F319901

General Info

Members Datasets Scaffolds Average Seq Length
210 164 207 489

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10012747|Ga0065707_100127472
Length 535
Sequence VEHFDVIIVGAGLSGIGAACHLKTHCPEKSFVILEGREVSGGTWDLFRYPGVRSDSDMYTLGYRFRPWRDPKAIADGPSILNYIRDTAIEYGVDKAIRYNXRVQGASWSSSEARWTVEVETGGKGEKGXGEKRDGPSEEVSRKDAKAQRDTAAAQLTCNFLFLCTGYYDYDNGYTPEWRGVERFRGALVHPQKWPDDLDYVNKRIVVIGSGATAITLVPALAERAAHVTMLQRSPSYIVMRPSEDIVANAFRRCLPDRAAYLLTRWKNVLLTTFFYNLARKRPKVFKRMVAKGVRRHLGNGYDAKHFTPPYNPWDQRLCIAPDADFFRSIRDGSVSVVTDHIETFTEDGLLLKSGAQLDADIIVTATGLQLKLISGMQLLVDGTPVNLSKTLVYKGMMFSDVPNLAFAIGYTNASWTLKCDLTSEYVCRVLNHMDQHGYEVCTPRVNDPDIKEEPVLDFNSGYVLRALPMLPSQGSKMPWRLHQNYMKDLRMLRYGRLDDSMEFKTVGHRQQIPDSRRTDLPKLAGDRESHLSSD

