F319991

General Info

Members Datasets Scaffolds Average Seq Length
210 144 203 319

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100069292|Ga0070668_1000692923
Length 329
Sequence MADKEERDGVPLSNLDQELFDGAEATKRDLIDYLDAVSGRILPVLRDRPLSVIRLLRGQDAFMQKNLPKYTPDWVPRAQVWAEASHRNVSYALCNDRRTLIWFGNQRAIEYHPALMHAGDHHPTHLIMDLDPPEGGGFGSVVAAARLIERVLDDIGMAGAVKTSGSKGVHVFVPLDGKSEPEDVAAATRAVAARAERLDPALATTAFIREDRHGKVFLDATRSGGATVVAAYSPRIRPGMRVSFPLAWSQLGDVTPEDFTIRTAPGLLSDRDPWAEGMPGPQALDPGLVEEGHTIPVARVQAMHEGKRRARARRASEQVAPEGDAGADG

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
3 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
4 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
5 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
6 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
73 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
74 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
75 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
76 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
77 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
78 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
82 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
85 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
86 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
123 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
133 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
136 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
137 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
138 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
139 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
144 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.67
Metatranscriptomes 0
Isolates 3.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.33
Nodule 0
Rhizoplane 4.76
Rhizosphere 84.29
Stem 0
Stem Tuber 0
Unclassified 7.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10073095 3300003320 Bacteria 3070
2 JGI25407J50210_10000727 3300003373 Bacteria 6894
3 JGI25407J50210_10014375 3300003373 Bacteria 2040
4 Ga0070658_10063945 3300005327 Bacteria 3001
5 Ga0070660_100165073 3300005339 Bacteria 1786
6 Ga0070661_100177704 3300005344 Bacteria 1619
7 Ga0070668_100000269 3300005347 Bacteria 34268
8 Ga0070668_100001303 3300005347 Bacteria 17835
9 Ga0070668_100069292 3300005347 Bacteria 2743
10 Ga0070709_10018483 3300005434 Bacteria 4015
11 Ga0070714_100576914 3300005435 Bacteria 1079
12 Ga0070713_100083888 3300005436 Bacteria 2725
13 Ga0070663_100013594 3300005455 Bacteria 5195
14 Ga0070679_100144781 3300005530 Bacteria 2354
15 Ga0070684_100017617 3300005535 Bacteria 5868
16 Ga0068857_100476960 3300005577 Bacteria 1169
17 Ga0068854_100181762 3300005578 Bacteria 1643
18 Ga0068859_100216267 3300005617 Bacteria 2004
19 Ga0068858_100214587 3300005842 Bacteria 1821
20 Ga0068860_100009329 3300005843 Bacteria 9748
21 Ga0081538_10000418 3300005981 Bacteria 47791
22 Ga0081538_10005762 3300005981 Bacteria 11058
23 Ga0081539_10000495 3300005985 Bacteria 82397
24 Ga0081539_10000889 3300005985 Bacteria 57153
25 Ga0081539_10009605 3300005985 Bacteria 8035
26 Ga0075364_10021893 3300006051 Bacteria 4031
27 Ga0075367_10046849 3300006178 Bacteria 2542
28 Ga0075370_10114124 3300006353 Bacteria 1570
29 Ga0075428_100041865 3300006844 Bacteria 5036
