F320449

General Info

Members Datasets Scaffolds Average Seq Length
210 163 420 176

Family's Representative Sequence

Representative Sequence 3300025931|Ga0207644_10423303|Ga0207644_104233032
Length 200
Sequence MAACAPTARYARRMVKSAVPVVSATKGATRLDILVGDITTLEVDAIVNAANRTLLGGGGVDGAIHRAAGPELKRECASLGGCETGSAKITKGYRLKAKHVIHAVGPVWSGGNKRENELLRSCYATALDLAAKHLLHTIAFPAISTGVYSFPADRAARIAVGAVTEEIEKAPRGLKQVIFCCFSPESAEHHKAAFAELGLS

Samples

Sample ID Description Type Environment
1 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
92 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
101 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
110 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
129 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
130 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
131 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
149 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
150 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
159 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
160 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 0
Rhizoplane 14.76
Rhizosphere 77.14
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207644_10423303 3300025931 Bacteria 1091
2 Ga0070658_10847934 3300005327 Bacteria 794
3 Ga0070691_10035857 3300005341 Bacteria 2336
4 Ga0070668_100409587 3300005347 Bacteria 1159
5 Ga0070675_100708252 3300005354 Bacteria 917
6 Ga0070671_100159319 3300005355 Bacteria 1908
7 Ga0070703_10004321 3300005406 Bacteria 4005
8 Ga0070709_10114570 3300005434 Bacteria 1817
9 Ga0070709_10143613 3300005434 Bacteria 1642
10 Ga0070714_100335785 3300005435 Bacteria 1416
11 Ga0070713_100635432 3300005436 Bacteria 1016
12 Ga0070701_10007900 3300005438 Bacteria 4574
13 Ga0070705_100000048 3300005440 Bacteria 61670
14 Ga0070700_100001513 3300005441 Bacteria 11564
15 Ga0070694_100000506 3300005444 Bacteria 21401
16 Ga0070708_100765766 3300005445 Bacteria 908
17 Ga0070663_100018062 3300005455 Bacteria 4615
18 Ga0070663_100150528 3300005455 Bacteria 1784
19 Ga0070662_100104174 3300005457 Bacteria 2152
20 Ga0070681_10309540 3300005458 Bacteria 1489
21 Ga0070706_100418037 3300005467 Bacteria 1248
22 Ga0070707_100358111 3300005468 Bacteria 1417
23 Ga0070707_100552312 3300005468 Bacteria 1114
24 Ga0070698_100454281 3300005471 Bacteria 1217
25 Ga0070698_101374822 3300005471 Bacteria 657
26 Ga0070699_100000318 3300005518 Bacteria 46655
27 Ga0070679_100154323 3300005530 Bacteria 2272
28 Ga0070679_100322060 3300005530 Bacteria 1495
29 Ga0070679_101648244 3300005530 Bacteria 589
30 Ga0070697_100068434 3300005536 Bacteria 2907
31 Ga0068853_100281855 3300005539 Bacteria 1532
32 Ga0070695_100139892 3300005545 Bacteria 1677
33 Ga0070695_100321694 3300005545 Bacteria 1150
34 Ga0070696_100036502 3300005546 Bacteria 3389
35 Ga0070696_100262356 3300005546 Bacteria 1310
36 Ga0070693_100006416 3300005547 Bacteria 5700
37 Ga0070704_100130409 3300005549 Bacteria 1947
38 Ga0068855_100912568 3300005563 Bacteria 927
39 Ga0070664_100830946 3300005564 Bacteria 864
40 Ga0068857_100033524 3300005577 Bacteria 4541
41 Ga0068852_100043908 3300005616 Bacteria 3793
42 Ga0068859_100488588 3300005617 Bacteria 1326
43 Ga0068859_101174516 3300005617 Bacteria 845
