F320491

General Info

Members Datasets Scaffolds Average Seq Length
210 123 420 312

Family's Representative Sequence

Representative Sequence 3300027907|Ga0207428_10020012|Ga0207428_100200124
Length 336
Sequence LTEGPHRVSLVLPTKNGAATLPAVLEAVWRQRASFGLETIAIDSGSTDGTLDLLRGKVTHLISIPPHTYDHGLTRNLGIMQATGELVVLLVQDAVPASEHWLEALTTPLFADPELAGTFARQQPAPNASAIARHYLSKWVASKDSAWTRSLNGPAELDDLLPLQRMEFCAFDNVCSCIRRSVWTEHPFHSSPIAEDLQWAREVLLAGHKLAFVPEAVVVHSHDRSPWYELFRTHALHKRLSELFGIETIPTPQLLARAIASSLVTNLWCERAAPAQWPRAAALSVVWPLAQYLGARDARAKGTGQRAEGRVKGEKEKEVTLPEPDLYDRPGTILKL

Samples

Sample ID Description Type Environment
1 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
96 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
116 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
117 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
121 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.81
Rhizosphere 96.19
Stem 0
Stem Tuber 0
Unclassified 22.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207428_10020012 3300027907 Bacteria 5699
2 Ga0065712_10070697 3300005290 Bacteria 5775
3 Ga0070676_10019085 3300005328 Bacteria 3810
4 Ga0070683_100013210 3300005329 Bacteria 7193
5 Ga0070670_100001174 3300005331 Bacteria 20803
6 Ga0070677_10019248 3300005333 Bacteria 2470
7 Ga0070689_100240141 3300005340 Bacteria 1492
8 Ga0070661_100029230 3300005344 Unclassified 3977
9 Ga0070668_100159356 3300005347 Bacteria 1830
10 Ga0070669_100026329 3300005353 Bacteria 4184
11 Ga0070675_100003488 3300005354 Bacteria 11927
12 Ga0070675_100083640 3300005354 Bacteria 2664
13 Ga0070671_100018452 3300005355 Bacteria 5667
14 Ga0070671_100090684 3300005355 Bacteria 2559
15 Ga0070674_100021562 3300005356 Bacteria 4140
16 Ga0070673_100011620 3300005364 Bacteria 6014
17 Ga0070673_100024091 3300005364 Bacteria 4456
18 Ga0070673_100038963 3300005364 Unclassified 3634
19 Ga0070673_100347977 3300005364 Unclassified 1315
20 Ga0070667_100191213 3300005367 Bacteria 1813
21 Ga0070667_100327231 3300005367 Bacteria 1384
22 Ga0070709_10000005 3300005434 Bacteria 197619
23 Ga0070701_10007187 3300005438 Bacteria 4740
24 Ga0070705_100116224 3300005440 Unclassified 1719
25 Ga0070694_100242409 3300005444 Bacteria 1360
26 Ga0070663_100018918 3300005455 Unclassified 4527
27 Ga0070663_100029527 3300005455 Unclassified 3748
28 Ga0070662_100131774 3300005457 Unclassified 1928
29 Ga0070662_100231892 3300005457 Bacteria 1477
30 Ga0070681_10321481 3300005458 Bacteria 1457
31 Ga0068867_100000708 3300005459 Bacteria 22219
32 Ga0070685_10074228 3300005466 Bacteria 2023
33 Ga0070679_100299313 3300005530 Bacteria 1559
34 Ga0070684_100000941 3300005535 Bacteria 20724
35 Ga0070672_100037038 3300005543 Bacteria 3720
36 Ga0070672_100046579 3300005543 Bacteria 3360
37 Ga0070672_100062089 3300005543 Bacteria 2948
38 Ga0070672_100152705 3300005543 Bacteria 1911
39 Ga0070686_100134656 3300005544 Bacteria 1713
40 Ga0070693_100004577 3300005547 Bacteria 6561
