F319977

General Info

Members Datasets Scaffolds Average Seq Length
210 116 420 266

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100104186|Ga0070689_1001041862
Length 243
Sequence MKIPRVRISISAVLSAFFACCGLACAADRPFSNGKWIDLTHDFSTNTLYWPTAESFALETEFHGQTPKGYFYVANRYHASEHGGTHIDAPIHFAEGHKTVDQLSIEQLSGPAVVVDVSAKAQKDADYRIAPADLKAWEQQHGQIPKGAIVLFHTGFAGRWPDAKKYLGERTIKAVGLDTASIDYGQSTLFESHRILFEKDIPAFENLGALDQLPVTGAYVIALPMKIKNGSGAPLRIAAWRPM

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
86 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
90 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
115 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
116 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 22.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100104186 3300005340 Bacteria 2249
2 JGI25406J46586_10004936 3300003203 Bacteria 6194
3 Ga0065714_10084248 3300005288 Bacteria 2208
4 Ga0065712_10008552 3300005290 Bacteria 3558
5 Ga0065712_10069167 3300005290 Bacteria 7829
6 Ga0065712_10075114 3300005290 Bacteria 3931
7 Ga0065715_10321573 3300005293 Bacteria 1001
8 Ga0065707_10084595 3300005295 Bacteria 7009
9 Ga0070689_100003091 3300005340 Bacteria 10978
10 Ga0070689_100052326 3300005340 Bacteria 3158
11 Ga0070689_100062234 3300005340 Bacteria 2904
12 Ga0070689_100069509 3300005340 Bacteria 2747
13 Ga0070689_100305800 3300005340 Bacteria 1324
14 Ga0070689_100356191 3300005340 Unclassified 1228
15 Ga0070669_100120924 3300005353 Bacteria 1998
16 Ga0070675_100034014 3300005354 Bacteria 4134
17 Ga0070675_100103077 3300005354 Unclassified 2405
18 Ga0070674_100047276 3300005356 Bacteria 2947
19 Ga0070673_100031982 3300005364 Bacteria 3955
20 Ga0070673_100050754 3300005364 Bacteria 3245
21 Ga0070673_100059320 3300005364 Unclassified 3028
22 Ga0070673_100095857 3300005364 Unclassified 2434
23 Ga0070688_100028972 3300005365 Unclassified 3311
24 Ga0070688_100031058 3300005365 Bacteria 3211
25 Ga0070688_100325822 3300005365 Unclassified 1117
26 Ga0070688_100349219 3300005365 Bacteria 1082
27 Ga0070667_100210028 3300005367 Unclassified 1730
28 Ga0070701_10047601 3300005438 Unclassified 2209
29 Ga0070705_100290872 3300005440 Unclassified 1166
30 Ga0070700_100024119 3300005441 Bacteria 3567
31 Ga0070700_100065747 3300005441 Bacteria 2300
32 Ga0070708_100219516 3300005445 Unclassified 1783
33 Ga0070678_100611110 3300005456 Unclassified 974
34 Ga0068867_100005629 3300005459 Bacteria 8877
35 Ga0070685_10005298 3300005466 Bacteria 6539
36 Ga0070706_100396328 3300005467 Unclassified 1285
37 Ga0070707_100045135 3300005468 Bacteria 4218
38 Ga0070698_100862193 3300005471 Bacteria 851
39 Ga0070697_100295487 3300005536 Bacteria 1392
40 Ga0070672_100006052 3300005543 Bacteria 8084
41 Ga0070672_100201679 3300005543 Unclassified 1664
42 Ga0070672_100251797 3300005543 Bacteria 1488
43 Ga0070686_100020826 3300005544 Bacteria 3886
44 Ga0070686_100027832 3300005544 Bacteria 3424