Samples

Sample ID Description Type Environment
1 2738541277 Variovorax sp. GV051 Isolate Unclassified
2 2738543019 Variovorax sp. GV040 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
93 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
94 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
102 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
103 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
129 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
146 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
147 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
148 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
149 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
156 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
164 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.62
Metatranscriptomes 0.95
Isolates 1.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.43
Nodule 0.48
Rhizoplane 6.19
Rhizosphere 88.1
Stem 0
Stem Tuber 0
Unclassified 3.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10024442 3300003203 Bacteria 2367
2 rootH2_10002097 3300003320 Bacteria 44862
3 Ga0065714_10002463 3300005288 Bacteria 17608
4 Ga0065712_10000246 3300005290 Bacteria 22122
5 Ga0065715_10117292 3300005293 Bacteria 2352
6 Ga0065707_10012747 3300005295 Bacteria 3122
7 Ga0065707_10102041 3300005295 Bacteria 2830
8 Ga0070690_100059009 3300005330 Bacteria 2466
9 Ga0070680_100101736 3300005336 Bacteria 2385
10 Ga0070682_100000491 3300005337 Bacteria 24828
11 Ga0070682_100003012 3300005337 Bacteria 9350
12 Ga0068868_100177926 3300005338 Bacteria 1763
13 Ga0070660_100001194 3300005339 Bacteria 17614
14 Ga0070660_100050391 3300005339 Bacteria 3204
15 Ga0070689_100000141 3300005340 Bacteria 41617
16 Ga0070689_100069404 3300005340 Bacteria 2749
17 Ga0070692_10011398 3300005345 Bacteria 4079
18 Ga0070675_100068722 3300005354 Bacteria 2934
19 Ga0070659_100041222 3300005366 Bacteria 3608
20 Ga0070705_100055341 3300005440 Bacteria 2331
21 Ga0070700_100000036 3300005441 Bacteria 111099
22 Ga0070694_100062465 3300005444 Bacteria 2545
23 Ga0070694_100161900 3300005444 Bacteria 1642
24 Ga0070681_10036563 3300005458 Bacteria 4931
25 Ga0070698_100025212 3300005471 Bacteria 6195
26 Ga0070699_100046240 3300005518 Bacteria 3767
27 Ga0070697_100197086 3300005536 Bacteria 1711
28 Ga0068853_100006787 3300005539 Bacteria 9124
29 Ga0068853_100171963 3300005539 Bacteria 1960
30 Ga0070686_100012782 3300005544 Bacteria 4791
31 Ga0070693_100012732 3300005547 Bacteria 4265
32 Ga0068855_100041060 3300005563 Bacteria 5485
33 Ga0068857_100019845 3300005577 Bacteria 5906
34 Ga0068856_100067766 3300005614 Bacteria 3527
35 Ga0070702_100096059 3300005615 Bacteria 1808
36 Ga0068859_100006576 3300005617 Bacteria 11795
37 Ga0068861_100007206 3300005719 Bacteria 7621
38 Ga0068851_10053448 3300005834 Bacteria 2056
39 Ga0068863_100057154 3300005841 Bacteria 3692
40 Ga0068860_100003335 3300005843 Bacteria 16533
41 Ga0068860_100061568 3300005843 Bacteria 3565
42 Ga0068860_100220793 3300005843 Bacteria 1840
43 Ga0068862_100012169 3300005844 Bacteria 7112
44 Ga0081538_10001537 3300005981 Bacteria 23667
45 Ga0081540_1012829 3300005983 Bacteria 5482
46 Ga0081539_10000487 3300005985 Bacteria 83994
47 Ga0075365_10041282 3300006038 Bacteria 3013
48 Ga0075363_100006526 3300006048 Bacteria 5306
49 Ga0075430_100026771 3300006846 Bacteria 4904
50 Ga0075431_100049553 3300006847 Bacteria 4330
51 Ga0075433_10011882 3300006852 Bacteria 7015
52 Ga0075434_100088233 3300006871 Bacteria 3102
53 Ga0075434_100231750 3300006871 Bacteria 1866
54 Ga0097620_100005947 3300006931 Bacteria 12385
55 Ga0097620_100006576 3300006931 Bacteria 11795
56 Ga0075435_100148913 3300007076 Unclassified 1967
57 Ga0099794_10044157 3300007265 Bacteria 2129
58 Ga0105240_10071240 3300009093 Bacteria 4299
59 Ga0111539_10006732 3300009094 Bacteria 14787
60 Ga0111539_10084715 3300009094 Bacteria 3726
61 Ga0111539_10371736 3300009094 Bacteria 1664
