F319714

General Info

Members Datasets Scaffolds Average Seq Length
209 150 418 260

Family's Representative Sequence

Representative Sequence 3300053159|Ga0500630_030686|Ga0500630_030686_756_1670
Length 304
Sequence VAANESRDLARDRKRDLHGPSLQGRYLAGMRCRVRSCYGAGVTPPYPDLERTDATYGGVTRTVFRGGAGPAVIVIHELPGLYPAVVDFGRFLIAAGMTVYFPSLCGDPGRARSAGYILGSIARACVSREFATWATRKTSPIVTWLRALARDAHAACGGPGVGAIGMCLTGGFALAMMVDDTVVAPVLSQPSLPFPVSRAHRRDLGISDADLVQVKARCAAGTPVMGLRFTGDRNSPADRFARLREELGDRFLGIEIDSSPGNPFGVPPDAHSVVTHHLVDEPGHPTRIALDRVIAFFRERLAIA

Samples

Sample ID Description Type Environment
1 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
64 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
66 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
67 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
68 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
69 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
70 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
71 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
79 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
80 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
81 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
82 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
83 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
84 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
86 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
104 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
111 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
112 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
115 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
136 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
145 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
146 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
147 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.83
Nodule 0
Rhizoplane 4.78
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500630_030686 3300053159 Bacteria 2643
2 JGI25407J50210_10000320 3300003373 Bacteria 8895
3 JGI25407J50210_10006929 3300003373 Bacteria 2833
4 JGI25407J50210_10008102 3300003373 Bacteria 2645
5 JGI25407J50210_10015456 3300003373 Bacteria 1971
6 Ga0070683_100236743 3300005329 Bacteria 1736
7 Ga0070690_100000825 3300005330 Bacteria 15727
8 Ga0068869_100238483 3300005334 Bacteria 1448
9 Ga0070680_100000053 3300005336 Bacteria 59633
10 Ga0070692_10228165 3300005345 Bacteria 1104
11 Ga0070671_100004597 3300005355 Bacteria 10939
12 Ga0070700_100506127 3300005441 Unclassified 930
13 Ga0070694_100482290 3300005444 Bacteria 984
14 Ga0070708_100178523 3300005445 Bacteria 1984
15 Ga0070681_10000025 3300005458 Bacteria 110322
16 Ga0070685_10281024 3300005466 Bacteria 1114
17 Ga0070707_100229137 3300005468 Bacteria 1809
18 Ga0070698_100066172 3300005471 Bacteria 3638
19 Ga0070679_100000071 3300005530 Bacteria 76030
20 Ga0070684_100092160 3300005535 Bacteria 2696
21 Ga0070684_100254646 3300005535 Bacteria 1605