41 Ga0070704_100067617 3300005549 Unclassified 2581
42 Ga0070664_100002693 3300005564 Bacteria 14333
43 Ga0068859_100072865 3300005617 Bacteria 3472
44 Ga0068859_100324736 3300005617 Bacteria 1633
45 Ga0068861_100036879 3300005719 Bacteria 3632
46 Ga0068861_100300348 3300005719 Unclassified 1390
47 Ga0068851_10061297 3300005834 Bacteria 1928
48 Ga0068870_10036439 3300005840 Bacteria 2531
49 Ga0068863_100120814 3300005841 Bacteria 2498
50 Ga0068858_100040297 3300005842 Bacteria 4331
51 Ga0068858_100119106 3300005842 Bacteria 2468
52 Ga0068858_100207227 3300005842 Bacteria 1855
53 Ga0068860_100137159 3300005843 Bacteria 2350
54 Ga0068860_100508751 3300005843 Bacteria 1203
55 Ga0068862_100146636 3300005844 Bacteria 2098
56 Ga0070716_100027702 3300006173 Unclassified 3047
57 Ga0097621_100030980 3300006237 Bacteria 4240
58 Ga0097621_100285660 3300006237 Bacteria 1453
59 Ga0068871_100008084 3300006358 Bacteria 7553
60 Ga0075428_100000078 3300006844 Bacteria 80448
61 Ga0075428_100117399 3300006844 Bacteria 2899
62 Ga0075428_100191987 3300006844 Bacteria 2209
63 Ga0075430_100003650 3300006846 Bacteria 12920
64 Ga0075430_100003689 3300006846 Bacteria 12862
65 Ga0075430_100040658 3300006846 Unclassified 3935
66 Ga0075431_100003019 3300006847 Bacteria 16283
67 Ga0075431_100041614 3300006847 Bacteria 4738
68 Ga0075431_100046884 3300006847 Unclassified 4456
69 Ga0075433_10103611 3300006852 Unclassified 2520
70 Ga0075433_10117413 3300006852 Unclassified 2361
71 Ga0075433_10179934 3300006852 Bacteria 1881
72 Ga0075434_100013121 3300006871 Bacteria 7870
73 Ga0075434_100130417 3300006871 Unclassified 2532
74 Ga0075429_100002680 3300006880 Bacteria 14985
75 Ga0075429_100099138 3300006880 Bacteria 2542
76 Ga0068865_100007674 3300006881 Bacteria 6645
77 Ga0068865_100226248 3300006881 Bacteria 1465
78 Ga0068865_100227793 3300006881 Bacteria 1460
79 Ga0075436_100054024 3300006914 Bacteria 2772
80 Ga0097620_100072862 3300006931 Bacteria 3472
81 Ga0097620_100324756 3300006931 Bacteria 1633
82 Ga0075435_100089519 3300007076 Bacteria 2538
83 Ga0111539_10010736 3300009094 Bacteria 11525
84 Ga0111539_10013731 3300009094 Bacteria 10118
85 Ga0111539_10045352 3300009094 Bacteria 5263
86 Ga0111539_10072412 3300009094 Bacteria 4064
87 Ga0111539_10073111 3300009094 Bacteria 4042
88 Ga0111539_10285552 3300009094 Bacteria 1920
89 Ga0105247_10204649 3300009101 Unclassified 1328
90 Ga0114129_10000323 3300009147 Bacteria 56097
91 Ga0114129_10009555 3300009147 Bacteria 13830
92 Ga0114129_10038168 3300009147 Bacteria 6778
93 Ga0114129_10072695 3300009147 Bacteria 4794
94 Ga0114129_10089253 3300009147 Unclassified 4273
95 Ga0114129_10118356 3300009147 Bacteria 3649
96 Ga0114129_10160660 3300009147 Unclassified 3069
97 Ga0114129_10194831 3300009147 Unclassified 2749
98 Ga0114129_10471406 3300009147 Bacteria 1644
99 Ga0105242_10685930 3300009176 Unclassified 1000
100 Ga0105248_10046686 3300009177 Unclassified 4855
101 Ga0105248_10091188 3300009177 Unclassified 3432
