F320192

General Info

Members Datasets Scaffolds Average Seq Length
210 149 190 369

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10013271|Ga0075364_100132712
Length 402
Sequence MSHVRIEGLTKHFDGKPPTKAVDDLHLEIEEGEFLVLLGPSGCGKTTTLRCLAGLETPSAGRITFGDTTVFDAKRRVNLSPDKRNIGMVFQSYALWPHMTVRKNIAYPLRARRIKEGRLGGWVEKIAELVDCQNLLDRYPAQLSGGQQQRVALARGLVARPDLVLFDEPLSNLDARLRDQVRAEIHELHANLGFSAVFVTHDQSEALALGDRLAIMKGGKVEQYDTPEHVFEDPASEYVAAFIGMGNRLRCEYVAGRWIAGGQPIDGAPLXKQPLAGPVAARLRSEDLRVAPAGQPLAPDLCHIEASIIDSEYGGKHIDVFVDASGARLHSRIPAGETGSWARRLRKGERVVVSFDPREARLFPDDGDRAAAVPPAAAADAGAGEHAIDSVAADAIPQAAEV

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
3 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
4 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
5 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
6 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
7 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
8 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
9 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
10 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
11 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
12 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
13 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
14 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
15 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
16 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
68 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
71 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
72 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
73 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
77 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
78 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
91 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
109 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
149 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.48
Metatranscriptomes 0
Isolates 9.52