44 Ga0068864_100025404 3300005618 Bacteria 4988
45 Ga0068861_101169171 3300005719 Bacteria 742
46 Ga0068870_10661783 3300005840 Bacteria 716
47 Ga0068863_100574693 3300005841 Bacteria 1114
48 Ga0068858_100164525 3300005842 Bacteria 2090
49 Ga0068860_100002212 3300005843 Bacteria 20463
50 Ga0068862_100002280 3300005844 Bacteria 17170
51 Ga0081455_10012863 3300005937 Bacteria 8309
52 Ga0081455_10020937 3300005937 Bacteria 6145
53 Ga0081455_10023566 3300005937 Bacteria 5726
54 Ga0081539_10004846 3300005985 Bacteria 14401
55 Ga0081539_10015946 3300005985 Bacteria 5414
56 Ga0075365_10105331 3300006038 Bacteria 1934
57 Ga0075368_10061467 3300006042 Bacteria 1504
58 Ga0075363_100233189 3300006048 Bacteria 1057
59 Ga0070715_10136808 3300006163 Bacteria 1185
60 Ga0075366_10273585 3300006195 Bacteria 1032
61 Ga0075370_10157559 3300006353 Bacteria 1332
62 Ga0075428_100132771 3300006844 Bacteria 2707
63 Ga0075430_100679677 3300006846 Bacteria 849
64 Ga0075434_100035021 3300006871 Bacteria 4962
65 Ga0075436_100310106 3300006914 Bacteria 1132
66 Ga0075436_100525483 3300006914 Bacteria 867
67 Ga0097620_100488576 3300006931 Bacteria 1326
68 Ga0075435_100028161 3300007076 Bacteria 4404
69 Ga0111539_10122957 3300009094 Bacteria 3042
70 Ga0105245_10687883 3300009098 Bacteria 1055
71 Ga0105237_10851659 3300009545 Bacteria 918
72 Ga0105238_10157800 3300009551 Bacteria 2244
73 Ga0105238_10227906 3300009551 Bacteria 1840
74 Ga0105249_10008522 3300009553 Bacteria 8939
75 Ga0105249_10452535 3300009553 Bacteria 1323
76 Ga0105239_10175054 3300010375 Bacteria 2400
77 Ga0157373_10232407 3300013100 Bacteria 1302
78 Ga0157370_10247845 3300013104 Bacteria 1648
79 Ga0157369_11440900 3300013105 Bacteria 701
80 Ga0182008_10249295 3300014497 Bacteria 916
81 Ga0213872_10090985 3300021361 Bacteria 1365
82 Ga0207653_10002277 3300025885 Bacteria 6119
83 Ga0207688_10263800 3300025901 Bacteria 1046
84 Ga0207699_10064694 3300025906 Bacteria 2214
85 Ga0207695_10973284 3300025913 Bacteria 728
86 Ga0207671_10219553 3300025914 Bacteria 1489
87 Ga0207660_10006217 3300025917 Bacteria 7755
88 Ga0207662_10191611 3300025918 Bacteria 1320
89 Ga0207652_10123103 3300025921 Bacteria 2309
90 Ga0207652_11061479 3300025921 Bacteria 710
91 Ga0207646_10277425 3300025922 Bacteria 1515
92 Ga0207646_10476594 3300025922 Bacteria 1125
93 Ga0207694_10293426 3300025924 Bacteria 1337
94 Ga0207694_10782581 3300025924 Bacteria 806
95 Ga0207659_10328381 3300025926 Bacteria 1264
96 Ga0207700_10527446 3300025928 Bacteria 1047
97 Ga0207679_11626463 3300025945 Bacteria 592
98 Ga0207667_10612553 3300025949 Bacteria 1097
99 Ga0207712_10003887 3300025961 Bacteria 9441
100 Ga0207678_10011879 3300026067 Bacteria 7647
101 Ga0207641_10398679 3300026088 Bacteria 1321
102 Ga0207676_10033734 3300026095 Bacteria 3870
103 Ga0207674_10003304 3300026116 Bacteria 19830
104 Ga0207674_10540252 3300026116 Bacteria 1126
105 Ga0268265_10000834 3300028380 Bacteria 29057
106 Ga0268264_10002254 3300028381 Bacteria 17074
107 Ga0268264_10545043 3300028381 Bacteria 1137
108 Ga0265327_10016417 3300031251 Bacteria 4704
109 Ga0373923_0041356 3300035111 Bacteria 1900
110 Ga0373936_0000628 3300035113 Bacteria 12173