22 Ga0070697_100433563 3300005536 Bacteria 1143
23 Ga0070693_100027061 3300005547 Bacteria 3103
24 Ga0070704_100507331 3300005549 Bacteria 1048
25 Ga0068859_100221996 3300005617 Bacteria 1977
26 Ga0068864_100037356 3300005618 Bacteria 4145
27 Ga0068864_100676056 3300005618 Bacteria 1007
28 Ga0068861_100099204 3300005719 Bacteria 2313
29 Ga0068863_100360922 3300005841 Bacteria 1416
30 Ga0068863_100515916 3300005841 Bacteria 1178
31 Ga0068858_100052770 3300005842 Bacteria 3762
32 Ga0068860_100009244 3300005843 Bacteria 9798
33 Ga0068860_100026370 3300005843 Bacteria 5603
34 Ga0081455_10038867 3300005937 Bacteria 4212
35 Ga0081538_10000994 3300005981 Bacteria 30109
36 Ga0070717_10026307 3300006028 Bacteria 4641
37 Ga0075365_10066267 3300006038 Bacteria 2422
38 Ga0075365_10079922 3300006038 Bacteria 2213
39 Ga0075365_10121171 3300006038 Bacteria 1804
40 Ga0075365_10251680 3300006038 Bacteria 1241
41 Ga0075365_10339599 3300006038 Bacteria 1058
42 Ga0075368_10004823 3300006042 Bacteria 4596
43 Ga0075363_100006835 3300006048 Bacteria 5215
44 Ga0075364_10055145 3300006051 Bacteria 2600
45 Ga0070712_100144358 3300006175 Bacteria 1820
46 Ga0075367_10162644 3300006178 Bacteria 1388
47 Ga0075370_10056995 3300006353 Bacteria 2220
48 Ga0075428_100008722 3300006844 Bacteria 11250
49 Ga0075428_100182135 3300006844 Bacteria 2273
50 Ga0075430_100039173 3300006846 Bacteria 4014
51 Ga0075430_100479222 3300006846 Bacteria 1027
52 Ga0075431_100136781 3300006847 Bacteria 2526
53 Ga0075431_100258740 3300006847 Bacteria 1767
54 Ga0097620_100221999 3300006931 Bacteria 1977
55 Ga0111539_10267766 3300009094 Bacteria 1989
56 Ga0105245_10038112 3300009098 Bacteria 4276
57 Ga0105245_10340869 3300009098 Bacteria 1482
58 Ga0105245_10407108 3300009098 Bacteria 1361
59 Ga0114129_10037651 3300009147 Bacteria 6829
60 Ga0114129_10290826 3300009147 Bacteria 2180
61 Ga0105243_10027260 3300009148 Bacteria 4375
62 Ga0105243_10338812 3300009148 Bacteria 1377
63 Ga0105242_10845385 3300009176 Bacteria 910
64 Ga0105249_10032604 3300009553 Bacteria 4713
65 Ga0105249_10170064 3300009553 Bacteria 2112
66 Ga0105249_10188879 3300009553 Bacteria 2010
67 Ga0105246_10590011 3300011119 Bacteria 958
68 Ga0163163_10190775 3300014325 Bacteria 2098
69 Ga0163161_10027730 3300017792 Bacteria 4018
70 Ga0213876_10127489 3300021384 Bacteria 1352
71 Ga0207645_10051922 3300025907 Bacteria 2620
72 Ga0207707_10000023 3300025912 Bacteria 183706
73 Ga0207707_10434114 3300025912 Bacteria 1125
74 Ga0207660_10003837 3300025917 Bacteria 9798
75 Ga0207652_10000039 3300025921 Bacteria 131660
76 Ga0207652_10152027 3300025921 Bacteria 2073
77 Ga0207646_10057100 3300025922 Bacteria 3488
78 Ga0207650_10575626 3300025925 Bacteria 945
79 Ga0207687_10018687 3300025927 Bacteria 4580
80 Ga0207670_10165904 3300025936 Bacteria 1652
81 Ga0207691_10145274 3300025940 Bacteria 2088
82 Ga0207691_10471281 3300025940 Bacteria 1068
83 Ga0207712_10067183 3300025961 Bacteria 2565
84 Ga0207703_10007405 3300026035 Bacteria 8720
85 Ga0207675_100047026 3300026118 Bacteria 4030