62 Ga0105247_10087851 3300009101 Bacteria 1969
63 Ga0114129_10012141 3300009147 Bacteria 12265
64 Ga0114129_10068026 3300009147 Bacteria 4967
65 Ga0114129_10140683 3300009147 Bacteria 3308
66 Ga0105243_10118335 3300009148 Bacteria 2229
67 Ga0105248_10001487 3300009177 Bacteria 26103
68 Ga0105248_10001999 3300009177 Bacteria 22692
69 Ga0105248_10040001 3300009177 Bacteria 5255
70 Ga0105237_10035532 3300009545 Bacteria 5042
71 Ga0105238_10091989 3300009551 Bacteria 3020
72 Ga0105238_10098906 3300009551 Bacteria 2901
73 Ga0105249_10065974 3300009553 Bacteria 3332
74 Ga0157373_10001090 3300013100 Bacteria 20911
75 Ga0157373_10035374 3300013100 Bacteria 3586
76 Ga0157369_10090209 3300013105 Bacteria 3273
77 Ga0157378_10127049 3300013297 Bacteria 2356
78 Ga0157372_10015206 3300013307 Bacteria 8242
79 Ga0157372_10080871 3300013307 Bacteria 3677
80 Ga0163163_10021145 3300014325 Bacteria 6138
81 Ga0157380_10011892 3300014326 Bacteria 6296
82 Ga0206356_11600226 3300020070 Bacteria 2837
83 Ga0206353_10074207 3300020082 Bacteria 4415
84 Ga0213872_10001807 3300021361 Bacteria 13310
85 Ga0213876_10014646 3300021384 Bacteria 4154
86 Ga0207653_10011478 3300025885 Bacteria 2764
87 Ga0207647_10002959 3300025904 Bacteria 12786
88 Ga0207643_10023653 3300025908 Bacteria 3388
89 Ga0207705_10005470 3300025909 Bacteria 9499
90 Ga0207671_10095085 3300025914 Bacteria 2250
91 Ga0207657_10011779 3300025919 Bacteria 8662
92 Ga0207652_10001577 3300025921 Bacteria 20046
93 Ga0207652_10047496 3300025921 Bacteria 3667
94 Ga0207659_10048605 3300025926 Bacteria 3006
95 Ga0207670_10003237 3300025936 Bacteria 8631
96 Ga0207711_10005327 3300025941 Bacteria 10909
97 Ga0207712_10052013 3300025961 Bacteria 2867
98 Ga0207703_10070934 3300026035 Bacteria 2876
99 Ga0207639_10053386 3300026041 Bacteria 3084
100 Ga0207639_10151443 3300026041 Bacteria 1943
101 Ga0207678_10176563 3300026067 Bacteria 1824
102 Ga0207708_10000016 3300026075 Bacteria 193989
103 Ga0207708_10028213 3300026075 Bacteria 4250
104 Ga0207708_10030432 3300026075 Bacteria 4092
105 Ga0207702_10055524 3300026078 Bacteria 3359
106 Ga0207702_10129265 3300026078 Bacteria 2271
107 Ga0207641_10037783 3300026088 Bacteria 4035
108 Ga0207641_10079903 3300026088 Bacteria 2836
109 Ga0207676_10001430 3300026095 Bacteria 17746
110 Ga0207676_10013887 3300026095 Bacteria 5782
111 Ga0207676_10044785 3300026095 Bacteria 3415
112 Ga0207674_10118831 3300026116 Bacteria 2613
113 Ga0207675_100013445 3300026118 Bacteria 7639
114 Ga0207675_100086291 3300026118 Bacteria 2947
115 Ga0207675_100161899 3300026118 Bacteria 2135
116 Ga0207428_10010034 3300027907 Bacteria 8477
117 Ga0207428_10043209 3300027907 Bacteria 3641
118 Ga0265327_10001511 3300031251 Bacteria 28784
119 Ga0307405_10051114 3300031731 Bacteria 2563
120 Ga0373951_0003079 3300035091 Bacteria 4115
121 Ga0373954_0026669 3300035118 Bacteria 2649
122 Ga0373946_0047774 3300035171 Bacteria 1779
123 Ga0373955_0024154 3300035172 Bacteria 3105
124 Ga0373927_0027037 3300035695 Bacteria 3749
125 Ga0373933_0000258 3300035724 Bacteria 34845
126 Ga0373947_0011872 3300035725 Bacteria 4992
127 Ga0373937_0003377 3300036401 Bacteria 13398
128 Ga0436365_1118797 3300039437 Bacteria 12523
129 Ga0436365_1429123 3300039437 Bacteria 8655
130 Ga0436361_0907623 3300039447 Bacteria 31912
131 Ga0451849_0365077 3300041505 Bacteria 4991
132 Ga0439448_0017693 3300042005 Bacteria 2178
133 Ga0466959_0090617 3300045049 Bacteria 2196
134 Ga0495592_0005690 3300046454 Bacteria 9219
135 Ga0495592_0124285 3300046454 Bacteria 1812
136 Ga0495629_0003882 3300046459 Bacteria 11265
137 Ga0495651_0006829 3300046462 Bacteria 8717
138 Ga0495653_0014043 3300046463 Bacteria 6530
139 Ga0495608_0000398 3300046511 Bacteria 30359
140 Ga0495618_0027408 3300046514 Bacteria 3546
141 Ga0495652_0008034 3300046529 Bacteria 9669
142 Ga0495640_0006657 3300046533 Bacteria 9116
143 Ga0495587_0014641 3300046536 Bacteria 4913
144 Ga0495645_0003922 3300046543 Bacteria 10140
145 Ga0495667_0004166 3300046559 Bacteria 9734