45 Ga0070704_100032673 3300005549 Bacteria 3513
46 Ga0068857_100362844 3300005577 Bacteria 1343
47 Ga0068857_100371394 3300005577 Bacteria 1327
48 Ga0070702_100252997 3300005615 Bacteria 1195
49 Ga0068852_100294098 3300005616 Bacteria 1570
50 Ga0068859_100047295 3300005617 Bacteria 4322
51 Ga0068859_100060625 3300005617 Bacteria 3812
52 Ga0068859_100234670 3300005617 Bacteria 1923
53 Ga0068859_100278689 3300005617 Bacteria 1765
54 Ga0068864_100189817 3300005618 Bacteria 1883
55 Ga0068866_10019130 3300005718 Bacteria 3111
56 Ga0068861_100101995 3300005719 Bacteria 2284
57 Ga0068861_100417822 3300005719 Unclassified 1194
58 Ga0068860_100082232 3300005843 Bacteria 3063
59 Ga0068862_100839640 3300005844 Bacteria 899
60 Ga0081539_10000329 3300005985 Bacteria 105307
61 Ga0075428_100000428 3300006844 Bacteria 41804
62 Ga0075428_100044684 3300006844 Bacteria 4867
63 Ga0075428_100058603 3300006844 Bacteria 4216
64 Ga0075428_100162476 3300006844 Bacteria 2424
65 Ga0075430_100022030 3300006846 Bacteria 5416
66 Ga0075431_100050534 3300006847 Unclassified 4286
67 Ga0075431_100071968 3300006847 Unclassified 3567
68 Ga0075431_100263860 3300006847 Bacteria 1747
69 Ga0075433_10021954 3300006852 Bacteria 5356
70 Ga0075429_100020576 3300006880 Bacteria 5726
71 Ga0075429_100104719 3300006880 Bacteria 2471
72 Ga0075429_100135741 3300006880 Bacteria 2153
73 Ga0075429_100149314 3300006880 Bacteria 2046
74 Ga0075429_100158496 3300006880 Bacteria 1982
75 Ga0068865_100018592 3300006881 Bacteria 4487
76 Ga0097620_100047298 3300006931 Bacteria 4322
77 Ga0097620_100060627 3300006931 Bacteria 3812
78 Ga0097620_100234663 3300006931 Bacteria 1923
79 Ga0097620_100278668 3300006931 Bacteria 1765
80 Ga0111539_10001005 3300009094 Bacteria 36942
81 Ga0111539_10009541 3300009094 Bacteria 12248
82 Ga0111539_10009735 3300009094 Bacteria 12132
83 Ga0111539_10104019 3300009094 Unclassified 3332
84 Ga0111539_10381415 3300009094 Archaea 1641
85 Ga0111539_10837886 3300009094 Bacteria 1070
86 Ga0114129_10052365 3300009147 Bacteria 5728
87 Ga0114129_10131592 3300009147 Unclassified 3435
88 Ga0114129_10265607 3300009147 Bacteria 2298
89 Ga0114129_10894938 3300009147 Bacteria 1125
90 Ga0105243_10995005 3300009148 Bacteria 841
91 Ga0105242_10048076 3300009176 Bacteria 3466
92 Ga0105249_10005688 3300009553 Bacteria 10780
93 Ga0105249_10014317 3300009553 Bacteria 7014
94 Ga0105249_10090070 3300009553 Bacteria 2868
95 Ga0105249_10994316 3300009553 Bacteria 907
96 Ga0163162_10074371 3300013306 Bacteria 3457
97 Ga0157375_10000129 3300013308 Bacteria 75013
98 Ga0157375_10081535 3300013308 Bacteria 3275
99 Ga0157375_10195480 3300013308 Bacteria 2178
100 Ga0163163_10589059 3300014325 Unclassified 1175
101 Ga0163163_10726961 3300014325 Bacteria 1056
102 Ga0157380_10088418 3300014326 Unclassified 2549
103 Ga0157380_10147630 3300014326 Bacteria 2028
104 Ga0157380_10582149 3300014326 Unclassified 1104
105 Ga0157377_10037298 3300014745 Unclassified 2678