102 Ga0105248_10187431 3300009177 Unclassified 2331
103 Ga0105248_10236122 3300009177 Unclassified 2058
104 Ga0105238_10018859 3300009551 Bacteria 7023
105 Ga0105249_10272843 3300009553 Bacteria 1686
106 Ga0157374_10026540 3300013296 Bacteria 5212
107 Ga0157374_10223336 3300013296 Bacteria 1849
108 Ga0163163_10033389 3300014325 Bacteria 4977
109 Ga0163163_10352871 3300014325 Bacteria 1527
110 Ga0157380_10046981 3300014326 Unclassified 3393
111 Ga0157380_10076691 3300014326 Unclassified 2721
112 Ga0157380_10088214 3300014326 Bacteria 2552
113 Ga0157380_10162799 3300014326 Bacteria 1941
114 Ga0157380_10264041 3300014326 Bacteria 1565
115 Ga0157379_10052759 3300014968 Unclassified 3631
116 Ga0207682_10018624 3300025893 Bacteria 2715
117 Ga0207699_10000015 3300025906 Bacteria 251707
118 Ga0207699_10131265 3300025906 Unclassified 1634
119 Ga0207645_10003966 3300025907 Bacteria 11045
120 Ga0207643_10107846 3300025908 Bacteria 1638
121 Ga0207643_10221553 3300025908 Bacteria 1158
122 Ga0207693_10321406 3300025915 Bacteria 1211
123 Ga0207649_10027415 3300025920 Unclassified 3342
124 Ga0207681_10017320 3300025923 Bacteria 4523
125 Ga0207681_10051427 3300025923 Bacteria 2792
126 Ga0207681_10192416 3300025923 Bacteria 1561
127 Ga0207694_10292746 3300025924 Bacteria 1339
128 Ga0207650_10099653 3300025925 Unclassified 2234
129 Ga0207659_10002191 3300025926 Bacteria 11611
130 Ga0207659_10008525 3300025926 Bacteria 6372
131 Ga0207644_10010406 3300025931 Bacteria 6129
132 Ga0207644_10017003 3300025931 Bacteria 4903
133 Ga0207706_10046163 3300025933 Bacteria 3857
134 Ga0207706_10113614 3300025933 Unclassified 2382
135 Ga0207706_10237079 3300025933 Bacteria 1595
136 Ga0207709_10061302 3300025935 Bacteria 2350
137 Ga0207670_10038460 3300025936 Unclassified 3125
138 Ga0207670_10091543 3300025936 Bacteria 2151
139 Ga0207670_10239466 3300025936 Bacteria 1397
140 Ga0207669_10002901 3300025937 Bacteria 7359
141 Ga0207704_10055899 3300025938 Unclassified 2414
142 Ga0207704_10057553 3300025938 Bacteria 2389
143 Ga0207704_10101290 3300025938 Bacteria 1921
144 Ga0207704_10232100 3300025938 Bacteria 1373
145 Ga0207665_10043185 3300025939 Bacteria 3014
146 Ga0207665_10082615 3300025939 Unclassified 2214
147 Ga0207691_10014827 3300025940 Bacteria 7427
148 Ga0207691_10026300 3300025940 Bacteria 5462
149 Ga0207691_10161636 3300025940 Bacteria 1964
150 Ga0207691_10192992 3300025940 Bacteria 1776
151 Ga0207711_10166849 3300025941 Unclassified 1996
152 Ga0207689_10001155 3300025942 Bacteria 25406
153 Ga0207661_10005267 3300025944 Bacteria 9102
154 Ga0207679_10007680 3300025945 Bacteria 6850
155 Ga0207651_10009181 3300025960 Bacteria 5391
156 Ga0207651_10196616 3300025960 Bacteria 1612
157 Ga0207658_10059932 3300025986 Bacteria 2838
158 Ga0207658_10082671 3300025986 Bacteria 2467
159 Ga0207658_10172099 3300025986 Unclassified 1785
160 Ga0207703_10059466 3300026035 Bacteria 3121
161 Ga0207703_10136927 3300026035 Bacteria 2121