111 Ga0373939_0001690 3300035114 Bacteria 5342
112 Ga0373931_0294058 3300035691 Bacteria 1001
113 Ga0373937_0016393 3300036401 Bacteria 6581
114 Ga0373937_0884155 3300036401 Bacteria 842
115 Ga0316582_0190110 3300036647 Bacteria 1399
116 Ga0316582_0371132 3300036647 Archaea 985
117 Ga0316584_0323933 3300036712 Bacteria 1111
118 Ga0395900_0037449 3300037418 Bacteria 5001
119 Ga0395898_0045331 3300037466 Bacteria 4322
120 Ga0436364_0528734 3300037853 Bacteria 1412
121 Ga0436365_0998372 3300039437 Bacteria 6712
122 Ga0436361_1175973 3300039447 Bacteria 1000
123 Ga0451577_0201471 3300042876 Bacteria 1797
124 Ga0453683_0021910 3300044673 Bacteria 4076
125 Ga0466961_0052750 3300044693 Bacteria 2596
126 Ga0466963_0002142 3300044694 Bacteria 10920
127 Ga0466963_0035696 3300044694 Bacteria 3240
128 Ga0466963_0883433 3300044694 Bacteria 630
129 Ga0466957_0078022 3300044842 Bacteria 2059
130 Ga0466958_0180311 3300045836 Bacteria 1340
131 Ga0466958_0249522 3300045836 Bacteria 1135
132 Ga0466967_0000841 3300045976 Bacteria 16220
133 Ga0495592_0003783 3300046454 Bacteria 10920
134 Ga0495641_0089304 3300046461 Bacteria 1377
135 Ga0495651_0017194 3300046462 Bacteria 5604
136 Ga0495653_0029331 3300046463 Bacteria 4393
137 Ga0495628_0178147 3300046516 Bacteria 1609
138 Ga0495640_0043343 3300046533 Bacteria 3134
139 Ga0495645_0170172 3300046543 Bacteria 1500
140 Ga0495667_0016635 3300046559 Bacteria 4967
141 Ga0495634_0143007 3300046642 Bacteria 1517
142 Ga0495588_0108496 3300046674 Bacteria 1461
143 Ga0495658_0047938 3300046683 Bacteria 2407
144 Ga0495613_0118192 3300046689 Bacteria 1905
145 Ga0495600_0003397 3300046809 Bacteria 9370
146 Ga0495581_0003534 3300047315 Bacteria 8971
147 Ga0495604_0006489 3300047317 Bacteria 9271
148 Ga0495684_0005293 3300047471 Bacteria 10050
149 Ga0495593_0034309 3300047673 Bacteria 2761
150 Ga0496100_0003697 3300048903 Bacteria 8009
151 Ga0496101_0002247 3300048904 Bacteria 11805
152 Ga0496101_0103466 3300048904 Bacteria 2134
153 Ga0496102_0002762 3300048905 Bacteria 14964
154 Ga0496102_0010647 3300048905 Bacteria 7922
155 Ga0496103_0004741 3300048906 Bacteria 8225
156 Ga0496104_0011923 3300048907 Bacteria 7797
157 Ga0496105_0021111 3300048908 Bacteria 5267
158 Ga0496105_0079199 3300048908 Bacteria 2713
159 Ga0496106_0002637 3300048909 Bacteria 13340
160 Ga0496106_0083456 3300048909 Bacteria 2457
161 Ga0496107_0004771 3300048910 Bacteria 9208
162 Ga0496107_0029901 3300048910 Bacteria 3879
163 Ga0496108_0001178 3300048911 Bacteria 20397
164 Ga0496108_0193747 3300048911 Bacteria 1762
165 Ga0496108_0209609 3300048911 Bacteria 1691
166 Ga0496109_0004323 3300048912 Bacteria 11864
167 Ga0496109_0210601 3300048912 Bacteria 1828
168 Ga0496109_0218277 3300048912 Bacteria 1793
169 Ga0496109_1537847 3300048912 Bacteria 600
170 Ga0496110_0004642 3300048913 Bacteria 10677
171 Ga0496110_0018362 3300048913 Bacteria 5864
172 Ga0496111_0004667 3300048914 Bacteria 8682
173 Ga0496111_0021029 3300048914 Bacteria 4550
174 Ga0496112_0009204 3300048915 Bacteria 8877
175 Ga0496112_0178771 3300048915 Bacteria 2085
176 Ga0496112_0551702 3300048915 Bacteria 1086
177 Ga0496113_0041916 3300048916 Bacteria 3380
178 Ga0496113_0206265 3300048916 Bacteria 1563
179 Ga0496115_0060574 3300048918 Bacteria 3050