106 Ga0207682_10044764 3300025893 Bacteria 1815
107 Ga0207642_10014940 3300025899 Bacteria 2880
108 Ga0207680_10134652 3300025903 Bacteria 1632
109 Ga0207645_10204604 3300025907 Bacteria 1299
110 Ga0207643_10013643 3300025908 Bacteria 4403
111 Ga0207660_10118072 3300025917 Unclassified 2006
112 Ga0207646_10039617 3300025922 Bacteria 4240
113 Ga0207681_10079394 3300025923 Unclassified 2312
114 Ga0207681_10107172 3300025923 Unclassified 2026
115 Ga0207659_10009559 3300025926 Bacteria 6064
116 Ga0207659_10065258 3300025926 Bacteria 2637
117 Ga0207659_10378191 3300025926 Bacteria 1180
118 Ga0207686_10236824 3300025934 Bacteria 1326
119 Ga0207670_10017267 3300025936 Bacteria 4361
120 Ga0207670_10046191 3300025936 Bacteria 2892
121 Ga0207669_10264892 3300025937 Bacteria 1288
122 Ga0207704_10314420 3300025938 Bacteria 1205
123 Ga0207704_10422951 3300025938 Bacteria 1056
124 Ga0207691_10020444 3300025940 Bacteria 6258
125 Ga0207691_10060629 3300025940 Bacteria 3437
126 Ga0207691_10444428 3300025940 Unclassified 1104
127 Ga0207689_10002769 3300025942 Bacteria 16206
128 Ga0207651_10033492 3300025960 Bacteria 3315
129 Ga0207651_10039413 3300025960 Bacteria 3115
130 Ga0207712_10005037 3300025961 Bacteria 8361
131 Ga0207712_10054348 3300025961 Bacteria 2813
132 Ga0207712_10056105 3300025961 Bacteria 2774
133 Ga0207712_10192215 3300025961 Unclassified 1612
134 Ga0207677_10097298 3300026023 Bacteria 2156
135 Ga0207708_10004481 3300026075 Bacteria 10292
136 Ga0207708_10115247 3300026075 Bacteria 2090
137 Ga0207708_10153803 3300026075 Unclassified 1813
138 Ga0207641_10052560 3300026088 Bacteria 3451
139 Ga0207641_10225996 3300026088 Unclassified 1738
140 Ga0207648_10009414 3300026089 Bacteria 9359
141 Ga0207648_10151270 3300026089 Bacteria 2048
142 Ga0207676_10211367 3300026095 Bacteria 1721
143 Ga0207675_100041164 3300026118 Bacteria 4314
144 Ga0207675_100079079 3300026118 Unclassified 3081
145 Ga0207675_100210190 3300026118 Bacteria 1871
146 Ga0207683_10580147 3300026121 Unclassified 1037
147 Ga0207698_10045473 3300026142 Bacteria 3308
148 Ga0207428_10001785 3300027907 Bacteria 22034
149 Ga0207428_10011060 3300027907 Bacteria 8019
150 Ga0207428_10015937 3300027907 Bacteria 6482
151 Ga0268264_10303312 3300028381 Bacteria 1504
152 Ga0307408_100281565 3300031548 Bacteria 1385
153 Ga0307408_100602440 3300031548 Bacteria 976
154 Ga0307410_10196067 3300031852 Bacteria 1539
155 Ga0307412_10287180 3300031911 Bacteria 1294
156 Ga0307409_100075021 3300031995 Bacteria 2706
157 Ga0439436_0008573 3300041404 Unclassified 3144
158 Ga0439453_0002143 3300041408 Bacteria 2677
159 Ga0439465_0000707 3300041413 Bacteria 10262
160 Ga0439449_0000024 3300042007 Bacteria 44788
161 Ga0450923_036749 3300042125 Bacteria 1017
162 Ga0451576_0283070 3300045051 Bacteria 1734
163 Ga0451576_0499201 3300045051 Bacteria 1278
164 Ga0495656_0017579 3300046615 Unclassified 2731
165 Ga0495676_0200373 3300047321 Unclassified 1387