146 Ga0495634_0016057 3300046642 Bacteria 5362
147 Ga0495635_0003457 3300046663 Bacteria 10912
148 Ga0495657_0004951 3300046675 Bacteria 10587
149 Ga0495599_0020781 3300046678 Bacteria 4090
150 Ga0495623_0010396 3300046679 Bacteria 6022
151 Ga0495613_0018419 3300046689 Bacteria 5208
152 Ga0495624_0043399 3300046690 Bacteria 2869
153 Ga0495600_0004966 3300046809 Bacteria 7987
154 Ga0495581_0050840 3300047315 Bacteria 2394
155 Ga0495581_0072852 3300047315 Bacteria 1988
156 Ga0495604_0001079 3300047317 Bacteria 22620
157 Ga0495676_0057714 3300047321 Bacteria 3059
158 Ga0495680_0000313 3300047322 Bacteria 54486
159 Ga0495675_0001927 3300047444 Bacteria 12370
160 Ga0495684_0014015 3300047471 Bacteria 6167
161 Ga0495602_0003638 3300048088 Bacteria 15973
162 Ga0496102_0062707 3300048905 Bacteria 3404
163 Ga0496104_0010267 3300048907 Bacteria 8365
164 Ga0496105_0000789 3300048908 Bacteria 21424
165 Ga0496108_0008735 3300048911 Bacteria 8214
166 Ga0496108_0033073 3300048911 Bacteria 4296
167 Ga0496109_0000895 3300048912 Bacteria 24890
168 Ga0496109_0076122 3300048912 Bacteria 3086
169 Ga0496110_0015431 3300048913 Bacteria 6357
170 Ga0496111_0000454 3300048914 Bacteria 20869
171 Ga0496111_0016402 3300048914 Bacteria 5103
172 Ga0496112_0001365 3300048915 Bacteria 18588
173 Ga0496113_0001465 3300048916 Bacteria 13158
174 Ga0496115_0006827 3300048918 Bacteria 8377
175 Ga0496126_0000525 3300048929 Bacteria 74677
176 Ga0501033_0023214 3300049570 Bacteria 4679
177 Ga0501036_0149124 3300049572 Bacteria 1973
178 Ga0501070_0000075 3300049586 Bacteria 84188
179 Ga0501202_019006 3300049652 Bacteria 1354
180 Ga0501207_007953 3300049654 Bacteria 1523
181 Ga0501217_008205 3300049661 Bacteria 2251
182 Ga0501217_010000 3300049661 Bacteria 2071
183 Ga0501235_011879 3300049669 Bacteria 1913
184 Ga0501257_022106 3300049686 Bacteria 1503
185 Ga0501080_0002868 3300049742 Bacteria 15165
186 Ga0501035_0000741 3300049822 Bacteria 35180
187 Ga0501044_0001515 3300049823 Bacteria 27243
188 nmdc:mga0yw44_67620_c1 3300050492 Bacteria 2209
189 nmdc:mga05p37_19342_c1 3300050507 Bacteria 8237
190 nmdc:mga05p37_272328_c1 3300050507 Bacteria 2022
191 nmdc:mga05p37_321925_c1 3300050507 Bacteria 1830
192 nmdc:mga0qj67_87430_c1 3300050509 Bacteria 2501
193 nmdc:mga06r32_179978_c1 3300050510 Bacteria 2099
194 nmdc:mga08y16_11466_c1 3300050511 Bacteria 9315
195 nmdc:mga08y16_201356_c1 3300050511 Bacteria 2063
196 nmdc:mga08y16_38753_c1 3300050511 Bacteria 5002
197 nmdc:mga0n895_15615_c1 3300050512 Bacteria 4316
198 nmdc:mga0n895_50089_c1 3300050512 Bacteria 4094
199 nmdc:mga0a205_102116_c1 3300050515 Bacteria 2767
200 nmdc:mga0a205_16167_c1 3300050515 Bacteria 6987
201 nmdc:mga0a205_269972_c1 3300050515 Bacteria 1578
202 nmdc:mga0a205_44773_c1 3300050515 Bacteria 4267
203 Ga0495601_0004120 3300053077 Bacteria 8374
204 Ga0495595_0001625 3300053084 Bacteria 8783
205 Ga0495619_0001467 3300053085 Bacteria 15543
206 Ga0495619_0116268 3300053085 Bacteria 1831
207 Ga0530510_0057445 3300061734 Bacteria 2812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10127049 Ga0157378_101270492 424
2 3300049652 Ga0501202_019006 Ga0501202_019006_57_1340 427
3 3300050512 nmdc:mga0n895_50089_c1 nmdc:mga0n895_50089_c1_2775_4070 430
4 3300013100 Ga0157373_10001090 Ga0157373_1000109014 432
5 3300009094 Ga0111539_10006732 Ga0111539_1000673211 433
6 3300049654 Ga0501207_007953 Ga0501207_007953_44_1357 433
7 3300050511 nmdc:mga08y16_11466_c1 nmdc:mga08y16_11466_c1_1645_2952 433
8 3300050511 nmdc:mga08y16_38753_c1 nmdc:mga08y16_38753_c1_3198_4607 433
9 3300009094 Ga0111539_10084715 Ga0111539_100847153 435
10 3300009101 Ga0105247_10087851 Ga0105247_100878511 435
11 3300050515 nmdc:mga0a205_269972_c1 nmdc:mga0a205_269972_c1_24_1334 435
12 3300009147 Ga0114129_10068026 Ga0114129_100680263 441
13 3300049686 Ga0501257_022106 Ga0501257_022106_89_1426 445
14 3300027907 Ga0207428_10043209 Ga0207428_100432093 451
15 3300050507 nmdc:mga05p37_272328_c1 nmdc:mga05p37_272328_c1_580_1947 451