Biome Distribution

Category Percentage (%)
Aerial Root 2.38
Bulb 0
Endosphere 10.95
Nodule 0.95
Rhizoplane 9.52
Rhizosphere 70.48
Stem 0
Stem Tuber 0
Unclassified 5.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100102574 3300005339 Bacteria 2268
2 Ga0070669_100180438 3300005353 Bacteria 1651
3 Ga0070714_100003260 3300005435 Bacteria 12079
4 Ga0070713_100055395 3300005436 Bacteria 3295
5 Ga0070713_100083366 3300005436 Bacteria 2733
6 Ga0070705_100141462 3300005440 Bacteria 1584
7 Ga0070708_100111150 3300005445 Bacteria 2519
8 Ga0070678_100198778 3300005456 Bacteria 1653
9 Ga0070706_100014507 3300005467 Bacteria 7279
10 Ga0070707_100015996 3300005468 Bacteria 7040
11 Ga0070698_100161662 3300005471 Bacteria 2183
12 Ga0070699_100289004 3300005518 Bacteria 1469
13 Ga0068853_100095994 3300005539 Bacteria 2615
14 Ga0068853_100179044 3300005539 Bacteria 1922
15 Ga0070696_100088430 3300005546 Bacteria 2202
16 Ga0068863_100018831 3300005841 Bacteria 6606
17 Ga0068863_100055928 3300005841 Bacteria 3736
18 Ga0081455_10014930 3300005937 Bacteria 7570
19 Ga0081455_10112838 3300005937 Bacteria 2157
20 Ga0081539_10001117 3300005985 Bacteria 48683
21 Ga0075365_10016276 3300006038 Bacteria 4519
22 Ga0075365_10018973 3300006038 Bacteria 4236
23 Ga0075365_10046610 3300006038 Bacteria 2847
24 Ga0075368_10058071 3300006042 Bacteria 1545
25 Ga0075363_100004813 3300006048 Bacteria 5958
26 Ga0075363_100058630 3300006048 Bacteria 2068
27 Ga0075363_100063204 3300006048 Bacteria 1997
28 Ga0075364_10013271 3300006051 Bacteria 5058
29 Ga0075364_10040761 3300006051 Bacteria 3012
30 Ga0075364_10057111 3300006051 Bacteria 2556
31 Ga0070712_100018623 3300006175 Bacteria 4513
32 Ga0075362_10028575 3300006177 Bacteria 2396
33 Ga0075367_10013901 3300006178 Bacteria 4343
34 Ga0075367_10036622 3300006178 Bacteria 2847
35 Ga0075428_100152610 3300006844 Bacteria 2509
36 Ga0075428_100392537 3300006844 Bacteria 1487
37 Ga0075431_100051158 3300006847 Bacteria 4261
38 Ga0075431_100251825 3300006847 Bacteria 1794
39 Ga0075433_10061589 3300006852 Bacteria 3287
40 Ga0075434_100043727 3300006871 Bacteria 4443
41 Ga0075429_100160512 3300006880 Bacteria 1969
42 Ga0075435_100204383 3300007076 Bacteria 1674
43 Ga0105244_10067498 3300009036 Bacteria 1789
44 Ga0114129_10114027 3300009147 Bacteria 3727
45 Ga0114129_10268318 3300009147 Bacteria 2284
46 Ga0105243_10009314 3300009148 Bacteria 7490
47 Ga0105243_10063200 3300009148 Bacteria 2966
48 Ga0105243_10218330 3300009148 Bacteria 1683
49 Ga0105242_10068446 3300009176 Bacteria 2937
50 Ga0105238_10281209 3300009551 Bacteria 1645
51 Ga0157369_10027853 3300013105 Bacteria 6260
52 Ga0163163_10108070 3300014325 Bacteria 2808
53 Ga0207684_10032709 3300025910 Bacteria 4423
54 Ga0207693_10012625 3300025915 Bacteria 6825
55 Ga0207646_10027478 3300025922 Bacteria 5189
56 Ga0207694_10193527 3300025924 Bacteria 1653
57 Ga0207700_10026970 3300025928 Bacteria 4015
58 Ga0207700_10297787 3300025928 Bacteria 1392
59 Ga0207644_10064781 3300025931 Bacteria 2656
60 Ga0207709_10012420 3300025935 Bacteria 4692
61 Ga0207709_10036054 3300025935 Bacteria 2929