30 Ga0075428_100086195 3300006844 Bacteria 3425
31 Ga0075428_100240347 3300006844 Bacteria 1954
32 Ga0075430_100008332 3300006846 Bacteria 8754
33 Ga0075430_100011459 3300006846 Bacteria 7530
34 Ga0075430_100134321 3300006846 Bacteria 2062
35 Ga0075431_100000341 3300006847 Bacteria 36704
36 Ga0075431_100086278 3300006847 Bacteria 3239
37 Ga0075431_100120552 3300006847 Bacteria 2706
38 Ga0075431_100212562 3300006847 Bacteria 1975
39 Ga0075431_100346090 3300006847 Bacteria 1495
40 Ga0075429_100011543 3300006880 Bacteria 7662
41 Ga0075429_100114655 3300006880 Bacteria 2356
42 Ga0075429_100125481 3300006880 Bacteria 2244
43 Ga0075429_100302802 3300006880 Bacteria 1399
44 Ga0075436_100013397 3300006914 Bacteria 5616
45 Ga0097620_100216280 3300006931 Bacteria 2004
46 Ga0075435_100010514 3300007076 Bacteria 6769
47 Ga0075435_100228981 3300007076 Bacteria 1579
48 Ga0075435_100235268 3300007076 Bacteria 1557
49 Ga0105240_10027425 3300009093 Bacteria 7454
50 Ga0111539_10161272 3300009094 Bacteria 2622
51 Ga0114129_10000128 3300009147 Bacteria 77291
52 Ga0114129_10039180 3300009147 Bacteria 6682
53 Ga0114129_10306558 3300009147 Bacteria 2115
54 Ga0105242_10018073 3300009176 Bacteria 5506
55 Ga0105237_10012796 3300009545 Bacteria 8824
56 Ga0105239_10080093 3300010375 Bacteria 3593
57 Ga0105239_10133304 3300010375 Bacteria 2764
58 Ga0105239_10396377 3300010375 Bacteria 1562
59 Ga0105246_10481006 3300011119 Bacteria 1050
60 Ga0157378_10119419 3300013297 Bacteria 2428
61 Ga0157378_10162733 3300013297 Bacteria 2088
62 Ga0157379_10050582 3300014968 Bacteria 3710
63 Ga0213876_10042146 3300021384 Bacteria 2412
64 Ga0207699_10199100 3300025906 Bacteria 1356
65 Ga0207693_10043711 3300025915 Bacteria 3523
66 Ga0207649_10050863 3300025920 Bacteria 2564
67 Ga0207646_10087057 3300025922 Bacteria 2795
68 Ga0207689_10273334 3300025942 Bacteria 1399
69 Ga0207661_10169727 3300025944 Bacteria 1898
70 Ga0207667_10246270 3300025949 Bacteria 1829
71 Ga0207667_10356507 3300025949 Bacteria 1491
72 Ga0207668_10046199 3300025972 Bacteria 2974
73 Ga0207668_10208192 3300025972 Bacteria 1562
74 Ga0207668_10214450 3300025972 Bacteria 1541
75 Ga0207703_10121121 3300026035 Bacteria 2246
76 Ga0207678_10000283 3300026067 Bacteria 46141
77 Ga0207676_10269372 3300026095 Bacteria 1542
78 Ga0268265_10022040 3300028380 Bacteria 4472
79 Ga0268264_10035744 3300028381 Bacteria 4090
80 Ga0307515_10000478 3300028794 Bacteria 95304
81 Ga0307512_10102536 3300030522 Bacteria 1930
82 Ga0307513_10104197 3300031456 Bacteria 2851
83 Ga0307509_10021453 3300031507 Bacteria 7300
84 Ga0307509_10027376 3300031507 Bacteria 6343
85 Ga0307408_100005542 3300031548 Bacteria 8435
86 Ga0307516_10002715 3300031730 Bacteria 23320
87 Ga0307516_10327948 3300031730 Bacteria 1200
88 Ga0307405_10081614 3300031731 Bacteria 2114
89 Ga0307413_10147600 3300031824 Bacteria 1634
90 Ga0307413_10214703 3300031824 Bacteria 1400
91 Ga0307410_10000105 3300031852 Bacteria 29319
92 Ga0307410_10283903 3300031852 Bacteria 1300
93 Ga0307406_10000492 3300031901 Bacteria 22708
94 Ga0307407_10029912 3300031903 Bacteria 2931
95 Ga0307409_100000004 3300031995 Bacteria 84332
96 Ga0307409_100044022 3300031995 Bacteria 3358
97 Ga0307416_100000085 3300032002 Bacteria 64569
98 Ga0307416_100308866 3300032002 Bacteria 1577
99 Ga0307415_100031817 3300032126 Bacteria 3404