16 3300031731 Ga0307405_10051114 Ga0307405_100511143 453
17 3300007076 Ga0075435_100148913 Ga0075435_1001489132 457
18 3300025961 Ga0207712_10052013 Ga0207712_100520133 457
19 3300005293 Ga0065715_10117292 Ga0065715_101172922 458
20 3300005330 Ga0070690_100059009 Ga0070690_1000590091 458
21 3300005338 Ga0068868_100177926 Ga0068868_1001779261 458
22 3300005288 Ga0065714_10002463 Ga0065714_100024635 475
23 3300005290 Ga0065712_10000246 Ga0065712_100002469 475
24 3300046454 Ga0495592_0124285 Ga0495592_0124285_14_1519 475
25 3300009177 Ga0105248_10001999 Ga0105248_1000199912 476
26 3300005295 Ga0065707_10102041 Ga0065707_101020412 477
27 3300005340 Ga0070689_100000141 Ga0070689_10000014114 478
28 3300005354 Ga0070675_100068722 Ga0070675_1000687222 478
29 3300025926 Ga0207659_10048605 Ga0207659_100486051 478
30 3300005539 Ga0068853_100171963 Ga0068853_1001719631 480
31 3300005614 Ga0068856_100067766 Ga0068856_1000677663 480
32 3300006871 Ga0075434_100231750 Ga0075434_1002317501 480
33 3300013307 Ga0157372_10080871 Ga0157372_100808711 480
34 3300026041 Ga0207639_10151443 Ga0207639_101514431 480
35 3300026078 Ga0207702_10129265 Ga0207702_101292651 480
36 3300041505 Ga0451849_0365077 Ga0451849_0365077_2113_3561 480
37 3300042005 Ga0439448_0017693 Ga0439448_0017693_293_1735 480
38 3300047315 Ga0495581_0072852 Ga0495581_0072852_507_1961 480
39 3300047321 Ga0495676_0057714 Ga0495676_0057714_275_1729 480
40 3300048905 Ga0496102_0062707 Ga0496102_0062707_196_1659 480
41 3300048907 Ga0496104_0010267 Ga0496104_0010267_2823_4277 480
42 3300048908 Ga0496105_0000789 Ga0496105_0000789_17127_18581 480
43 3300048911 Ga0496108_0008735 Ga0496108_0008735_3614_5068 480
44 3300048912 Ga0496109_0000895 Ga0496109_0000895_4367_5821 480
45 3300048913 Ga0496110_0015431 Ga0496110_0015431_2689_4143 480
46 3300048914 Ga0496111_0000454 Ga0496111_0000454_2277_3731 480
47 3300048915 Ga0496112_0001365 Ga0496112_0001365_14886_16340 480
48 3300048916 Ga0496113_0001465 Ga0496113_0001465_9489_10943 480
49 3300048918 Ga0496115_0006827 Ga0496115_0006827_2836_4290 480
50 3300050515 nmdc:mga0a205_102116_c1 nmdc:mga0a205_102116_c1_1196_2638 480
51 3300050515 nmdc:mga0a205_44773_c1 nmdc:mga0a205_44773_c1_1539_2993 480
52 iso_pu_bacteria 8055157932 8055158203 480
53 3300005544 Ga0070686_100012782 Ga0070686_1000127824 481
54 3300006931 Ga0097620_100005947 Ga0097620_1000059478 481
55 3300009094 Ga0111539_10371736 Ga0111539_103717362 481
56 3300014325 Ga0163163_10021145 Ga0163163_100211454 481
57 3300026088 Ga0207641_10037783 Ga0207641_100377832 481
58 3300026095 Ga0207676_10001430 Ga0207676_1000143013 481
59 3300050511 nmdc:mga08y16_201356_c1 nmdc:mga08y16_201356_c1_535_1989 481
60 3300005337 Ga0070682_100003012 Ga0070682_10000301211 482
61 3300005440 Ga0070705_100055341 Ga0070705_1000553412 482
62 3300005444 Ga0070694_100161900 Ga0070694_1001619001 482
63 3300005834 Ga0068851_10053448 Ga0068851_100534482 482
64 3300006852 Ga0075433_10011882 Ga0075433_100118823 482
65 3300006871 Ga0075434_100088233 Ga0075434_1000882333 482
66 3300009147 Ga0114129_10012141 Ga0114129_100121417 482
67 3300009545 Ga0105237_10035532 Ga0105237_100355322 482
68 3300025885 Ga0207653_10011478 Ga0207653_100114783 482
69 3300025914 Ga0207671_10095085 Ga0207671_100950853 482
70 3300026035 Ga0207703_10070934 Ga0207703_100709342 482
71 3300026075 Ga0207708_10028213 Ga0207708_100282136 482
72 3300050507 nmdc:mga05p37_19342_c1 nmdc:mga05p37_19342_c1_803_2293 482
73 3300050512 nmdc:mga0n895_15615_c1 nmdc:mga0n895_15615_c1_1538_3028 482
74 3300050515 nmdc:mga0a205_16167_c1 nmdc:mga0a205_16167_c1_1533_3023 482
75 3300005441 Ga0070700_100000036 Ga0070700_10000003679 483
76 3300005719 Ga0068861_100007206 Ga0068861_1000072063 483
77 3300006038 Ga0075365_10041282 Ga0075365_100412822 483
78 3300025936 Ga0207670_10003237 Ga0207670_100032373 483
79 3300026075 Ga0207708_10000016 Ga0207708_1000001698 483
80 3300026118 Ga0207675_100013445 Ga0207675_1000134453 483
81 3300050492 nmdc:mga0yw44_67620_c1 nmdc:mga0yw44_67620_c1_34_1536 483