62 Ga0207668_10027552 3300025972 Bacteria 3702
63 Ga0207703_10030283 3300026035 Bacteria 4276
64 Ga0207641_10026273 3300026088 Bacteria 4805
65 Ga0207683_10234112 3300026121 Bacteria 1675
66 Ga0209813_10038949 3300027866 Bacteria 1439
67 Ga0207428_10000432 3300027907 Bacteria 51578
68 Ga0268264_10001458 3300028381 Bacteria 22103
69 Ga0307515_10000192 3300028794 Bacteria 149030
70 Ga0265339_10000205 3300031249 Bacteria 48438
71 Ga0307408_100012662 3300031548 Bacteria 5594
72 Ga0307408_100151988 3300031548 Bacteria 1829
73 Ga0265313_10000353 3300031595 Bacteria 50100
74 Ga0307508_10107078 3300031616 Bacteria 2394
75 Ga0265342_10041227 3300031712 Bacteria 2797
76 Ga0307516_10029850 3300031730 Bacteria 5508
77 Ga0307409_100186924 3300031995 Bacteria 1840
78 Ga0307416_100033027 3300032002 Bacteria 3918
79 Ga0373944_0029857 3300035089 Bacteria 1632
80 Ga0373939_0030517 3300035114 Bacteria 1551
81 Ga0373956_0052832 3300035119 Bacteria 1828
82 Ga0373946_0037683 3300035171 Bacteria 1966
83 Ga0373935_0130494 3300035692 Bacteria 1688
84 Ga0373927_0190305 3300035695 Bacteria 1346
85 Ga0373947_0031561 3300035725 Bacteria 3119
86 Ga0373947_0111512 3300035725 Bacteria 1729
87 Ga0373937_0035503 3300036401 Bacteria 4538
88 Ga0373925_0045738 3300037068 Bacteria 3252
89 Ga0395899_0059734 3300037312 Bacteria 2811
90 Ga0395899_0071612 3300037312 Bacteria 2537
91 Ga0395900_0029351 3300037418 Bacteria 5643
92 Ga0395900_0105503 3300037418 Bacteria 2895
93 Ga0395900_0121120 3300037418 Bacteria 2684
94 Ga0395898_0003114 3300037466 Bacteria 18727
95 Ga0395898_0033556 3300037466 Bacteria 5121
96 Ga0395898_0111005 3300037466 Bacteria 2628
97 Ga0395898_0234596 3300037466 Bacteria 1750
98 Ga0395905_0039903 3300037471 Bacteria 4404
99 Ga0395905_0053786 3300037471 Bacteria 3768
100 Ga0395905_0065938 3300037471 Bacteria 3390
101 Ga0395905_0117884 3300037471 Bacteria 2495
102 Ga0395901_0001811 3300038443 Bacteria 22074
103 Ga0395901_0047304 3300038443 Bacteria 4467
104 Ga0395901_0053385 3300038443 Bacteria 4199
105 Ga0395901_0127484 3300038443 Bacteria 2675
106 Ga0395901_0167544 3300038443 Bacteria 2306
107 Ga0466960_0044235 3300044901 Bacteria 2122
108 Ga0495582_0044667 3300046473 Bacteria 2440
109 Ga0495594_0054973 3300046499 Bacteria 2194
110 Ga0495644_0037840 3300046523 Bacteria 1821
111 Ga0495652_0130434 3300046529 Bacteria 1991
112 Ga0495665_0023275 3300046531 Bacteria 3326
113 Ga0495633_0105784 3300046558 Bacteria 1305
114 Ga0495667_0090271 3300046559 Bacteria 1986
115 Ga0495634_0013738 3300046642 Bacteria 5848
116 Ga0495634_0194249 3300046642 Bacteria 1264
117 Ga0495581_0007086 3300047315 Bacteria 6492
118 Ga0495672_0105528 3300047320 Bacteria 1520
119 Ga0495676_0077242 3300047321 Bacteria 2539
120 Ga0495684_0003478 3300047471 Bacteria 12323
121 Ga0496100_0006825 3300048903 Bacteria 6255
122 Ga0496100_0056227 3300048903 Bacteria 2573
123 Ga0496101_0002686 3300048904 Bacteria 10916
124 Ga0496101_0006356 3300048904 Bacteria 7606
125 Ga0496102_0003573 3300048905 Bacteria 13173
126 Ga0496102_0320051 3300048905 Bacteria 1461
127 Ga0496104_0003343 3300048907 Bacteria 13847