100 Ga0307415_100113107 3300032126 Bacteria 2018
101 Ga0307415_100198342 3300032126 Bacteria 1590
102 Ga0307507_10034727 3300033179 Bacteria 5200
103 Ga0373940_0003283 3300035088 Bacteria 3281
104 Ga0373939_0064669 3300035114 Bacteria 1175
105 Ga0373954_0095563 3300035118 Bacteria 1431
106 Ga0373942_0000586 3300035207 Bacteria 10268
107 Ga0373962_0004174 3300035242 Bacteria 3481
108 Ga0373947_0043199 3300035725 Bacteria 2692
109 Ga0436365_1518405 3300039437 Bacteria 6513
110 Ga0436362_0881270 3300039453 Bacteria 5115
111 Ga0451853_0617112 3300041512 Bacteria 5346
112 Ga0439448_0025736 3300042005 Bacteria 1847
113 Ga0439463_007305 3300042016 Bacteria 2729
114 Ga0439460_0004757 3300042461 Bacteria 3312
115 Ga0439440_0000875 3300042993 Bacteria 5256
116 Ga0466972_0011045 3300044658 Bacteria 4533
117 Ga0466960_0130667 3300044901 Bacteria 1325
118 Ga0495594_0005660 3300046499 Bacteria 6427
119 Ga0495628_0207146 3300046516 Bacteria 1476
120 Ga0495630_0024716 3300046517 Bacteria 4440
121 Ga0495630_0241192 3300046517 Bacteria 1381
122 Ga0495634_0013156 3300046642 Bacteria 5978
123 Ga0495613_0000128 3300046689 Bacteria 74734
124 Ga0495613_0054525 3300046689 Bacteria 2939
125 Ga0495680_0118764 3300047322 Bacteria 1954
126 Ga0496101_0078094 3300048904 Bacteria 2441
127 Ga0496102_0032340 3300048905 Bacteria 4699
128 Ga0496103_0081896 3300048906 Bacteria 2031
129 Ga0496105_0005312 3300048908 Bacteria 9765
130 Ga0496105_0041217 3300048908 Bacteria 3805
131 Ga0496108_0000036 3300048911 Bacteria 152347
132 Ga0496109_0493759 3300048912 Bacteria 1155
133 Ga0496110_0615294 3300048913 Bacteria 985
134 Ga0496114_0027901 3300048917 Bacteria 4628
135 Ga0496115_0068680 3300048918 Bacteria 2869
136 Ga0501033_0001571 3300049570 Bacteria 20140
137 Ga0501036_0001907 3300049572 Bacteria 16235
138 Ga0501038_0102314 3300049574 Bacteria 2384
139 Ga0501039_0026351 3300049575 Bacteria 4467
140 Ga0501040_0059248 3300049576 Bacteria 2630
141 Ga0501040_0263138 3300049576 Bacteria 1231
142 Ga0501042_0006699 3300049578 Bacteria 7506
143 Ga0501046_0004368 3300049580 Bacteria 12853
144 Ga0501048_0006025 3300049582 Bacteria 9232
145 Ga0501067_0058917 3300049583 Bacteria 2126
146 Ga0501068_0002110 3300049584 Bacteria 10605
147 Ga0501070_0001888 3300049586 Bacteria 18534
148 Ga0501070_0340787 3300049586 Bacteria 1218
149 Ga0501071_0057673 3300049587 Bacteria 2807
150 Ga0501072_0020321 3300049588 Bacteria 5144
151 Ga0501072_0139366 3300049588 Bacteria 1934
152 Ga0501072_0188042 3300049588 Bacteria 1647
153 Ga0501073_0002620 3300049589 Bacteria 13474
154 Ga0501074_0066363 3300049590 Bacteria 2596
155 Ga0501074_0127929 3300049590 Bacteria 1818
156 Ga0501075_0030429 3300049591 Bacteria 3999
157 Ga0501075_0072318 3300049591 Bacteria 2607
158 Ga0501076_0004318 3300049592 Bacteria 10084
159 Ga0501076_0054359 3300049592 Bacteria 3173
160 Ga0501079_0000619 3300049741 Bacteria 23573
161 Ga0501079_0009960 3300049741 Bacteria 7216
162 Ga0501081_0146087 3300049743 Bacteria 1697
163 Ga0501083_0000589 3300049744 Bacteria 23299
164 Ga0501045_0002688 3300049824 Bacteria 12129
165 Ga0501045_0108586 3300049824 Bacteria 2057
166 nmdc:mga00v17_12375_c1 3300050491 Bacteria 4707
167 nmdc:mga0yw44_239927_c1 3300050492 Bacteria 1204
168 nmdc:mga06z11_20091_c1 3300050494 Bacteria 3082