82 3300003320 rootH2_10002097 rootH2_1000209720 484
83 3300005615 Ga0070702_100096059 Ga0070702_1000960591 484
84 3300005617 Ga0068859_100006576 Ga0068859_10000657611 484
85 3300006931 Ga0097620_100006576 Ga0097620_10000657611 484
86 3300025941 Ga0207711_10005327 Ga0207711_1000532712 484
87 3300053085 Ga0495619_0116268 Ga0495619_0116268_193_1695 484
88 iso_pu_bacteria 2738541277 2738717960 484
89 iso_pu_bacteria 2738543019 2739278646 484
90 3300005547 Ga0070693_100012732 Ga0070693_1000127322 485
91 3300005843 Ga0068860_100220793 Ga0068860_1002207931 485
92 3300005340 Ga0070689_100069404 Ga0070689_1000694042 486
93 3300009553 Ga0105249_10065974 Ga0105249_100659741 486
94 3300025908 Ga0207643_10023653 Ga0207643_100236532 486
95 3300025921 Ga0207652_10047496 Ga0207652_100474962 486
96 3300026095 Ga0207676_10044785 Ga0207676_100447852 486
97 3300005339 Ga0070660_100050391 Ga0070660_1000503913 487
98 3300005366 Ga0070659_100041222 Ga0070659_1000412223 487
99 3300005843 Ga0068860_100061568 Ga0068860_1000615683 487
100 3300013105 Ga0157369_10090209 Ga0157369_100902092 487
101 3300020070 Ga0206356_11600226 Ga0206356_116002262 487
102 3300020082 Ga0206353_10074207 Ga0206353_100742073 487
103 3300026078 Ga0207702_10055524 Ga0207702_100555243 487
104 3300026116 Ga0207674_10118831 Ga0207674_101188313 487
105 3300027907 Ga0207428_10010034 Ga0207428_100100347 487
106 3300026095 Ga0207676_10013887 Ga0207676_100138872 488
107 3300026118 Ga0207675_100161899 Ga0207675_1001618992 488
108 3300035118 Ga0373954_0026669 Ga0373954_0026669_1109_2584 488
109 3300035171 Ga0373946_0047774 Ga0373946_0047774_164_1639 488
110 3300035172 Ga0373955_0024154 Ga0373955_0024154_186_1661 488
111 3300035695 Ga0373927_0027037 Ga0373927_0027037_937_2412 488
112 3300035724 Ga0373933_0000258 Ga0373933_0000258_25063_26538 488
113 3300035725 Ga0373947_0011872 Ga0373947_0011872_1969_3444 488
114 3300036401 Ga0373937_0003377 Ga0373937_0003377_3255_4730 488
115 3300046454 Ga0495592_0005690 Ga0495592_0005690_2101_3576 488
116 3300046459 Ga0495629_0003882 Ga0495629_0003882_2128_3603 488
117 3300046462 Ga0495651_0006829 Ga0495651_0006829_4133_5608 488
118 3300046463 Ga0495653_0014043 Ga0495653_0014043_3109_4584 488
119 3300046511 Ga0495608_0000398 Ga0495608_0000398_4392_5867 488
120 3300046514 Ga0495618_0027408 Ga0495618_0027408_195_1670 488
121 3300046529 Ga0495652_0008034 Ga0495652_0008034_4952_6427 488
122 3300046533 Ga0495640_0006657 Ga0495640_0006657_4260_5735 488
123 3300046536 Ga0495587_0014641 Ga0495587_0014641_3110_4585 488
124 3300046543 Ga0495645_0003922 Ga0495645_0003922_3968_5443 488
125 3300046559 Ga0495667_0004166 Ga0495667_0004166_2810_4285 488
126 3300046642 Ga0495634_0016057 Ga0495634_0016057_467_1942 488
127 3300046663 Ga0495635_0003457 Ga0495635_0003457_5968_7443 488
128 3300046675 Ga0495657_0004951 Ga0495657_0004951_5409_6884 488
129 3300046678 Ga0495599_0020781 Ga0495599_0020781_1164_2639 488
130 3300046679 Ga0495623_0010396 Ga0495623_0010396_1465_2940 488
131 3300046689 Ga0495613_0018419 Ga0495613_0018419_1717_3192 488
132 3300046690 Ga0495624_0043399 Ga0495624_0043399_868_2343 488
133 3300046809 Ga0495600_0004966 Ga0495600_0004966_4946_6421 488
134 3300047315 Ga0495581_0050840 Ga0495581_0050840_740_2215 488
135 3300047317 Ga0495604_0001079 Ga0495604_0001079_10923_12398 488
136 3300047322 Ga0495680_0000313 Ga0495680_0000313_3388_4863 488
137 3300047444 Ga0495675_0001927 Ga0495675_0001927_5672_7147 488
138 3300047471 Ga0495684_0014015 Ga0495684_0014015_1468_2943 488
139 3300048088 Ga0495602_0003638 Ga0495602_0003638_6443_7918 488
140 3300049572 Ga0501036_0149124 Ga0501036_0149124_161_1651 488
141 3300049586 Ga0501070_0000075 Ga0501070_0000075_27123_28649 488
142 3300049742 Ga0501080_0002868 Ga0501080_0002868_8657_10183 488
143 3300049822 Ga0501035_0000741 Ga0501035_0000741_32920_34446 488
144 3300049823 Ga0501044_0001515 Ga0501044_0001515_5218_6744 488
145 3300053077 Ga0495601_0004120 Ga0495601_0004120_5368_6843 488