128 Ga0496104_0022016 3300048907 Bacteria 5856
129 Ga0496105_0007024 3300048908 Bacteria 8674
130 Ga0496105_0109435 3300048908 Bacteria 2281
131 Ga0496106_0003000 3300048909 Bacteria 12570
132 Ga0496106_0004075 3300048909 Bacteria 10897
133 Ga0496107_0004146 3300048910 Bacteria 9775
134 Ga0496108_0052994 3300048911 Bacteria 3401
135 Ga0496109_0025102 3300048912 Bacteria 5307
136 Ga0496110_0250451 3300048913 Bacteria 1612
137 Ga0496114_0007755 3300048917 Bacteria 8493
138 Ga0496114_0046850 3300048917 Bacteria 3593
139 Ga0496115_0068898 3300048918 Bacteria 2865
140 Ga0496115_0136016 3300048918 Bacteria 2026
141 Ga0496121_0007507 3300048924 Bacteria 13155
142 Ga0496122_0028519 3300048925 Bacteria 4733
143 Ga0496123_0023850 3300048926 Bacteria 4671
144 Ga0501033_0239018 3300049570 Bacteria 1289
145 Ga0501036_0141348 3300049572 Bacteria 2031
146 Ga0501038_0177281 3300049574 Bacteria 1722
147 Ga0501040_0044687 3300049576 Bacteria 3021
148 Ga0501042_0134537 3300049578 Bacteria 1782
149 Ga0501048_0077313 3300049582 Bacteria 2349
150 Ga0501048_0167916 3300049582 Bacteria 1554
151 Ga0501072_0019671 3300049588 Bacteria 5223
152 Ga0501074_0148838 3300049590 Bacteria 1674
153 Ga0501075_0074029 3300049591 Bacteria 2576
154 Ga0501076_0005092 3300049592 Bacteria 9407
155 Ga0501076_0043864 3300049592 Bacteria 3526
156 Ga0501076_0200385 3300049592 Bacteria 1630
157 Ga0501077_0006216 3300049593 Bacteria 7298
158 Ga0501077_0008390 3300049593 Bacteria 6396
159 Ga0501079_0016890 3300049741 Bacteria 5574
160 Ga0501079_0141928 3300049741 Bacteria 1871
161 Ga0501081_0007243 3300049743 Bacteria 7210
162 Ga0501081_0008561 3300049743 Bacteria 6647
163 Ga0501081_0107752 3300049743 Bacteria 1976
164 nmdc:mga03n38_51498_c1 3300050490 Bacteria 1839
165 nmdc:mga03n38_91219_c1 3300050490 Bacteria 1451
166 nmdc:mga00v17_2738_c1 3300050491 Bacteria 9049
167 nmdc:mga0yw44_121368_c1 3300050492 Bacteria 1684
168 nmdc:mga0yw44_25920_c1 3300050492 Bacteria 3342
169 nmdc:mga0yw44_39963_c1 3300050492 Bacteria 2784
170 nmdc:mga0yw44_6613_c1 3300050492 Bacteria 5618
171 nmdc:mga0k408_163364_c1 3300050493 Bacteria 1327
172 nmdc:mga06z11_38974_c1 3300050494 Bacteria 2363
173 nmdc:mga05p37_166250_c1 3300050507 Bacteria 2692
174 nmdc:mga05p37_255599_c1 3300050507 Bacteria 2099
175 nmdc:mga05p37_31044_c1 3300050507 Bacteria 6524
176 nmdc:mga09592_44479_c1 3300050508 Bacteria 3738
177 nmdc:mga08y16_216_c1 3300050511 Bacteria 51710
178 nmdc:mga0n895_35270_c1 3300050512 Bacteria 4821
179 nmdc:mga0n895_413064_c1 3300050512 Bacteria 1364
180 nmdc:mga0n895_436838_c1 3300050512 Bacteria 1322
181 nmdc:mga0n895_4502_c1 3300050512 Bacteria 11463
182 nmdc:mga0rr50_186110_c1 3300050513 Bacteria 1700
183 nmdc:mga0a205_68210_c1 3300050515 Bacteria 3435
184 Ga0495601_0114972 3300053077 Bacteria 1745
185 Ga0495595_0031037 3300053084 Bacteria 2400
186 Ga0501084_0002290 3300054114 Bacteria 15379
187 Ga0501084_0007140 3300054114 Bacteria 9200
188 Ga0590071_015240 3300059421 Bacteria 1804
189 Ga0501082_0013257 3300060353 Bacteria 7089
190 Ga0530510_0004544 3300061734 Bacteria 9605