180 Ga0496115_0107309 3300048918 Bacteria 2293
181 Ga0501033_0172054 3300049570 Bacteria 1555
182 Ga0501036_0795300 3300049572 Bacteria 779
183 Ga0501070_1276603 3300049586 Bacteria 561
184 Ga0501073_0049066 3300049589 Bacteria 2961
185 Ga0501073_0691980 3300049589 Bacteria 703
186 Ga0501076_0561810 3300049592 Bacteria 941
187 Ga0501044_0665503 3300049823 Bacteria 929
188 Ga0501045_0905980 3300049824 Bacteria 648
189 nmdc:mga03683_10746_c1 3300050489 Bacteria 3290
190 nmdc:mga03683_29123_c1 3300050489 Bacteria 2200
191 nmdc:mga03n38_194695_c1 3300050490 Bacteria 1046
192 nmdc:mga0yw44_26052_c1 3300050492 Bacteria 3335
193 nmdc:mga0yw44_35864_c1 3300050492 Bacteria 1356
194 nmdc:mga0k408_50144_c1 3300050493 Bacteria 2416
195 nmdc:mga06z11_22803_c1 3300050494 Bacteria 2930
196 nmdc:mga07m45_1374_c1 3300050496 Bacteria 4679
197 nmdc:mga09592_324234_c1 3300050508 Bacteria 1334
198 nmdc:mga09592_387339_c1 3300050508 Bacteria 1208
199 nmdc:mga0qj67_97013_c1 3300050509 Bacteria 2373
200 nmdc:mga08y16_369052_c1 3300050511 Bacteria 1472
201 nmdc:mga0n895_359802_c1 3300050512 Bacteria 1474
202 nmdc:mga0n895_506643_c1 3300050512 Bacteria 1216
203 nmdc:mga0rr50_55311_c1 3300050513 Bacteria 2960
204 nmdc:mga0sz30_440_c1 3300050516 Bacteria 12989
205 Ga0495601_0087525 3300053077 Bacteria 2002
206 Ga0495612_0019257 3300053078 Bacteria 2734
207 Ga0495612_0214698 3300053078 Bacteria 851
208 Ga0495595_0004921 3300053084 Bacteria 5388
209 Ga0495619_0010749 3300053085 Bacteria 5760
210 Ga0500616_0043447 3300053153 Bacteria 2401
211 Ga0207644_10423303
212 Ga0070658_10847934
213 Ga0070691_10035857
214 Ga0070668_100409587
215 Ga0070675_100708252
216 Ga0070671_100159319
217 Ga0070703_10004321
218 Ga0070709_10114570
219 Ga0070709_10143613
220 Ga0070714_100335785
221 Ga0070713_100635432
222 Ga0070701_10007900
223 Ga0070705_100000048
224 Ga0070700_100001513
225 Ga0070694_100000506
226 Ga0070708_100765766
227 Ga0070663_100018062
228 Ga0070663_100150528
229 Ga0070662_100104174
230 Ga0070681_10309540
231 Ga0070706_100418037
232 Ga0070707_100358111
233 Ga0070707_100552312
234 Ga0070698_100454281
235 Ga0070698_101374822
236 Ga0070699_100000318
237 Ga0070679_100154323
238 Ga0070679_100322060
239 Ga0070679_101648244
240 Ga0070697_100068434
241 Ga0068853_100281855
242 Ga0070695_100139892
243 Ga0070695_100321694
244 Ga0070696_100036502
245 Ga0070696_100262356
246 Ga0070693_100006416
247 Ga0070704_100130409
248 Ga0068855_100912568
249 Ga0070664_100830946
250 Ga0068857_100033524
251 Ga0068852_100043908
252 Ga0068859_100488588
253 Ga0068859_101174516
254 Ga0068864_100025404
255 Ga0068861_101169171
256 Ga0068870_10661783
257 Ga0068863_100574693
258 Ga0068858_100164525
259 Ga0068860_100002212
260 Ga0068862_100002280
261 Ga0081455_10012863
262 Ga0081455_10020937
263 Ga0081455_10023566
264 Ga0081539_10004846
265 Ga0081539_10015946
266 Ga0075365_10105331
267 Ga0075368_10061467
268 Ga0075363_100233189
269 Ga0070715_10136808
270 Ga0075366_10273585
271 Ga0075370_10157559
272 Ga0075428_100132771
273 Ga0075430_100679677
274 Ga0075434_100035021
275 Ga0075436_100310106
276 Ga0075436_100525483
277 Ga0097620_100488576
278 Ga0075435_100028161
279 Ga0111539_10122957
280 Ga0105245_10687883