146 3300053084 Ga0495595_0001625 Ga0495595_0001625_3895_5370 488
147 3300053085 Ga0495619_0001467 Ga0495619_0001467_7487_8962 488
148 3300005471 Ga0070698_100025212 Ga0070698_1000252121 489
149 3300005518 Ga0070699_100046240 Ga0070699_1000462401 489
150 3300005983 Ga0081540_1012829 Ga0081540_10128295 489
151 3300021361 Ga0213872_10001807 Ga0213872_100018077 489
152 3300039447 Ga0436361_0907623 Ga0436361_0907623_17171_18664 489
153 3300005336 Ga0070680_100101736 Ga0070680_1001017362 490
154 3300005337 Ga0070682_100000491 Ga0070682_10000049111 490
155 3300005339 Ga0070660_100001194 Ga0070660_10000119416 490
156 3300005345 Ga0070692_10011398 Ga0070692_100113983 490
157 3300005444 Ga0070694_100062465 Ga0070694_1000624654 490
158 3300005458 Ga0070681_10036563 Ga0070681_100365635 490
159 3300005539 Ga0068853_100006787 Ga0068853_1000067878 490
160 3300005563 Ga0068855_100041060 Ga0068855_1000410605 490
161 3300005843 Ga0068860_100003335 Ga0068860_10000333511 490
162 3300005981 Ga0081538_10001537 Ga0081538_1000153714 490
163 3300006048 Ga0075363_100006526 Ga0075363_1000065262 490
164 3300009093 Ga0105240_10071240 Ga0105240_100712401 490
165 3300009147 Ga0114129_10140683 Ga0114129_101406832 490
166 3300009551 Ga0105238_10091989 Ga0105238_100919893 490
167 3300009551 Ga0105238_10098906 Ga0105238_100989062 490
168 3300013307 Ga0157372_10015206 Ga0157372_100152065 490
169 3300025904 Ga0207647_10002959 Ga0207647_100029597 490
170 3300025909 Ga0207705_10005470 Ga0207705_100054704 490
171 3300025919 Ga0207657_10011779 Ga0207657_100117797 490
172 3300025921 Ga0207652_10001577 Ga0207652_1000157720 490
173 3300026041 Ga0207639_10053386 Ga0207639_100533861 490
174 3300026067 Ga0207678_10176563 Ga0207678_101765632 490
175 3300031251 Ga0265327_10001511 Ga0265327_1000151122 490
176 3300039437 Ga0436365_1118797 Ga0436365_1118797_5146_6642 490
177 3300045049 Ga0466959_0090617 Ga0466959_0090617_510_2003 490
178 3300048911 Ga0496108_0033073 Ga0496108_0033073_1676_3199 490
179 3300048912 Ga0496109_0076122 Ga0496109_0076122_1165_2688 490
180 3300048914 Ga0496111_0016402 Ga0496111_0016402_2865_4373 490
181 3300049570 Ga0501033_0023214 Ga0501033_0023214_2673_4169 490
182 3300050507 nmdc:mga05p37_321925_c1 nmdc:mga05p37_321925_c1_300_1784 490
183 3300050509 nmdc:mga0qj67_87430_c1 nmdc:mga0qj67_87430_c1_598_2097 490
184 3300005295 Ga0065707_10012747 Ga0065707_100127472 491
185 3300005844 Ga0068862_100012169 Ga0068862_1000121692 491
186 3300014326 Ga0157380_10011892 Ga0157380_100118922 491
187 3300026075 Ga0207708_10030432 Ga0207708_100304322 491
188 3300026118 Ga0207675_100086291 Ga0207675_1000862911 491
189 3300061734 Ga0530510_0057445 Ga0530510_0057445_1027_2505 491
190 3300003203 JGI25406J46586_10024442 JGI25406J46586_100244422 492
191 3300005536 Ga0070697_100197086 Ga0070697_1001970861 492
192 3300005577 Ga0068857_100019845 Ga0068857_1000198452 492
193 3300005841 Ga0068863_100057154 Ga0068863_1000571542 492
194 3300005985 Ga0081539_10000487 Ga0081539_1000048779 492
195 3300006846 Ga0075430_100026771 Ga0075430_1000267712 492
196 3300006847 Ga0075431_100049553 Ga0075431_1000495534 492
197 3300007265 Ga0099794_10044157 Ga0099794_100441571 492
198 3300009148 Ga0105243_10118335 Ga0105243_101183352 492
199 3300009177 Ga0105248_10001487 Ga0105248_1000148711 492
200 3300009177 Ga0105248_10040001 Ga0105248_100400013 492
201 3300013100 Ga0157373_10035374 Ga0157373_100353741 492
202 3300021384 Ga0213876_10014646 Ga0213876_100146464 492
203 3300026088 Ga0207641_10079903 Ga0207641_100799032 492
204 3300035091 Ga0373951_0003079 Ga0373951_0003079_1135_2625 492
205 3300039437 Ga0436365_1429123 Ga0436365_1429123_5936_7567 492
206 3300048929 Ga0496126_0000525 Ga0496126_0000525_70536_72050 492
207 3300049661 Ga0501217_008205 Ga0501217_008205_466_1992 492
208 3300049661 Ga0501217_010000 Ga0501217_010000_44_1552 492
209 3300049669 Ga0501235_011879 Ga0501235_011879_298_1788 492
210 3300050510 nmdc:mga06r32_179978_c1 nmdc:mga06r32_179978_c1_248_1759 492