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046499 Ga0495594_0054973 Ga0495594_0054973_11_925 303
2 3300035692 Ga0373935_0130494 Ga0373935_0130494_10_930 306
3 3300061734 Ga0530510_0004544 Ga0530510_0004544_6902_7834 308
4 3300005985 Ga0081539_10001117 Ga0081539_1000111721 333
5 3300046531 Ga0495665_0023275 Ga0495665_0023275_1720_2886 333
6 3300047315 Ga0495581_0007086 Ga0495581_0007086_860_2026 333
7 iso_pu_bacteria 8055034563 8055037752 333
8 3300048908 Ga0496105_0109435 Ga0496105_0109435_1112_2122 336
9 3300009036 Ga0105244_10067498 Ga0105244_100674982 338
10 3300009148 Ga0105243_10009314 Ga0105243_100093144 338
11 3300025935 Ga0207709_10012420 Ga0207709_100124203 338
12 iso_pu_bacteria 2885305155 2885309094 338
13 3300006048 Ga0075363_100063204 Ga0075363_1000632042 341
14 3300031548 Ga0307408_100151988 Ga0307408_1001519881 341
15 3300031995 Ga0307409_100186924 Ga0307409_1001869242 341
16 3300006048 Ga0075363_100004813 Ga0075363_1000048132 342
17 3300006178 Ga0075367_10036622 Ga0075367_100366222 342
18 3300006038 Ga0075365_10016276 Ga0075365_100162763 343
19 3300006051 Ga0075364_10040761 Ga0075364_100407612 343
20 3300006177 Ga0075362_10028575 Ga0075362_100285751 343
21 3300037312 Ga0395899_0071612 Ga0395899_0071612_330_1442 343
22 3300037418 Ga0395900_0121120 Ga0395900_0121120_557_1669 343
23 3300037466 Ga0395898_0111005 Ga0395898_0111005_1336_2448 343
24 3300050492 nmdc:mga0yw44_6613_c1 nmdc:mga0yw44_6613_c1_493_1698 343
25 3300006844 Ga0075428_100152610 Ga0075428_1001526102 344
26 3300027907 Ga0207428_10000432 Ga0207428_1000043210 344
27 3300050507 nmdc:mga05p37_255599_c1 nmdc:mga05p37_255599_c1_382_1422 344
28 3300050511 nmdc:mga08y16_216_c1 nmdc:mga08y16_216_c1_12282_13322 344
29 iso_pu_bacteria 2622736605 2623498267 344
30 iso_pu_bacteria 2932398195 2932399560 344
31 3300049576 Ga0501040_0044687 Ga0501040_0044687_1605_2681 346
32 3300049582 Ga0501048_0167916 Ga0501048_0167916_222_1298 346
33 3300049741 Ga0501079_0141928 Ga0501079_0141928_579_1655 346
34 3300048913 Ga0496110_0250451 Ga0496110_0250451_485_1591 347
35 3300044901 Ga0466960_0044235 Ga0466960_0044235_145_1353 348
36 3300048925 Ga0496122_0028519 Ga0496122_0028519_639_1772 348
37 3300048926 Ga0496123_0023850 Ga0496123_0023850_398_1531 348
38 3300005435 Ga0070714_100003260 Ga0070714_1000032603 349
39 3300005436 Ga0070713_100055395 Ga0070713_1000553953 349
40 3300025928 Ga0207700_10026970 Ga0207700_100269705 349
41 3300037471 Ga0395905_0065938 Ga0395905_0065938_242_1369 349
42 iso_pu_bacteria 2984576629 2984578594 349
43 iso_pu_bacteria 2990256926 2990259401 349
44 3300005353 Ga0070669_100180438 Ga0070669_1001804382 350
45 3300005539 Ga0068853_100179044 Ga0068853_1001790442 350
46 3300005841 Ga0068863_100055928 Ga0068863_1000559282 350
47 3300009551 Ga0105238_10281209 Ga0105238_102812092 350
48 3300013105 Ga0157369_10027853 Ga0157369_100278534 350
49 3300014325 Ga0163163_10108070 Ga0163163_101080702 350
50 3300025924 Ga0207694_10193527 Ga0207694_101935271 350
51 3300025972 Ga0207668_10027552 Ga0207668_100275524 350
52 3300026035 Ga0207703_10030283 Ga0207703_100302835 350
53 3300026088 Ga0207641_10026273 Ga0207641_100262733 350
54 3300028794 Ga0307515_10000192 Ga0307515_1000019263 350
55 3300031616 Ga0307508_10107078 Ga0307508_101070782 350
56 3300031730 Ga0307516_10029850 Ga0307516_100298503 350
57 3300035114 Ga0373939_0030517 Ga0373939_0030517_300_1433 350
58 iso_pu_bacteria 2738541308 2738892938 350
59 iso_pu_bacteria 2751185725 2753037020 350
60 iso_pu_bacteria 2751185792 2753324889 350