86 Ga0207428_10151482 3300027907 Bacteria 1765
87 Ga0268264_10000155 3300028381 Bacteria 156029
88 Ga0307515_10001985 3300028794 Bacteria 45299
89 Ga0265338_10001109 3300028800 Bacteria 44693
90 Ga0265338_10160424 3300028800 Bacteria 1737
91 Ga0265325_10001544 3300031241 Bacteria 16096
92 Ga0265325_10001631 3300031241 Bacteria 15634
93 Ga0265340_10001733 3300031247 Bacteria 12505
94 Ga0265340_10046928 3300031247 Bacteria 2106
95 Ga0265339_10007099 3300031249 Bacteria 7272
96 Ga0265339_10016724 3300031249 Bacteria 4365
97 Ga0265331_10081209 3300031250 Bacteria 1506
98 Ga0265327_10004589 3300031251 Bacteria 12151
99 Ga0265316_10066022 3300031344 Bacteria 2801
100 Ga0265316_10190376 3300031344 Bacteria 1524
101 Ga0265316_10252284 3300031344 Bacteria 1295
102 Ga0307509_10000330 3300031507 Bacteria 78146
103 Ga0307509_10095007 3300031507 Bacteria 3038
104 Ga0307509_10114925 3300031507 Bacteria 2685
105 Ga0265313_10000462 3300031595 Bacteria 42851
106 Ga0265313_10019276 3300031595 Bacteria 3802
107 Ga0265313_10143638 3300031595 Bacteria 1025
108 Ga0265314_10023951 3300031711 Bacteria 4640
109 Ga0265342_10013554 3300031712 Bacteria 5461
110 Ga0307516_10023298 3300031730 Bacteria 6351
111 Ga0307410_10007869 3300031852 Bacteria 5869
112 Ga0307406_10235506 3300031901 Bacteria 1370
113 Ga0307409_100013157 3300031995 Bacteria 5310
114 Ga0307411_10037896 3300032005 Bacteria 3036
115 Ga0307415_100008910 3300032126 Bacteria 5590
116 Ga0373949_0000041 3300035090 Bacteria 46493
117 Ga0373936_0000009 3300035113 Bacteria 263478
118 Ga0373941_0001801 3300035115 Bacteria 4613
119 Ga0373961_0000005 3300035241 Bacteria 146538
120 Ga0316574_0011151 3300035398 Bacteria 5100
121 Ga0373927_0580542 3300035695 Bacteria 741
122 Ga0373937_0046956 3300036401 Bacteria 3950
123 Ga0373925_0079075 3300037068 Bacteria 2498
124 Ga0436365_0849258 3300039437 Bacteria 6270
125 Ga0436365_0905536 3300039437 Bacteria 5180
126 Ga0436362_0626229 3300039453 Bacteria 2018
127 Ga0439451_014304 3300042009 Bacteria 1601
128 Ga0439463_045348 3300042016 Bacteria 1120
129 Ga0439440_0085620 3300042993 Bacteria 839
130 Ga0466966_0039455 3300044684 Bacteria 3041
131 Ga0466967_0104979 3300045976 Bacteria 2588
132 Ga0495629_0141754 3300046459 Bacteria 1672
133 Ga0495628_0312666 3300046516 Bacteria 1161
134 Ga0495630_0205017 3300046517 Bacteria 1505
135 Ga0495635_0098797 3300046663 Bacteria 1995
136 Ga0495613_0154080 3300046689 Bacteria 1638
137 Ga0495624_0092166 3300046690 Bacteria 1869
138 Ga0495649_0155831 3300046694 Bacteria 1199
139 Ga0495674_0304275 3300047319 Bacteria 1302
140 Ga0495676_0041922 3300047321 Bacteria 3763
141 Ga0495680_0065474 3300047322 Bacteria 2783
142 Ga0496102_0094086 3300048905 Bacteria 2776
143 Ga0496105_0054336 3300048908 Bacteria 3307
144 Ga0496108_0101262 3300048911 Bacteria 2458
145 Ga0496109_0311580 3300048912 Bacteria 1485
146 Ga0496109_0325909 3300048912 Bacteria 1450
147 Ga0496110_0260635 3300048913 Bacteria 1578
148 Ga0496111_0286688 3300048914 Bacteria 1221
