga0373926_0039888_270_758 157
157 3300035089 Ga0373944_0057976 Ga0373944_0057976_281_754 157
158 3300035117 Ga0373953_0011752 Ga0373953_0011752_1673_2161 157
159 3300035118 Ga0373954_0002185 Ga0373954_0002185_3099_3587 157
160 3300035119 Ga0373956_0001390 Ga0373956_0001390_2694_3182 157
161 3300035170 Ga0373943_0105596 Ga0373943_0105596_506_979 157
162 3300035171 Ga0373946_0026964 Ga0373946_0026964_345_833 157
163 3300035695 Ga0373927_0001418 Ga0373927_0001418_4358_4846 157
164 3300035695 Ga0373927_0086979 Ga0373927_0086979_300_773 157
165 3300035695 Ga0373927_0248854 Ga0373927_0248854_206_679 157
166 3300035724 Ga0373933_0000295 Ga0373933_0000295_16531_17004 157
167 3300035724 Ga0373933_0003706 Ga0373933_0003706_436_924 157
168 3300035725 Ga0373947_0011885 Ga0373947_0011885_2649_3137 157
169 3300036401 Ga0373937_0000015 Ga0373937_0000015_112338_112811 157
170 3300036401 Ga0373937_0003064 Ga0373937_0003064_5674_6162 157
171 3300037068 Ga0373925_0000082 Ga0373925_0000082_4009_4497 157
172 3300037068 Ga0373925_0095332 Ga0373925_0095332_524_997 157
173 3300037853 Ga0436364_0779640 Ga0436364_0779640_341_814 157
174 3300037853 Ga0436364_0791442 Ga0436364_0791442_462_950 157
175 3300039437 Ga0436365_0346303 Ga0436365_0346303_218_706 157
176 3300039437 Ga0436365_1467674 Ga0436365_1467674_495_983 157
177 3300039438 Ga0436360_0189328 Ga0436360_0189328_362_835 157
178 3300039438 Ga0436360_0566025 Ga0436360_0566025_257_730 157
179 3300039447 Ga0436361_0250997 Ga0436361_0250997_47_520 157
180 3300039447 Ga0436361_0541123 Ga0436361_0541123_46_534 157
181 3300039447 Ga0436361_1099977 Ga0436361_1099977_75_563 157
182 3300039453 Ga0436362_0207932 Ga0436362_0207932_70_543 157
183 3300039453 Ga0436362_0830979 Ga0436362_0830979_221_694 157
184 3300044673 Ga0453683_0009914 Ga0453683_0009914_3512_3994 157
185 3300046462 Ga0495651_0020689 Ga0495651_0020689_4577_5050 157
186 3300046462 Ga0495651_0026616 Ga0495651_0026616_3503_3991 157
187 3300046463 Ga0495653_0312483 Ga0495653_0312483_485_958 157
188 3300046472 Ga0495580_0031154 Ga0495580_0031154_1881_2384 157
189 3300046472 Ga0495580_0062073 Ga0495580_0062073_473_946 157
190 3300046472 Ga0495580_0499536 Ga0495580_0499536_237_719 157
191 3300046473 Ga0495582_0205539 Ga0495582_0205539_554_1057 157
192 3300046511 Ga0495608_0066374 Ga0495608_0066374_865_1353 157
193 3300046517 Ga0495630_0231054 Ga0495630_0231054_549_1022 157
194 3300046529 Ga0495652_0009556 Ga0495652_0009556_1504_1977 157
195 3300046536 Ga0495587_0000081 Ga0495587_0000081_52445_52918 157
196 3300046536 Ga0495587_0002201 Ga0495587_0002201_9288_9776 157
197 3300046675 Ga0495657_0125923 Ga0495657_0125923_503_991 157
198 3300046680 Ga0495646_0053934 Ga0495646_0053934_486_959 157
199 3300047317 Ga0495604_0001121 Ga0495604_0001121_9340_9828 157
200 3300047444 Ga0495675_0000105 Ga0495675_0000105_37972_38445 157
201 3300047471 Ga0495684_0003920 Ga0495684_0003920_548_1036 157
202 3300048088 Ga0495602_0000101 Ga0495602_0000101_58130_58603 157
203 3300048088 Ga0495602_0030929 Ga0495602_0030929_2924_3412 157
204 3300048904 Ga0496101_0181040 Ga0496101_0181040_204_677 157
205 3300048905 Ga0496102_0004895 Ga0496102_0004895_1858_2331 157
206 3300048907 Ga0496104_0119622 Ga0496104_0119622_1622_2125 157
207 3300048918 Ga0496115_0016739 Ga0496115_0016739_2530_3033 157
208 3300048918 Ga0496115_0234938 Ga0496115_0234938_434_907 157
209 3300050514 nmdc:mga08x19_699348_c1 nmdc:mga08x19_699348_c1_111_599 157
210 3300053085 Ga0495619_0255903 Ga0495619_0255903_163_651 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

21

106

0.92

PF04173

DoxD

TQO small subunit DoxD

39

144

0.81

Feature Viewer

pLDDT pTM Quality
57.71 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map