61 iso_pu_bacteria 2904765812 2904766969 350
62 iso_pu_bacteria 2904770941 2904775020 350
63 iso_pu_bacteria 2919420072 2919420596 350
64 iso_pu_bacteria 2919432681 2919433646 350
65 iso_pu_bacteria 2974315732 2974318913 350
66 iso_pu_bacteria 2984523437 2984527186 350
67 3300005456 Ga0070678_100198778 Ga0070678_1001987781 351
68 3300006852 Ga0075433_10061589 Ga0075433_100615892 351
69 3300009148 Ga0105243_10063200 Ga0105243_100632002 351
70 3300009176 Ga0105242_10068446 Ga0105242_100684462 351
71 3300025931 Ga0207644_10064781 Ga0207644_100647812 351
72 3300025935 Ga0207709_10036054 Ga0207709_100360542 351
73 3300026121 Ga0207683_10234112 Ga0207683_102341122 351
74 3300032002 Ga0307416_100033027 Ga0307416_1000330273 351
75 3300035119 Ga0373956_0052832 Ga0373956_0052832_473_1630 351
76 3300036401 Ga0373937_0035503 Ga0373937_0035503_2080_3237 351
77 3300037418 Ga0395900_0029351 Ga0395900_0029351_200_1387 351
78 3300037418 Ga0395900_0105503 Ga0395900_0105503_267_1415 351
79 3300037466 Ga0395898_0003114 Ga0395898_0003114_7758_8945 351
80 3300037466 Ga0395898_0234596 Ga0395898_0234596_26_1171 351
81 3300037471 Ga0395905_0039903 Ga0395905_0039903_1728_2915 351
82 3300037471 Ga0395905_0053786 Ga0395905_0053786_1008_2153 351
83 3300038443 Ga0395901_0001811 Ga0395901_0001811_8419_9606 351
84 3300038443 Ga0395901_0047304 Ga0395901_0047304_1215_2360 351
85 3300038443 Ga0395901_0127484 Ga0395901_0127484_1355_2512 351
86 3300038443 Ga0395901_0167544 Ga0395901_0167544_485_1633 351
87 3300046529 Ga0495652_0130434 Ga0495652_0130434_294_1451 351
88 3300046642 Ga0495634_0013738 Ga0495634_0013738_2742_3899 351
89 3300047471 Ga0495684_0003478 Ga0495684_0003478_6973_8130 351
90 3300048903 Ga0496100_0006825 Ga0496100_0006825_2942_4087 351
91 3300048903 Ga0496100_0056227 Ga0496100_0056227_99_1244 351
92 3300048904 Ga0496101_0002686 Ga0496101_0002686_6332_7477 351
93 3300048904 Ga0496101_0006356 Ga0496101_0006356_3343_4488 351
94 3300048905 Ga0496102_0003573 Ga0496102_0003573_4659_5804 351
95 3300048909 Ga0496106_0003000 Ga0496106_0003000_7596_8741 351
96 3300048909 Ga0496106_0004075 Ga0496106_0004075_6371_7516 351
97 3300048910 Ga0496107_0004146 Ga0496107_0004146_2329_3474 351
98 3300048917 Ga0496114_0007755 Ga0496114_0007755_4824_5969 351
99 3300050512 nmdc:mga0n895_4502_c1 nmdc:mga0n895_4502_c1_3685_4830 351
100 3300050515 nmdc:mga0a205_68210_c1 nmdc:mga0a205_68210_c1_270_1415 351
101 3300053077 Ga0495601_0114972 Ga0495601_0114972_531_1706 351
102 3300053084 Ga0495595_0031037 Ga0495595_0031037_1151_2308 351
103 iso_pu_bacteria 2811994878 2812351693 351
104 iso_pu_bacteria 2891968417 2891970677 351
105 iso_pu_bacteria 2984576629 2984578624 351
106 iso_pu_bacteria 2990256926 2990259430 351
107 iso_pu_bacteria 8008558824 8008560077 351
108 3300005445 Ga0070708_100111150 Ga0070708_1001111502 352
109 3300005467 Ga0070706_100014507 Ga0070706_1000145074 352
110 3300005539 Ga0068853_100095994 Ga0068853_1000959942 352
111 3300006038 Ga0075365_10046610 Ga0075365_100466102 352
112 3300006871 Ga0075434_100043727 Ga0075434_1000437272 352
113 3300007076 Ga0075435_100204383 Ga0075435_1002043832 352
114 3300025910 Ga0207684_10032709 Ga0207684_100327093 352
115 3300035725 Ga0373947_0111512 Ga0373947_0111512_601_1659 352
116 3300046642 Ga0495634_0194249 Ga0495634_0194249_192_1250 352
117 3300050512 nmdc:mga0n895_35270_c1 nmdc:mga0n895_35270_c1_2747_3805 352
118 3300050513 nmdc:mga0rr50_186110_c1 nmdc:mga0rr50_186110_c1_485_1549 352
119 3300009147 Ga0114129_10268318 Ga0114129_102683182 353
120 3300049592 Ga0501076_0200385 Ga0501076_0200385_371_1444 353