169 nmdc:mga07m45_166468_c1 3300050496 Bacteria 1280
170 nmdc:mga05p37_297198_c1 3300050507 Bacteria 1920
171 nmdc:mga05p37_34295_c1 3300050507 Bacteria 6216
172 nmdc:mga05p37_38351_c1 3300050507 Bacteria 5877
173 nmdc:mga09592_1187_c1 3300050508 Bacteria 12233
174 nmdc:mga09592_29372_c1 3300050508 Bacteria 4573
175 nmdc:mga09592_4842_c1 3300050508 Bacteria 10901
176 nmdc:mga0qj67_338632_c1 3300050509 Bacteria 1217
177 nmdc:mga0qj67_54048_c1 3300050509 Bacteria 3180
178 nmdc:mga0qj67_77433_c1 3300050509 Bacteria 2660
179 nmdc:mga0qj67_8_c4 3300050509 Bacteria 18514
180 nmdc:mga06r32_222735_c1 3300050510 Bacteria 1875
181 nmdc:mga06r32_30013_c1 3300050510 Bacteria 5100
182 nmdc:mga06r32_56954_c1 3300050510 Bacteria 3754
183 nmdc:mga06r32_85137_c1 3300050510 Bacteria 3082
184 nmdc:mga06r32_962_c2 3300050510 Bacteria 18224
185 nmdc:mga08y16_129728_c1 3300050511 Bacteria 2622
186 nmdc:mga0n895_21834_c1 3300050512 Bacteria 5993
187 nmdc:mga0rr50_25506_c1 3300050513 Bacteria 4111
188 nmdc:mga0rr50_302627_c1 3300050513 Bacteria 1338
189 nmdc:mga08x19_65478_c1 3300050514 Bacteria 2360
190 nmdc:mga0a205_4625_c1 3300050515 Bacteria 7811
191 Ga0495601_0152295 3300053077 Bacteria 1510
192 Ga0495595_0029640 3300053084 Bacteria 2450
193 Ga0495619_0160423 3300053085 Bacteria 1553
194 Ga0495619_0273223 3300053085 Bacteria 1171
195 Ga0501084_0045590 3300054114 Bacteria 3671
196 Ga0501084_0050324 3300054114 Bacteria 3487
197 Ga0501084_0074531 3300054114 Bacteria 2842
198 Ga0501084_0127747 3300054114 Bacteria 2140
199 Ga0501082_0008348 3300060353 Bacteria 8932
200 Ga0501082_0025911 3300060353 Bacteria 5054
201 Ga0501082_0530377 3300060353 Bacteria 1029
202 Ga0530510_0003551 3300061734 Bacteria 10736
203 Ga0530510_0004505 3300061734 Bacteria 9644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0615294 Ga0496110_0615294_128_967 277
2 3300035114 Ga0373939_0064669 Ga0373939_0064669_10_912 300
3 3300031548 Ga0307408_100005542 Ga0307408_1000055421 305
4 3300031731 Ga0307405_10081614 Ga0307405_100816142 305
5 3300031852 Ga0307410_10000105 Ga0307410_1000010512 305
6 3300031901 Ga0307406_10000492 Ga0307406_1000049210 305
7 3300031903 Ga0307407_10029912 Ga0307407_100299122 305
8 3300031995 Ga0307409_100000004 Ga0307409_10000000428 305
9 3300032002 Ga0307416_100000085 Ga0307416_10000008517 305
10 3300003373 JGI25407J50210_10000727 JGI25407J50210_100007272 306
11 3300005327 Ga0070658_10063945 Ga0070658_100639453 306
12 3300005339 Ga0070660_100165073 Ga0070660_1001650732 306
13 3300005344 Ga0070661_100177704 Ga0070661_1001777042 306
14 3300005530 Ga0070679_100144781 Ga0070679_1001447812 306
15 3300005535 Ga0070684_100017617 Ga0070684_1000176177 306
16 3300005577 Ga0068857_100476960 Ga0068857_1004769601 306
17 3300009176 Ga0105242_10018073 Ga0105242_100180732 306
18 3300010375 Ga0105239_10396377 Ga0105239_103963771 306
19 3300013297 Ga0157378_10162733 Ga0157378_101627332 306
20 3300025920 Ga0207649_10050863 Ga0207649_100508632 306
21 3300025944 Ga0207661_10169727 Ga0207661_101697271 306
22 3300025949 Ga0207667_10246270 Ga0207667_102462702 306
23 3300049574 Ga0501038_0102314 Ga0501038_0102314_20_943 306
24 3300005434 Ga0070709_10018483 Ga0070709_100184835 307
25 3300005436 Ga0070713_100083888 Ga0070713_1000838884 307
26 3300025906 Ga0207699_10199100 Ga0207699_101991002 307