166 Ga0501032_0042104 3300049569 Bacteria 3099
167 Ga0501033_0279790 3300049570 Bacteria 1178
168 Ga0501038_0383862 3300049574 Bacteria 1089
169 Ga0501039_0033428 3300049575 Unclassified 3965
170 Ga0501040_0467491 3300049576 Bacteria 908
171 Ga0501042_0064721 3300049578 Unclassified 2613
172 Ga0501046_0044700 3300049580 Unclassified 3522
173 Ga0501048_0196045 3300049582 Bacteria 1431
174 Ga0501072_0029819 3300049588 Bacteria 4263
175 Ga0501074_0284500 3300049590 Unclassified 1175
176 Ga0501075_0146265 3300049591 Unclassified 1801
177 Ga0501076_0030808 3300049592 Bacteria 4180
178 Ga0501076_0316511 3300049592 Unclassified 1280
179 Ga0501077_0165739 3300049593 Bacteria 1404
180 Ga0501249_010555 3300049679 Bacteria 1934
181 Ga0501079_0026093 3300049741 Unclassified 4481
182 Ga0501080_0404983 3300049742 Bacteria 1227
183 nmdc:mga05p37_101397_c1 3300050507 Unclassified 3545
184 nmdc:mga05p37_296047_c1 3300050507 Bacteria 1925
185 nmdc:mga05p37_486251_c1 3300050507 Bacteria 1420
186 nmdc:mga05p37_83067_c1 3300050507 Bacteria 3946
187 nmdc:mga05p37_86409_c1 3300050507 Bacteria 3865
188 nmdc:mga05p37_87930_c1 3300050507 Bacteria 3830
189 nmdc:mga09592_119175_c1 3300050508 Bacteria 2266
190 nmdc:mga09592_149375_c1 3300050508 Bacteria 2016
191 nmdc:mga09592_16878_c1 3300050508 Unclassified 3382
192 nmdc:mga09592_33934_c1 3300050508 Bacteria 4264
193 nmdc:mga0qj67_12804_c1 3300050509 Bacteria 6327
194 nmdc:mga0qj67_146453_c1 3300050509 Unclassified 1915
195 nmdc:mga0qj67_178223_c1 3300050509 Unclassified 1726
196 nmdc:mga0qj67_459873_c1 3300050509 Bacteria 1025
197 nmdc:mga06r32_2347_c1 3300050510 Bacteria 16980
198 nmdc:mga06r32_24055_c1 3300050510 Bacteria 5647
199 nmdc:mga06r32_81839_c1 3300050510 Unclassified 3145
200 nmdc:mga08y16_14896_c1 3300050511 Bacteria 8179
201 nmdc:mga08y16_15486_c1 3300050511 Bacteria 8020
202 nmdc:mga08y16_161148_c1 3300050511 Bacteria 2331
203 nmdc:mga08y16_191362_c1 3300050511 Bacteria 2122
204 nmdc:mga08y16_373764_c1 3300050511 Bacteria 1462
205 nmdc:mga08y16_43101_c1 3300050511 Bacteria 4728
206 nmdc:mga08y16_616421_c1 3300050511 Archaea 1092
207 nmdc:mga0a205_126329_c1 3300050515 Bacteria 2457
208 nmdc:mga0a205_23655_c1 3300050515 Bacteria 5826
209 Ga0501082_0021854 3300060353 Bacteria 5515
210 Ga0530510_0272144 3300061734 Unclassified 1264
211 Ga0070689_100104186
212 JGI25406J46586_10004936
213 Ga0065714_10084248
214 Ga0065712_10008552
215 Ga0065712_10069167
216 Ga0065712_10075114
217 Ga0065715_10321573
218 Ga0065707_10084595
219 Ga0070689_100003091
220 Ga0070689_100052326
221 Ga0070689_100062234
222 Ga0070689_100069509
223 Ga0070689_100305800
224 Ga0070689_100356191
225 Ga0070669_100120924
226 Ga0070675_100034014
227 Ga0070675_100103077
228 Ga0070674_100047276
229 Ga0070673_100031982
230 Ga0070673_100050754
231 Ga0070673_100059320
232 Ga0070673_100095857
233 Ga0070688_100028972
234 Ga0070688_100031058
235 Ga0070688_100325822
236 Ga0070688_100349219
237 Ga0070667_100210028