281 Ga0105237_10851659
282 Ga0105238_10157800
283 Ga0105238_10227906
284 Ga0105249_10008522
285 Ga0105249_10452535
286 Ga0105239_10175054
287 Ga0157373_10232407
288 Ga0157370_10247845
289 Ga0157369_11440900
290 Ga0182008_10249295
291 Ga0213872_10090985
292 Ga0207653_10002277
293 Ga0207688_10263800
294 Ga0207699_10064694
295 Ga0207695_10973284
296 Ga0207671_10219553
297 Ga0207660_10006217
298 Ga0207662_10191611
299 Ga0207652_10123103
300 Ga0207652_11061479
301 Ga0207646_10277425
302 Ga0207646_10476594
303 Ga0207694_10293426
304 Ga0207694_10782581
305 Ga0207659_10328381
306 Ga0207700_10527446
307 Ga0207679_11626463
308 Ga0207667_10612553
309 Ga0207712_10003887
310 Ga0207678_10011879
311 Ga0207641_10398679
312 Ga0207676_10033734
313 Ga0207674_10003304
314 Ga0207674_10540252
315 Ga0268265_10000834
316 Ga0268264_10002254
317 Ga0268264_10545043
318 Ga0265327_10016417
319 Ga0373923_0041356
320 Ga0373936_0000628
321 Ga0373939_0001690
322 Ga0373931_0294058
323 Ga0373937_0016393
324 Ga0373937_0884155
325 Ga0316582_0190110
326 Ga0316582_0371132
327 Ga0316584_0323933
328 Ga0395900_0037449
329 Ga0395898_0045331
330 Ga0436364_0528734
331 Ga0436365_0998372
332 Ga0436361_1175973
333 Ga0451577_0201471
334 Ga0453683_0021910
335 Ga0466961_0052750
336 Ga0466963_0002142
337 Ga0466963_0035696
338 Ga0466963_0883433
339 Ga0466957_0078022
340 Ga0466958_0180311
341 Ga0466958_0249522
342 Ga0466967_0000841
343 Ga0495592_0003783
344 Ga0495641_0089304
345 Ga0495651_0017194
346 Ga0495653_0029331
347 Ga0495628_0178147
348 Ga0495640_0043343
349 Ga0495645_0170172
350 Ga0495667_0016635
351 Ga0495634_0143007
352 Ga0495588_0108496
353 Ga0495658_0047938
354 Ga0495613_0118192
355 Ga0495600_0003397
356 Ga0495581_0003534
357 Ga0495604_0006489
358 Ga0495684_0005293
359 Ga0495593_0034309
360 Ga0496100_0003697
361 Ga0496101_0002247
362 Ga0496101_0103466
363 Ga0496102_0002762
364 Ga0496102_0010647
365 Ga0496103_0004741
366 Ga0496104_0011923
367 Ga0496105_0021111
368 Ga0496105_0079199
369 Ga0496106_0002637
370 Ga0496106_0083456
371 Ga0496107_0004771
372 Ga0496107_0029901
373 Ga0496108_0001178
374 Ga0496108_0193747
375 Ga0496108_0209609
376 Ga0496109_0004323
377 Ga0496109_0210601
378 Ga0496109_0218277
379 Ga0496109_1537847
380 Ga0496110_0004642
381 Ga0496110_0018362
382 Ga0496111_0004667
383 Ga0496111_0021029
384 Ga0496112_0009204
385 Ga0496112_0178771
386 Ga0496112_0551702
387 Ga0496113_0041916
388 Ga0496113_0206265
389 Ga0496115_0060574
390 Ga0496115_0107309
391 Ga0501033_0172054
392 Ga0501036_0795300
393 Ga0501070_1276603
394 Ga0501073_0049066
395 Ga0501073_0691980
396 Ga0501076_0561810
397 Ga0501044_0665503
398 Ga0501045_0905980
399 nmdc:mga03683_10746_c1
400 nmdc:mga03683_29123_c1
401 nmdc:mga03n38_194695_c1
402 nmdc:mga0yw44_26052_c1
403 nmdc:mga0yw44_35864_c1
404 nmdc:mga0k408_50144_c1
405 nmdc:mga06z11_22803_c1
406 nmdc:mga07m45_1374_c1
407 nmdc:mga09592_324234_c1
408 nmdc:mga09592_387339_c1
409 nmdc:mga0qj67_97013_c1
410 nmdc:mga08y16_369052_c1
411 nmdc:mga0n895_359802_c1
412 nmdc:mga0n895_506643_c1
413 nmdc:mga0rr50_55311_c1
414 nmdc:mga0sz30_440_c1
415 Ga0495601_0087525
416 Ga0495612_0019257
417 Ga0495612_0214698
418 Ga0495595_0004921
419 Ga0495619_0010749
420 Ga0500616_0043447