162 Ga0207678_10012858 3300026067 Bacteria 7348
163 Ga0207678_10046877 3300026067 Unclassified 3738
164 Ga0207702_10347104 3300026078 Unclassified 1419
165 Ga0207648_10001137 3300026089 Bacteria 29904
166 Ga0207675_100038801 3300026118 Bacteria 4445
167 Ga0207675_100232888 3300026118 Bacteria 1777
168 Ga0207428_10034075 3300027907 Bacteria 4176
169 Ga0207428_10044155 3300027907 Bacteria 3596
170 Ga0268265_10545766 3300028380 Bacteria 1100
171 Ga0268264_10034357 3300028381 Bacteria 4170
172 Ga0268264_10300119 3300028381 Bacteria 1512
173 Ga0373944_0052193 3300035089 Bacteria 1291
174 Ga0373947_0047378 3300035725 Bacteria 2576
175 Ga0373937_0489262 3300036401 Bacteria 1169
176 Ga0451577_0003991 3300042876 Bacteria 15889
177 Ga0453684_0000428 3300044712 Bacteria 171577
178 Ga0451576_0361208 3300045051 Unclassified 1521
179 Ga0451576_0490608 3300045051 Bacteria 1290
180 Ga0466967_0509995 3300045976 Bacteria 1181
181 Ga0495639_0009452 3300046475 Bacteria 4181
182 Ga0495586_0242330 3300046535 Unclassified 1028
183 Ga0495599_0097385 3300046678 Bacteria 1834
184 Ga0496104_0019148 3300048907 Bacteria 6257
185 Ga0496105_0031951 3300048908 Unclassified 4317
186 Ga0496106_0054730 3300048909 Unclassified 3015
187 Ga0496108_0399706 3300048911 Unclassified 1200
188 Ga0496109_0052839 3300048912 Unclassified 3704
189 Ga0496110_0004522 3300048913 Bacteria 10790
190 Ga0496111_0001625 3300048914 Bacteria 13018
191 Ga0496114_0070209 3300048917 Unclassified 2942
192 nmdc:mga05p37_1_c1 3300050507 Bacteria 177088
193 nmdc:mga05p37_49530_c1 3300050507 Bacteria 5167
194 nmdc:mga05p37_58623_c1 3300050507 Bacteria 4742
195 nmdc:mga09592_3365_c1 3300050508 Bacteria 12924
196 nmdc:mga0qj67_20815_c1 3300050509 Bacteria 5024
197 nmdc:mga0qj67_241165_c1 3300050509 Bacteria 1467
198 nmdc:mga06r32_129355_c1 3300050510 Unclassified 2495
199 nmdc:mga06r32_418467_c1 3300050510 Unclassified 1321
200 nmdc:mga06r32_468360_c1 3300050510 Bacteria 1239
201 nmdc:mga08y16_22025_c1 3300050511 Bacteria 6729
202 nmdc:mga08y16_29778_c1 3300050511 Bacteria 5748
203 nmdc:mga08y16_5621_c1 3300050511 Bacteria 13132
204 nmdc:mga0n895_55551_c1 3300050512 Bacteria 3897
205 nmdc:mga08x19_5131_c1 3300050514 Bacteria 7746
206 nmdc:mga0a205_135162_c1 3300050515 Bacteria 2366
207 nmdc:mga0a205_367482_c1 3300050515 Bacteria 1305
208 Ga0495595_0103341 3300053084 Bacteria 1377
209 Ga0501084_0179161 3300054114 Unclassified 1789
210 Ga0530510_0293496 3300061734 Bacteria 1216
211 Ga0207428_10020012
212 Ga0065712_10070697
213 Ga0070676_10019085
214 Ga0070683_100013210
215 Ga0070670_100001174
216 Ga0070677_10019248
217 Ga0070689_100240141
218 Ga0070661_100029230
219 Ga0070668_100159356
220 Ga0070669_100026329
221 Ga0070675_100003488
222 Ga0070675_100083640
223 Ga0070671_100018452
224 Ga0070671_100090684
225 Ga0070674_100021562
226 Ga0070673_100011620
227 Ga0070673_100024091
228 Ga0070673_100038963
229 Ga0070673_100347977
230 Ga0070667_100191213
231 Ga0070667_100327231