121 3300050512 nmdc:mga0n895_436838_c1 nmdc:mga0n895_436838_c1_87_1148 353
122 3300005471 Ga0070698_100161662 Ga0070698_1001616621 354
123 3300025928 Ga0207700_10297787 Ga0207700_102977871 354
124 3300031249 Ga0265339_10000205 Ga0265339_1000020519 354
125 3300031595 Ga0265313_10000353 Ga0265313_1000035319 354
126 3300031712 Ga0265342_10041227 Ga0265342_100412272 354
127 3300048924 Ga0496121_0007507 Ga0496121_0007507_3926_5023 354
128 3300050493 nmdc:mga0k408_163364_c1 nmdc:mga0k408_163364_c1_184_1248 354
129 3300050512 nmdc:mga0n895_413064_c1 nmdc:mga0n895_413064_c1_286_1350 354
130 3300005468 Ga0070707_100015996 Ga0070707_1000159967 355
131 3300005518 Ga0070699_100289004 Ga0070699_1002890042 355
132 3300005841 Ga0068863_100018831 Ga0068863_1000188316 355
133 3300006051 Ga0075364_10013271 Ga0075364_100132712 355
134 3300006175 Ga0070712_100018623 Ga0070712_1000186234 355
135 3300009148 Ga0105243_10218330 Ga0105243_102183302 355
136 3300025915 Ga0207693_10012625 Ga0207693_100126255 355
137 3300025922 Ga0207646_10027478 Ga0207646_100274784 355
138 3300028381 Ga0268264_10001458 Ga0268264_100014587 355
139 3300031548 Ga0307408_100012662 Ga0307408_1000126622 355
140 3300048911 Ga0496108_0052994 Ga0496108_0052994_80_1279 355
141 3300049572 Ga0501036_0141348 Ga0501036_0141348_874_1950 355
142 3300049574 Ga0501038_0177281 Ga0501038_0177281_382_1458 355
143 3300049578 Ga0501042_0134537 Ga0501042_0134537_677_1753 355
144 3300049582 Ga0501048_0077313 Ga0501048_0077313_307_1383 355
145 3300049590 Ga0501074_0148838 Ga0501074_0148838_458_1534 355
146 3300049591 Ga0501075_0074029 Ga0501075_0074029_873_1949 355
147 3300049592 Ga0501076_0005092 Ga0501076_0005092_6012_7088 355
148 3300049593 Ga0501077_0008390 Ga0501077_0008390_5225_6301 355
149 3300049743 Ga0501081_0008561 Ga0501081_0008561_5545_6621 355
150 3300049743 Ga0501081_0107752 Ga0501081_0107752_15_1091 355
151 3300050490 nmdc:mga03n38_51498_c1 nmdc:mga03n38_51498_c1_491_1699 355
152 3300050491 nmdc:mga00v17_2738_c1 nmdc:mga00v17_2738_c1_1305_2513 355
153 3300050492 nmdc:mga0yw44_39963_c1 nmdc:mga0yw44_39963_c1_232_1440 355
154 3300054114 Ga0501084_0007140 Ga0501084_0007140_7211_8287 355
155 3300059421 Ga0590071_015240 Ga0590071_015240_519_1595 355
156 3300060353 Ga0501082_0013257 Ga0501082_0013257_4661_5737 355
157 3300005440 Ga0070705_100141462 Ga0070705_1001414622 356
158 3300005546 Ga0070696_100088430 Ga0070696_1000884303 356
159 3300006844 Ga0075428_100392537 Ga0075428_1003925372 356
160 3300006847 Ga0075431_100051158 Ga0075431_1000511582 356
161 3300006880 Ga0075429_100160512 Ga0075429_1001605122 356
162 3300009147 Ga0114129_10114027 Ga0114129_101140272 356
163 3300037312 Ga0395899_0059734 Ga0395899_0059734_1602_2762 356
164 3300037466 Ga0395898_0033556 Ga0395898_0033556_2540_3700 356
165 3300037471 Ga0395905_0117884 Ga0395905_0117884_319_1479 356
166 3300038443 Ga0395901_0053385 Ga0395901_0053385_1867_3027 356
167 3300046523 Ga0495644_0037840 Ga0495644_0037840_516_1592 356
168 3300048907 Ga0496104_0003343 Ga0496104_0003343_4596_5666 356
169 3300048908 Ga0496105_0007024 Ga0496105_0007024_2991_4061 356
170 3300048912 Ga0496109_0025102 Ga0496109_0025102_3163_4233 356
171 3300048917 Ga0496114_0046850 Ga0496114_0046850_782_1948 356
172 3300048918 Ga0496115_0068898 Ga0496115_0068898_171_1241 356
173 3300050507 nmdc:mga05p37_166250_c1 nmdc:mga05p37_166250_c1_585_1664 356
174 3300050507 nmdc:mga05p37_31044_c1 nmdc:mga05p37_31044_c1_2306_3382 356
175 3300050508 nmdc:mga09592_44479_c1 nmdc:mga09592_44479_c1_141_1217 356