238 Ga0070701_10047601
239 Ga0070705_100290872
240 Ga0070700_100024119
241 Ga0070700_100065747
242 Ga0070708_100219516
243 Ga0070678_100611110
244 Ga0068867_100005629
245 Ga0070685_10005298
246 Ga0070706_100396328
247 Ga0070707_100045135
248 Ga0070698_100862193
249 Ga0070697_100295487
250 Ga0070672_100006052
251 Ga0070672_100201679
252 Ga0070672_100251797
253 Ga0070686_100020826
254 Ga0070686_100027832
255 Ga0070704_100032673
256 Ga0068857_100362844
257 Ga0068857_100371394
258 Ga0070702_100252997
259 Ga0068852_100294098
260 Ga0068859_100047295
261 Ga0068859_100060625
262 Ga0068859_100234670
263 Ga0068859_100278689
264 Ga0068864_100189817
265 Ga0068866_10019130
266 Ga0068861_100101995
267 Ga0068861_100417822
268 Ga0068860_100082232
269 Ga0068862_100839640
270 Ga0081539_10000329
271 Ga0075428_100000428
272 Ga0075428_100044684
273 Ga0075428_100058603
274 Ga0075428_100162476
275 Ga0075430_100022030
276 Ga0075431_100050534
277 Ga0075431_100071968
278 Ga0075431_100263860
279 Ga0075433_10021954
280 Ga0075429_100020576
281 Ga0075429_100104719
282 Ga0075429_100135741
283 Ga0075429_100149314
284 Ga0075429_100158496
285 Ga0068865_100018592
286 Ga0097620_100047298
287 Ga0097620_100060627
288 Ga0097620_100234663
289 Ga0097620_100278668
290 Ga0111539_10001005
291 Ga0111539_10009541
292 Ga0111539_10009735
293 Ga0111539_10104019
294 Ga0111539_10381415
295 Ga0111539_10837886
296 Ga0114129_10052365
297 Ga0114129_10131592
298 Ga0114129_10265607
299 Ga0114129_10894938
300 Ga0105243_10995005
301 Ga0105242_10048076
302 Ga0105249_10005688
303 Ga0105249_10014317
304 Ga0105249_10090070
305 Ga0105249_10994316
306 Ga0163162_10074371
307 Ga0157375_10000129
308 Ga0157375_10081535
309 Ga0157375_10195480
310 Ga0163163_10589059
311 Ga0163163_10726961
312 Ga0157380_10088418
313 Ga0157380_10147630
314 Ga0157380_10582149
315 Ga0157377_10037298
316 Ga0207682_10044764
317 Ga0207642_10014940
318 Ga0207680_10134652
319 Ga0207645_10204604
320 Ga0207643_10013643
321 Ga0207660_10118072
322 Ga0207646_10039617
323 Ga0207681_10079394
324 Ga0207681_10107172
325 Ga0207659_10009559
326 Ga0207659_10065258
327 Ga0207659_10378191
328 Ga0207686_10236824
329 Ga0207670_10017267
330 Ga0207670_10046191
331 Ga0207669_10264892
332 Ga0207704_10314420
333 Ga0207704_10422951
334 Ga0207691_10020444
335 Ga0207691_10060629
336 Ga0207691_10444428
337 Ga0207689_10002769
338 Ga0207651_10033492
339 Ga0207651_10039413
340 Ga0207712_10005037
341 Ga0207712_10054348
342 Ga0207712_10056105
343 Ga0207712_10192215
344 Ga0207677_10097298
345 Ga0207708_10004481
346 Ga0207708_10115247
347 Ga0207708_10153803
348 Ga0207641_10052560
349 Ga0207641_10225996
350 Ga0207648_10009414
351 Ga0207648_10151270
352 Ga0207676_10211367
353 Ga0207675_100041164
354 Ga0207675_100079079
355 Ga0207675_100210190
356 Ga0207683_10580147
357 Ga0207698_10045473
358 Ga0207428_10001785
359 Ga0207428_10011060
360 Ga0207428_10015937
361 Ga0268264_10303312
362 Ga0307408_100281565