149 Ga0496112_0002365 3300048915 Bacteria 15156
150 Ga0496113_0379494 3300048916 Bacteria 1135
151 Ga0496114_0135685 3300048917 Bacteria 2128
152 Ga0496126_0000055 3300048929 Bacteria 297958
153 Ga0501033_0011671 3300049570 Bacteria 6718
154 Ga0501034_0001108 3300049571 Bacteria 37791
155 Ga0501034_0010604 3300049571 Bacteria 9589
156 Ga0501034_0090561 3300049571 Bacteria 3056
157 Ga0501034_0117171 3300049571 Bacteria 2651
158 Ga0501034_0286532 3300049571 Bacteria 1586
159 Ga0501034_0390882 3300049571 Bacteria 1315
160 Ga0501036_0063314 3300049572 Bacteria 3132
161 Ga0501037_0283698 3300049573 Bacteria 1153
162 Ga0501046_0041072 3300049580 Bacteria 3692
163 Ga0501046_0252159 3300049580 Bacteria 1299
164 Ga0501047_0014188 3300049581 Bacteria 7573
165 Ga0501047_0072433 3300049581 Bacteria 3317
166 Ga0501047_0238685 3300049581 Bacteria 1669
167 Ga0501047_0253502 3300049581 Bacteria 1608
168 Ga0501047_0744750 3300049581 Unclassified 796
169 Ga0501048_0277598 3300049582 Bacteria 1191
170 Ga0501069_0060309 3300049585 Bacteria 2118
171 Ga0501070_0035693 3300049586 Bacteria 4152
172 Ga0501071_0258370 3300049587 Bacteria 1315
173 Ga0501072_0042968 3300049588 Bacteria 3552
174 Ga0501075_0378919 3300049591 Bacteria 1078
175 Ga0501044_0002304 3300049823 Bacteria 21754
176 Ga0501044_0077984 3300049823 Bacteria 3358
177 Ga0501044_0103171 3300049823 Bacteria 2867
178 Ga0501045_0658376 3300049824 Bacteria 774
179 nmdc:mga03n38_196065_c1 3300050490 Bacteria 1043
180 nmdc:mga00v17_165697_c1 3300050491 Bacteria 1424
181 nmdc:mga00v17_59045_c1 3300050491 Bacteria 2352
182 nmdc:mga0yw44_127970_c1 3300050492 Bacteria 1642
183 nmdc:mga0yw44_1417_c1 3300050492 Bacteria 9512
184 nmdc:mga0yw44_19209_c1 3300050492 Bacteria 3763
185 nmdc:mga0yw44_267940_c1 3300050492 Bacteria 1140
186 nmdc:mga0yw44_368788_c1 3300050492 Bacteria 968
187 nmdc:mga0yw44_65362_c1 3300050492 Bacteria 2241
188 nmdc:mga06z11_85178_c1 3300050494 Bacteria 1705
189 nmdc:mga04h51_30901_c1 3300050495 Bacteria 1689
190 nmdc:mga07m45_37845_c1 3300050496 Bacteria 2691
191 nmdc:mga07m45_74623_c1 3300050496 Bacteria 1932
192 nmdc:mga05p37_368658_c1 3300050507 Bacteria 1686
193 nmdc:mga05p37_382787_c1 3300050507 Bacteria 1648
194 nmdc:mga09592_25033_c1 3300050508 Bacteria 4937
195 nmdc:mga06r32_127086_c1 3300050510 Bacteria 2519
196 nmdc:mga06r32_88270_c1 3300050510 Bacteria 3027
197 Ga0495601_0246564 3300053077 Bacteria 1166
198 Ga0495595_0221259 3300053084 Bacteria 945
199 Ga0495619_0080238 3300053085 Bacteria 2196
200 Ga0495619_0156925 3300053085 Bacteria 1570
201 Ga0500566_0034839 3300053094 Bacteria 2927
202 Ga0500566_0128460 3300053094 Bacteria 1359
203 Ga0500597_013093 3300053120 Bacteria 3068
204 Ga0500564_107575 3300053138 Bacteria 1227
205 Ga0500603_001189 3300053150 Bacteria 6038
206 Ga0500603_003093 3300053150 Bacteria 3592
207 Ga0500636_0095011 3300053177 Bacteria 1702
208 Ga0530510_0005941 3300061734 Bacteria 8466
209 3006321762 3006321560 Bacteria 8247479
210 Ga0500630_030686
211 JGI25407J50210_10000320