27 3300025915 Ga0207693_10043711 Ga0207693_100437114 307
28 3300048905 Ga0496102_0032340 Ga0496102_0032340_506_1471 307
29 3300048906 Ga0496103_0081896 Ga0496103_0081896_455_1420 307
30 3300048908 Ga0496105_0041217 Ga0496105_0041217_888_1853 307
31 3300048912 Ga0496109_0493759 Ga0496109_0493759_124_1089 307
32 3300048917 Ga0496114_0027901 Ga0496114_0027901_840_1805 307
33 3300048918 Ga0496115_0068680 Ga0496115_0068680_170_1135 307
34 3300049587 Ga0501071_0057673 Ga0501071_0057673_417_1379 307
35 3300049591 Ga0501075_0072318 Ga0501075_0072318_757_1719 307
36 3300049824 Ga0501045_0108586 Ga0501045_0108586_854_1816 307
37 3300054114 Ga0501084_0074531 Ga0501084_0074531_786_1748 307
38 3300005435 Ga0070714_100576914 Ga0070714_1005769141 308
39 iso_pu_bacteria 2585427649 2586063893 308
40 3300005985 Ga0081539_10000889 Ga0081539_1000088930 309
41 3300031852 Ga0307410_10283903 Ga0307410_102839031 310
42 3300005347 Ga0070668_100000269 Ga0070668_10000026913 311
43 3300006353 Ga0075370_10114124 Ga0075370_101141242 311
44 3300025972 Ga0207668_10046199 Ga0207668_100461993 311
45 3300049583 Ga0501067_0058917 Ga0501067_0058917_1037_1975 311
46 3300050496 nmdc:mga07m45_166468_c1 nmdc:mga07m45_166468_c1_21_1025 311
47 iso_pu_bacteria 2622736605 2623499562 312
48 iso_pu_bacteria 2675903060 2676489820 312
49 iso_pu_bacteria 2751185782 2753262823 314
50 iso_pu_bacteria 2772190715 2772643207 314
51 iso_pu_bacteria 2917736166 2917739612 314
52 iso_pu_bacteria 8003314358 8003319509 314
53 3300005578 Ga0068854_100181762 Ga0068854_1001817621 315
54 3300005985 Ga0081539_10009605 Ga0081539_100096053 315
55 3300006178 Ga0075367_10046849 Ga0075367_100468493 315
56 3300006847 Ga0075431_100346090 Ga0075431_1003460902 316
57 3300006880 Ga0075429_100302802 Ga0075429_1003028022 316
58 3300009093 Ga0105240_10027425 Ga0105240_100274254 316
59 3300009545 Ga0105237_10012796 Ga0105237_100127965 316
60 3300010375 Ga0105239_10080093 Ga0105239_100800932 316
61 3300025949 Ga0207667_10356507 Ga0207667_103565072 316
62 3300031456 Ga0307513_10104197 Ga0307513_101041973 316
63 3300031824 Ga0307413_10147600 Ga0307413_101476001 316
64 3300031995 Ga0307409_100044022 Ga0307409_1000440223 316
65 3300032126 Ga0307415_100031817 Ga0307415_1000318171 316
66 3300033179 Ga0307507_10034727 Ga0307507_100347271 316
67 3300050494 nmdc:mga06z11_20091_c1 nmdc:mga06z11_20091_c1_32_1078 316
68 3300050510 nmdc:mga06r32_222735_c1 nmdc:mga06r32_222735_c1_320_1273 316
69 3300005347 Ga0070668_100001303 Ga0070668_1000013036 317
70 3300006844 Ga0075428_100240347 Ga0075428_1002403472 317
71 3300010375 Ga0105239_10133304 Ga0105239_101333042 317
72 3300011119 Ga0105246_10481006 Ga0105246_104810061 317
73 3300013297 Ga0157378_10119419 Ga0157378_101194193 317
74 3300025942 Ga0207689_10273334 Ga0207689_102733342 317
75 3300025972 Ga0207668_10214450 Ga0207668_102144502 317
76 3300028794 Ga0307515_10000478 Ga0307515_100004782 317
77 3300031507 Ga0307509_10027376 Ga0307509_100273765 317
78 3300031730 Ga0307516_10002715 Ga0307516_100027155 317
79 3300031824 Ga0307413_10214703 Ga0307413_102147032 317
80 3300032002 Ga0307416_100308866 Ga0307416_1003088663 317
81 3300032126 Ga0307415_100113107 Ga0307415_1001131072 317
82 3300032126 Ga0307415_100198342 Ga0307415_1001983422 317
83 3300044658 Ga0466972_0011045 Ga0466972_0011045_190_1146 317