176 3300005937 Ga0081455_10014930 Ga0081455_100149302 357
177 3300048907 Ga0496104_0022016 Ga0496104_0022016_4392_5465 357
178 3300048918 Ga0496115_0136016 Ga0496115_0136016_574_1647 357
179 3300049570 Ga0501033_0239018 Ga0501033_0239018_56_1141 358
180 3300049588 Ga0501072_0019671 Ga0501072_0019671_943_2028 358
181 3300049592 Ga0501076_0043864 Ga0501076_0043864_1524_2609 358
182 3300049593 Ga0501077_0006216 Ga0501077_0006216_2594_3679 358
183 3300049741 Ga0501079_0016890 Ga0501079_0016890_372_1457 358
184 3300049743 Ga0501081_0007243 Ga0501081_0007243_1538_2623 358
185 3300054114 Ga0501084_0002290 Ga0501084_0002290_14152_15237 358
186 3300005937 Ga0081455_10112838 Ga0081455_101128382 359
187 3300006038 Ga0075365_10018973 Ga0075365_100189732 359
188 3300006042 Ga0075368_10058071 Ga0075368_100580712 359
189 3300006048 Ga0075363_100058630 Ga0075363_1000586302 359
190 3300006051 Ga0075364_10057111 Ga0075364_100571112 359
191 3300006847 Ga0075431_100251825 Ga0075431_1002518251 359
192 3300027866 Ga0209813_10038949 Ga0209813_100389492 359
193 3300048905 Ga0496102_0320051 Ga0496102_0320051_200_1279 359
194 3300050490 nmdc:mga03n38_91219_c1 nmdc:mga03n38_91219_c1_185_1264 359
195 3300050492 nmdc:mga0yw44_121368_c1 nmdc:mga0yw44_121368_c1_245_1324 359
196 3300050492 nmdc:mga0yw44_25920_c1 nmdc:mga0yw44_25920_c1_265_1356 359
197 3300050494 nmdc:mga06z11_38974_c1 nmdc:mga06z11_38974_c1_321_1400 359
198 3300035089 Ga0373944_0029857 Ga0373944_0029857_440_1531 362
199 3300035171 Ga0373946_0037683 Ga0373946_0037683_418_1509 362
200 3300035695 Ga0373927_0190305 Ga0373927_0190305_174_1265 362
201 3300035725 Ga0373947_0031561 Ga0373947_0031561_1109_2200 362
202 3300037068 Ga0373925_0045738 Ga0373925_0045738_1949_3040 362
203 3300046473 Ga0495582_0044667 Ga0495582_0044667_410_1501 362
204 3300046558 Ga0495633_0105784 Ga0495633_0105784_68_1162 362
205 3300047321 Ga0495676_0077242 Ga0495676_0077242_1080_2171 362
206 3300005339 Ga0070660_100102574 Ga0070660_1001025742 364
207 3300005436 Ga0070713_100083366 Ga0070713_1000833662 364
208 3300006178 Ga0075367_10013901 Ga0075367_100139013 364
209 3300046559 Ga0495667_0090271 Ga0495667_0090271_369_1463 364
210 3300047320 Ga0495672_0105528 Ga0495672_0105528_11_1120 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

22

171

0.93

PF08402

TOBE_2

TOBE domain

281

363

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.951 3 234
7ahe-assembly1.cif.gz_C opua inhibited inward facing 0.9431 3 234
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.9406 1 224
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9396 4 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9354 1 218
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9732 1 218 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9688 1 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9687 2 217 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9661 4 236 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.963 4 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382ZAC4-F1-model_v4 ABC transporter domain-containing protein 0.986 2 211 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.983 1 200 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9815 49 192 GO:0005524
GO:0016887
GO:0055052
AF-A0A848WQ45-F1-model_v4 ABC transporter ATP-binding protein 0.9814 2 236 GO:0005524
GO:0016887
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9782 1 200 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359

Feature Viewer

pLDDT pTM Quality
90.01 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map