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

8

70

0.92

PF00743

FMO-like

Flavin-binding monooxygenase-like

131

436

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d4v-assembly2.cif.gz_D hcgc with sah and a guanylylpyridinol (gp) derivative 0.8829 175 206
2cdb-assembly1.cif.gz_C sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp and glucose 0.847 177 207
2cdb-assembly1.cif.gz_A sulfolobus solfataricus glucose dehydrogenase 1 in complex with nadp and glucose 0.8459 177 207
1l7e-assembly2.cif.gz_C crystal structure of r. rubrum transhydrogenase domain i with bound nadh 0.8424 177 206
6isv-assembly1.cif.gz_B structure of acetophenone reductase from geotrichum candidum nbrc 4597 in complex with nad 0.8406 173 207
ID Description Score Start End Superfamily
af_O53762_6_249_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9832 2 244 3.50.50.60
af_P9WNF7_1_267_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9742 2 261 3.50.50.60
af_P9WNF9_1_152_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9723 2 152 3.50.50.60
af_O53762_6_249_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9673 2 244 3.50.50.60
af_O53762_250_486_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9621 248 482 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A257UTC5-F1-model_v4 FAD-containing monooxygenase EthA 0.9913 2 484 GO:0004499
GO:0050660
GO:0050661
AF-A4YYE0-F1-model_v4 Putative Flavin-containing monooxygenase (EC 1.14.-.-) 0.9872 2 480 GO:0004499
GO:0050660
GO:0050661
AF-A0A7W6WU08-F1-model_v4 Cation diffusion facilitator CzcD-associated flavoprotein CzcO 0.9867 148 480 GO:0004499
GO:0050660
GO:0050661
AF-A0A520S7N3-F1-model_v4 NAD(P)/FAD-dependent oxidoreductase 0.9865 2 480 GO:0004499
GO:0050660
GO:0050661
AF-A9AVC0-F1-model_v4 FAD dependent oxidoreductase 0.986 2 482 GO:0004497

Feature Viewer

pLDDT pTM Quality
90.26 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map