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01661

Macro

Macro domain

47

159

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fsz-assembly1.cif.gz_A-2 crystal structure of trypanosoma cruzi macrodomain 0.9787 13 179
5fsy-assembly1.cif.gz_A crystal structure of trypanosoma brucei macrodomain in complex with adp-ribose 0.9785 13 177
4iqy-assembly1.cif.gz_A crystal structure of the human protein-proximal adp-ribosyl-hydrolase macrod2 0.9765 13 178
5cb5-assembly10.cif.gz_I structural insights into the mechanism of escherichia coli ymdb 0.9759 13 178
5cb3-assembly1.cif.gz_A structural insights into the mechanism of escherichia coli ymdb 0.975 11 177
ID Description Score Start End Superfamily
af_F6PBM1_89_319_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9786 13 173 3.40.220.10
5cb5C00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9757 13 178 3.40.220.10
5fsxB00 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9744 13 177 3.40.220.10
af_Q4DQ03_1_267_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9717 13 180 3.40.220.10
af_Q3UYG8_4_243_3.40.220.10 Alpha Beta;3-Layer(aba) Sandwich;Leucine Aminopeptidase, subunit E; domain 1;Leucine Aminopeptidase, subunit E, domain 1 0.9706 13 178 3.40.220.10
ID Description Score Start End GO Terms
AF-A0A662AKW8-F1-model_v4 RNase III inhibitor 1.005 18 120 GO:0019213
AF-A0A3C0E9J0-F1-model_v4 RNase III inhibitor 1.004 18 112
AF-A0A357Z310-F1-model_v4 RNase III inhibitor 1.003 18 133 GO:0019213
AF-A0A537CYL7-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.003 18 108 GO:0061463
AF-A0A7X7UT26-F1-model_v4 O-acetyl-ADP-ribose deacetylase 1.002 18 142

Map