84 3300044901 Ga0466960_0130667 Ga0466960_0130667_135_1091 317
85 3300046499 Ga0495594_0005660 Ga0495594_0005660_5102_6058 317
86 3300046516 Ga0495628_0207146 Ga0495628_0207146_472_1431 317
87 3300047322 Ga0495680_0118764 Ga0495680_0118764_298_1254 317
88 3300053077 Ga0495601_0152295 Ga0495601_0152295_118_1077 317
89 3300003373 JGI25407J50210_10014375 JGI25407J50210_100143752 318
90 3300005347 Ga0070668_100069292 Ga0070668_1000692923 318
91 3300005455 Ga0070663_100013594 Ga0070663_1000135943 318
92 3300005617 Ga0068859_100216267 Ga0068859_1002162672 318
93 3300005842 Ga0068858_100214587 Ga0068858_1002145872 318
94 3300005843 Ga0068860_100009329 Ga0068860_1000093292 318
95 3300005981 Ga0081538_10000418 Ga0081538_1000041811 318
96 3300005981 Ga0081538_10005762 Ga0081538_100057624 318
97 3300005985 Ga0081539_10000495 Ga0081539_1000049548 318
98 3300006844 Ga0075428_100041865 Ga0075428_1000418653 318
99 3300006846 Ga0075430_100008332 Ga0075430_1000083326 318
100 3300006846 Ga0075430_100011459 Ga0075430_1000114596 318
101 3300006847 Ga0075431_100086278 Ga0075431_1000862783 318
102 3300006847 Ga0075431_100212562 Ga0075431_1002125622 318
103 3300006880 Ga0075429_100011543 Ga0075429_1000115434 318
104 3300006880 Ga0075429_100114655 Ga0075429_1001146552 318
105 3300006931 Ga0097620_100216280 Ga0097620_1002162802 318
106 3300007076 Ga0075435_100235268 Ga0075435_1002352682 318
107 3300009094 Ga0111539_10161272 Ga0111539_101612722 318
108 3300009147 Ga0114129_10000128 Ga0114129_100001285 318
109 3300009147 Ga0114129_10039180 Ga0114129_100391806 318
110 3300014968 Ga0157379_10050582 Ga0157379_100505823 318
111 3300025972 Ga0207668_10208192 Ga0207668_102081922 318
112 3300026035 Ga0207703_10121121 Ga0207703_101211213 318
113 3300026067 Ga0207678_10000283 Ga0207678_1000028324 318
114 3300026095 Ga0207676_10269372 Ga0207676_102693722 318
115 3300028380 Ga0268265_10022040 Ga0268265_100220402 318
116 3300028381 Ga0268264_10035744 Ga0268264_100357442 318
117 3300031507 Ga0307509_10021453 Ga0307509_100214534 318
118 3300031730 Ga0307516_10327948 Ga0307516_103279481 318
119 3300035088 Ga0373940_0003283 Ga0373940_0003283_1887_2843 318
120 3300035118 Ga0373954_0095563 Ga0373954_0095563_204_1181 318
121 3300035207 Ga0373942_0000586 Ga0373942_0000586_6231_7187 318
122 3300035242 Ga0373962_0004174 Ga0373962_0004174_991_1947 318
123 3300035725 Ga0373947_0043199 Ga0373947_0043199_1719_2678 318
124 3300039453 Ga0436362_0881270 Ga0436362_0881270_1863_2822 318
125 3300042005 Ga0439448_0025736 Ga0439448_0025736_34_993 318
126 3300042016 Ga0439463_007305 Ga0439463_007305_1009_1968 318
127 3300042461 Ga0439460_0004757 Ga0439460_0004757_1927_2886 318
128 3300042993 Ga0439440_0000875 Ga0439440_0000875_2658_3617 318
129 3300046517 Ga0495630_0024716 Ga0495630_0024716_3372_4331 318
130 3300046642 Ga0495634_0013156 Ga0495634_0013156_4088_5047 318
131 3300046689 Ga0495613_0000128 Ga0495613_0000128_69871_70830 318
132 3300046689 Ga0495613_0054525 Ga0495613_0054525_1646_2623 318
133 3300048911 Ga0496108_0000036 Ga0496108_0000036_107605_108561 318
134 3300049570 Ga0501033_0001571 Ga0501033_0001571_7359_8318 318
135 3300049572 Ga0501036_0001907 Ga0501036_0001907_8437_9396 318
136 3300049575 Ga0501039_0026351 Ga0501039_0026351_1403_2362 318
137 3300049576 Ga0501040_0059248 Ga0501040_0059248_105_1064 318