232 Ga0070709_10000005
233 Ga0070701_10007187
234 Ga0070705_100116224
235 Ga0070694_100242409
236 Ga0070663_100018918
237 Ga0070663_100029527
238 Ga0070662_100131774
239 Ga0070662_100231892
240 Ga0070681_10321481
241 Ga0068867_100000708
242 Ga0070685_10074228
243 Ga0070679_100299313
244 Ga0070684_100000941
245 Ga0070672_100037038
246 Ga0070672_100046579
247 Ga0070672_100062089
248 Ga0070672_100152705
249 Ga0070686_100134656
250 Ga0070693_100004577
251 Ga0070704_100067617
252 Ga0070664_100002693
253 Ga0068859_100072865
254 Ga0068859_100324736
255 Ga0068861_100036879
256 Ga0068861_100300348
257 Ga0068851_10061297
258 Ga0068870_10036439
259 Ga0068863_100120814
260 Ga0068858_100040297
261 Ga0068858_100119106
262 Ga0068858_100207227
263 Ga0068860_100137159
264 Ga0068860_100508751
265 Ga0068862_100146636
266 Ga0070716_100027702
267 Ga0097621_100030980
268 Ga0097621_100285660
269 Ga0068871_100008084
270 Ga0075428_100000078
271 Ga0075428_100117399
272 Ga0075428_100191987
273 Ga0075430_100003650
274 Ga0075430_100003689
275 Ga0075430_100040658
276 Ga0075431_100003019
277 Ga0075431_100041614
278 Ga0075431_100046884
279 Ga0075433_10103611
280 Ga0075433_10117413
281 Ga0075433_10179934
282 Ga0075434_100013121
283 Ga0075434_100130417
284 Ga0075429_100002680
285 Ga0075429_100099138
286 Ga0068865_100007674
287 Ga0068865_100226248
288 Ga0068865_100227793
289 Ga0075436_100054024
290 Ga0097620_100072862
291 Ga0097620_100324756
292 Ga0075435_100089519
293 Ga0111539_10010736
294 Ga0111539_10013731
295 Ga0111539_10045352
296 Ga0111539_10072412
297 Ga0111539_10073111
298 Ga0111539_10285552
299 Ga0105247_10204649
300 Ga0114129_10000323
301 Ga0114129_10009555
302 Ga0114129_10038168
303 Ga0114129_10072695
304 Ga0114129_10089253
305 Ga0114129_10118356
306 Ga0114129_10160660
307 Ga0114129_10194831
308 Ga0114129_10471406
309 Ga0105242_10685930
310 Ga0105248_10046686
311 Ga0105248_10091188
312 Ga0105248_10187431
313 Ga0105248_10236122
314 Ga0105238_10018859
315 Ga0105249_10272843
316 Ga0157374_10026540
317 Ga0157374_10223336
318 Ga0163163_10033389
319 Ga0163163_10352871
320 Ga0157380_10046981
321 Ga0157380_10076691
322 Ga0157380_10088214
323 Ga0157380_10162799
324 Ga0157380_10264041
325 Ga0157379_10052759
326 Ga0207682_10018624
327 Ga0207699_10000015
328 Ga0207699_10131265
329 Ga0207645_10003966
330 Ga0207643_10107846
331 Ga0207643_10221553
332 Ga0207693_10321406
333 Ga0207649_10027415
334 Ga0207681_10017320
335 Ga0207681_10051427
336 Ga0207681_10192416
337 Ga0207694_10292746
338 Ga0207650_10099653
339 Ga0207659_10002191
340 Ga0207659_10008525
341 Ga0207644_10010406
342 Ga0207644_10017003
343 Ga0207706_10046163
344 Ga0207706_10113614
345 Ga0207706_10237079
346 Ga0207709_10061302
347 Ga0207670_10038460
348 Ga0207670_10091543
349 Ga0207670_10239466
350 Ga0207669_10002901
351 Ga0207704_10055899
352 Ga0207704_10057553
353 Ga0207704_10101290
354 Ga0207704_10232100
355 Ga0207665_10043185
356 Ga0207665_10082615
357 Ga0207691_10014827