363 Ga0307408_100602440
364 Ga0307410_10196067
365 Ga0307412_10287180
366 Ga0307409_100075021
367 Ga0439436_0008573
368 Ga0439453_0002143
369 Ga0439465_0000707
370 Ga0439449_0000024
371 Ga0450923_036749
372 Ga0451576_0283070
373 Ga0451576_0499201
374 Ga0495656_0017579
375 Ga0495676_0200373
376 Ga0501032_0042104
377 Ga0501033_0279790
378 Ga0501038_0383862
379 Ga0501039_0033428
380 Ga0501040_0467491
381 Ga0501042_0064721
382 Ga0501046_0044700
383 Ga0501048_0196045
384 Ga0501072_0029819
385 Ga0501074_0284500
386 Ga0501075_0146265
387 Ga0501076_0030808
388 Ga0501076_0316511
389 Ga0501077_0165739
390 Ga0501249_010555
391 Ga0501079_0026093
392 Ga0501080_0404983
393 nmdc:mga05p37_101397_c1
394 nmdc:mga05p37_296047_c1
395 nmdc:mga05p37_486251_c1
396 nmdc:mga05p37_83067_c1
397 nmdc:mga05p37_86409_c1
398 nmdc:mga05p37_87930_c1
399 nmdc:mga09592_119175_c1
400 nmdc:mga09592_149375_c1
401 nmdc:mga09592_16878_c1
402 nmdc:mga09592_33934_c1
403 nmdc:mga0qj67_12804_c1
404 nmdc:mga0qj67_146453_c1
405 nmdc:mga0qj67_178223_c1
406 nmdc:mga0qj67_459873_c1
407 nmdc:mga06r32_2347_c1
408 nmdc:mga06r32_24055_c1
409 nmdc:mga06r32_81839_c1
410 nmdc:mga08y16_14896_c1
411 nmdc:mga08y16_15486_c1
412 nmdc:mga08y16_161148_c1
413 nmdc:mga08y16_191362_c1
414 nmdc:mga08y16_373764_c1
415 nmdc:mga08y16_43101_c1
416 nmdc:mga08y16_616421_c1
417 nmdc:mga0a205_126329_c1
418 nmdc:mga0a205_23655_c1
419 Ga0501082_0021854
420 Ga0530510_0272144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04199

Cyclase

Putative cyclase

37

184

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8f9x-assembly2.cif.gz_D cyclase-phosphotriesterase from ruegeria pomeroyi dss-3 0.9016 31 264
8f9x-assembly2.cif.gz_D cyclase-phosphotriesterase from ruegeria pomeroyi dss-3 0.8978 31 264
4m8d-assembly3.cif.gz_E crystal structure of an isatin hydrolase bound to product analogue thioisatinate 0.8875 31 266
8hmo-assembly2.cif.gz_D crystal structure of metal-dependent hydrolase complexed with manganese from bacillus smithii 0.8859 31 263
4cob-assembly1.cif.gz_B crystal structure kynurenine formamidase from pseudomonas aeruginosa 0.8812 31 266
ID Description Score Start End Superfamily
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.9056 31 263 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8812 31 266 3.50.30.50
5nmpC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8802 31 265 3.50.30.50
4cobB00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8772 31 266 3.50.30.50
af_Q2G123_4_245_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.8553 31 263 3.50.30.50
ID Description Score Start End GO Terms
AF-A0A842PZ16-F1-model_v4 deleted 0.9956 106 266
AF-A0A354T999-F1-model_v4 Cyclase 0.9887 30 266 GO:0004061
GO:0019441
AF-A0A846PYL8-F1-model_v4 Cyclase family protein 0.9873 27 265 GO:0004061
GO:0019441
AF-A0A1W9G923-F1-model_v4 Cyclase 0.9863 44 265 GO:0004061
GO:0019441
AF-A0A1G0PG23-F1-model_v4 Cyclase 0.9857 44 265 GO:0004061
GO:0019441

Map