138 3300049578 Ga0501042_0006699 Ga0501042_0006699_1576_2535 318
139 3300049580 Ga0501046_0004368 Ga0501046_0004368_1466_2425 318
140 3300049582 Ga0501048_0006025 Ga0501048_0006025_1297_2256 318
141 3300049584 Ga0501068_0002110 Ga0501068_0002110_2044_3003 318
142 3300049586 Ga0501070_0001888 Ga0501070_0001888_17489_18448 318
143 3300049586 Ga0501070_0340787 Ga0501070_0340787_104_1063 318
144 3300049588 Ga0501072_0020321 Ga0501072_0020321_1579_2538 318
145 3300049589 Ga0501073_0002620 Ga0501073_0002620_5264_6223 318
146 3300049592 Ga0501076_0004318 Ga0501076_0004318_7483_8442 318
147 3300049741 Ga0501079_0000619 Ga0501079_0000619_6821_7780 318
148 3300049741 Ga0501079_0009960 Ga0501079_0009960_5006_5965 318
149 3300049744 Ga0501083_0000589 Ga0501083_0000589_3059_4018 318
150 3300049824 Ga0501045_0002688 Ga0501045_0002688_10443_11402 318
151 3300050507 nmdc:mga05p37_297198_c1 nmdc:mga05p37_297198_c1_360_1325 318
152 3300050507 nmdc:mga05p37_34295_c1 nmdc:mga05p37_34295_c1_1785_2744 318
153 3300050508 nmdc:mga09592_1187_c1 nmdc:mga09592_1187_c1_6064_7035 318
154 3300050508 nmdc:mga09592_4842_c1 nmdc:mga09592_4842_c1_4773_5732 318
155 3300050509 nmdc:mga0qj67_338632_c1 nmdc:mga0qj67_338632_c1_14_979 318
156 3300050509 nmdc:mga0qj67_77433_c1 nmdc:mga0qj67_77433_c1_549_1508 318
157 3300050509 nmdc:mga0qj67_8_c4 nmdc:mga0qj67_8_c4_8634_9605 318
158 3300050510 nmdc:mga06r32_56954_c1 nmdc:mga06r32_56954_c1_813_1772 318
159 3300050510 nmdc:mga06r32_962_c2 nmdc:mga06r32_962_c2_8731_9702 318
160 3300050511 nmdc:mga08y16_129728_c1 nmdc:mga08y16_129728_c1_325_1284 318
161 3300050512 nmdc:mga0n895_21834_c1 nmdc:mga0n895_21834_c1_3623_4582 318
162 3300050513 nmdc:mga0rr50_25506_c1 nmdc:mga0rr50_25506_c1_1043_2002 318
163 3300050513 nmdc:mga0rr50_302627_c1 nmdc:mga0rr50_302627_c1_306_1289 318
164 3300050514 nmdc:mga08x19_65478_c1 nmdc:mga08x19_65478_c1_1194_2153 318
165 3300050515 nmdc:mga0a205_4625_c1 nmdc:mga0a205_4625_c1_3388_4347 318
166 3300053084 Ga0495595_0029640 Ga0495595_0029640_1382_2359 318
167 3300053085 Ga0495619_0160423 Ga0495619_0160423_310_1287 318
168 3300054114 Ga0501084_0045590 Ga0501084_0045590_1248_2207 318
169 3300054114 Ga0501084_0050324 Ga0501084_0050324_2044_3003 318
170 3300060353 Ga0501082_0008348 Ga0501082_0008348_506_1465 318
171 3300060353 Ga0501082_0025911 Ga0501082_0025911_1540_2499 318
172 3300061734 Ga0530510_0003551 Ga0530510_0003551_8826_9785 318
173 3300006844 Ga0075428_100086195 Ga0075428_1000861953 319
174 3300006846 Ga0075430_100134321 Ga0075430_1001343212 319
175 3300006847 Ga0075431_100000341 Ga0075431_10000034128 319
176 3300006880 Ga0075429_100125481 Ga0075429_1001254812 319
177 3300006914 Ga0075436_100013397 Ga0075436_1000133973 319
178 3300007076 Ga0075435_100010514 Ga0075435_1000105146 319
179 3300025922 Ga0207646_10087057 Ga0207646_100870573 319
180 3300030522 Ga0307512_10102536 Ga0307512_101025362 319
181 3300048904 Ga0496101_0078094 Ga0496101_0078094_265_1329 319
182 3300048908 Ga0496105_0005312 Ga0496105_0005312_7414_8478 319
183 3300050508 nmdc:mga09592_29372_c1 nmdc:mga09592_29372_c1_2457_3431 319
184 3300050509 nmdc:mga0qj67_54048_c1 nmdc:mga0qj67_54048_c1_190_1164 319
185 3300050510 nmdc:mga06r32_30013_c1 nmdc:mga06r32_30013_c1_1021_1995 319
186 3300006051 Ga0075364_10021893 Ga0075364_100218933 320