358 Ga0207691_10026300
359 Ga0207691_10161636
360 Ga0207691_10192992
361 Ga0207711_10166849
362 Ga0207689_10001155
363 Ga0207661_10005267
364 Ga0207679_10007680
365 Ga0207651_10009181
366 Ga0207651_10196616
367 Ga0207658_10059932
368 Ga0207658_10082671
369 Ga0207658_10172099
370 Ga0207703_10059466
371 Ga0207703_10136927
372 Ga0207678_10012858
373 Ga0207678_10046877
374 Ga0207702_10347104
375 Ga0207648_10001137
376 Ga0207675_100038801
377 Ga0207675_100232888
378 Ga0207428_10034075
379 Ga0207428_10044155
380 Ga0268265_10545766
381 Ga0268264_10034357
382 Ga0268264_10300119
383 Ga0373944_0052193
384 Ga0373947_0047378
385 Ga0373937_0489262
386 Ga0451577_0003991
387 Ga0453684_0000428
388 Ga0451576_0361208
389 Ga0451576_0490608
390 Ga0466967_0509995
391 Ga0495639_0009452
392 Ga0495586_0242330
393 Ga0495599_0097385
394 Ga0496104_0019148
395 Ga0496105_0031951
396 Ga0496106_0054730
397 Ga0496108_0399706
398 Ga0496109_0052839
399 Ga0496110_0004522
400 Ga0496111_0001625
401 Ga0496114_0070209
402 nmdc:mga05p37_1_c1
403 nmdc:mga05p37_49530_c1
404 nmdc:mga05p37_58623_c1
405 nmdc:mga09592_3365_c1
406 nmdc:mga0qj67_20815_c1
407 nmdc:mga0qj67_241165_c1
408 nmdc:mga06r32_129355_c1
409 nmdc:mga06r32_418467_c1
410 nmdc:mga06r32_468360_c1
411 nmdc:mga08y16_22025_c1
412 nmdc:mga08y16_29778_c1
413 nmdc:mga08y16_5621_c1
414 nmdc:mga0n895_55551_c1
415 nmdc:mga08x19_5131_c1
416 nmdc:mga0a205_135162_c1
417 nmdc:mga0a205_367482_c1
418 Ga0495595_0103341
419 Ga0501084_0179161
420 Ga0530510_0293496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

9

168

0.84

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

5

235

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7531 1 219
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7496 1 219
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7439 1 220
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7403 1 220
3bcv-assembly1.cif.gz_B crystal structure of a putative glycosyltransferase from bacteroides fragilis 0.7356 1 211
ID Description Score Start End Superfamily
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.827 1 224 3.90.550.10
af_P75905_64_287_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8145 3 222 3.90.550.10
af_Q9RQP9_29_257_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8089 3 222 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7989 1 224 3.90.550.10
af_A9C3Q0_26_206_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.771 3 106 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A1F2REV6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9577 1 311
AF-A0A1F2REV6-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9517 1 311
AF-A0A522A668-F1-model_v4 Glycosyltransferase family 2 protein 0.9493 5 311 GO:0016740
GO:0044010
GO:0045226
AF-A0A2D6A245-F1-model_v4 Glycosyltransferase 2-like domain-containing protein 0.9424 5 306
AF-A0A522A668-F1-model_v4 Glycosyltransferase family 2 protein 0.9345 5 311 GO:0016740
GO:0044010
GO:0045226

Map