187 3300006847 Ga0075431_100120552 Ga0075431_1001205523 320
188 3300007076 Ga0075435_100228981 Ga0075435_1002289813 320
189 3300009147 Ga0114129_10306558 Ga0114129_103065581 320
190 3300049576 Ga0501040_0263138 Ga0501040_0263138_141_1106 320
191 3300049588 Ga0501072_0188042 Ga0501072_0188042_565_1530 320
192 3300049590 Ga0501074_0066363 Ga0501074_0066363_1581_2555 320
193 3300049590 Ga0501074_0127929 Ga0501074_0127929_203_1168 320
194 3300049591 Ga0501075_0030429 Ga0501075_0030429_1335_2300 320
195 3300049592 Ga0501076_0054359 Ga0501076_0054359_2177_3142 320
196 3300049743 Ga0501081_0146087 Ga0501081_0146087_507_1472 320
197 3300050491 nmdc:mga00v17_12375_c1 nmdc:mga00v17_12375_c1_2430_3401 320
198 3300050507 nmdc:mga05p37_38351_c1 nmdc:mga05p37_38351_c1_4615_5592 320
199 3300050510 nmdc:mga06r32_85137_c1 nmdc:mga06r32_85137_c1_619_1596 320
200 3300053085 Ga0495619_0273223 Ga0495619_0273223_157_1131 320
201 3300060353 Ga0501082_0530377 Ga0501082_0530377_47_1012 320
202 3300061734 Ga0530510_0004505 Ga0530510_0004505_4084_5049 320
203 3300021384 Ga0213876_10042146 Ga0213876_100421463 321
204 3300039437 Ga0436365_1518405 Ga0436365_1518405_3331_4311 321
205 3300046517 Ga0495630_0241192 Ga0495630_0241192_291_1262 321
206 3300049588 Ga0501072_0139366 Ga0501072_0139366_60_1040 321
207 3300050492 nmdc:mga0yw44_239927_c1 nmdc:mga0yw44_239927_c1_92_1063 321
208 3300054114 Ga0501084_0127747 Ga0501084_0127747_970_1962 321
209 3300003320 rootH2_10073095 rootH2_100730954 322
210 3300041512 Ga0451853_0617112 Ga0451853_0617112_2891_3880 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21686

LigD_Prim-Pol

LigD, primase-polymerase domain

26

274

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.9353 11 289
6sa1-assembly1.cif.gz_A post catalytic complex of prim-polc from mycobacterium smegmatis with gapped dna and 3'-dutp 0.9195 14 296
2far-assembly2.cif.gz_B crystal structure of pseudomonas aeruginosa ligd polymerase domain with datp and manganese 0.8995 13 295
2iry-assembly1.cif.gz_A crystal structure of the polymerase domain from mycobacterium tuberculosis ligase d with dgtp and manganese. 0.8897 5 275
5dmu-assembly1.cif.gz_A structure of the nhej polymerase from methanocella paludicola 0.8666 11 289
ID Description Score Start End Superfamily
af_P95226_24_305_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9309 30 295 3.90.920.10
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9274 26 296 3.90.920.10
af_P9WNV3_16_301_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.9078 21 267 3.90.920.10
2iruB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9072 128 261 3.30.70.3300
af_O69697_22_304_3.90.920.10 Alpha Beta;Alpha-Beta Complex;DNA primase, PRIM domain;DNA primase, PRIM domain 0.8866 26 296 3.90.920.10
ID Description Score Start End GO Terms
AF-A0A6F8YBU1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9873 5 285 GO:0008270
GO:0016491
AF-A0A2S9FM71-F1-model_v4 ATP-dependent DNA ligase 0.9872 154 296 GO:0016874
AF-A0A2W2GLN9-F1-model_v4 ATP-dependent DNA ligase 0.9871 5 282 GO:0005524
GO:0016874
GO:0046872
AF-A0A379BV72-F1-model_v4 deleted 0.9841 5 319
AF-A0A2W2GLN9-F1-model_v4 ATP-dependent DNA ligase 0.9835 5 282 GO:0005524
GO:0016874
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.09 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map