212 JGI25407J50210_10006929
213 JGI25407J50210_10008102
214 JGI25407J50210_10015456
215 Ga0070683_100236743
216 Ga0070690_100000825
217 Ga0068869_100238483
218 Ga0070680_100000053
219 Ga0070692_10228165
220 Ga0070671_100004597
221 Ga0070700_100506127
222 Ga0070694_100482290
223 Ga0070708_100178523
224 Ga0070681_10000025
225 Ga0070685_10281024
226 Ga0070707_100229137
227 Ga0070698_100066172
228 Ga0070679_100000071
229 Ga0070684_100092160
230 Ga0070684_100254646
231 Ga0070697_100433563
232 Ga0070693_100027061
233 Ga0070704_100507331
234 Ga0068859_100221996
235 Ga0068864_100037356
236 Ga0068864_100676056
237 Ga0068861_100099204
238 Ga0068863_100360922
239 Ga0068863_100515916
240 Ga0068858_100052770
241 Ga0068860_100009244
242 Ga0068860_100026370
243 Ga0081455_10038867
244 Ga0081538_10000994
245 Ga0070717_10026307
246 Ga0075365_10066267
247 Ga0075365_10079922
248 Ga0075365_10121171
249 Ga0075365_10251680
250 Ga0075365_10339599
251 Ga0075368_10004823
252 Ga0075363_100006835
253 Ga0075364_10055145
254 Ga0070712_100144358
255 Ga0075367_10162644
256 Ga0075370_10056995
257 Ga0075428_100008722
258 Ga0075428_100182135
259 Ga0075430_100039173
260 Ga0075430_100479222
261 Ga0075431_100136781
262 Ga0075431_100258740
263 Ga0097620_100221999
264 Ga0111539_10267766
265 Ga0105245_10038112
266 Ga0105245_10340869
267 Ga0105245_10407108
268 Ga0114129_10037651
269 Ga0114129_10290826
270 Ga0105243_10027260
271 Ga0105243_10338812
272 Ga0105242_10845385
273 Ga0105249_10032604
274 Ga0105249_10170064
275 Ga0105249_10188879
276 Ga0105246_10590011
277 Ga0163163_10190775
278 Ga0163161_10027730
279 Ga0213876_10127489
280 Ga0207645_10051922
281 Ga0207707_10000023
282 Ga0207707_10434114
283 Ga0207660_10003837
284 Ga0207652_10000039
285 Ga0207652_10152027
286 Ga0207646_10057100
287 Ga0207650_10575626
288 Ga0207687_10018687
289 Ga0207670_10165904
290 Ga0207691_10145274
291 Ga0207691_10471281
292 Ga0207712_10067183
293 Ga0207703_10007405
294 Ga0207675_100047026
295 Ga0207428_10151482
296 Ga0268264_10000155
297 Ga0307515_10001985
298 Ga0265338_10001109
299 Ga0265338_10160424
300 Ga0265325_10001544
301 Ga0265325_10001631
302 Ga0265340_10001733
303 Ga0265340_10046928
304 Ga0265339_10007099
305 Ga0265339_10016724
306 Ga0265331_10081209
307 Ga0265327_10004589
308 Ga0265316_10066022
309 Ga0265316_10190376
310 Ga0265316_10252284
311 Ga0307509_10000330
312 Ga0307509_10095007
313 Ga0307509_10114925
314 Ga0265313_10000462
315 Ga0265313_10019276
316 Ga0265313_10143638
317 Ga0265314_10023951
318 Ga0265342_10013554
319 Ga0307516_10023298
320 Ga0307410_10007869
321 Ga0307406_10235506
322 Ga0307409_100013157
323 Ga0307411_10037896
324 Ga0307415_100008910
325 Ga0373949_0000041
326 Ga0373936_0000009
327 Ga0373941_0001801
328 Ga0373961_0000005
329 Ga0316574_0011151
330 Ga0373927_0580542
331 Ga0373937_0046956
332 Ga0373925_0079075
333 Ga0436365_0849258
334 Ga0436365_0905536
335 Ga0436362_0626229
336 Ga0439451_014304
337 Ga0439463_045348
338 Ga0439440_0085620
339 Ga0466966_0039455
340 Ga0466967_0104979
341 Ga0495629_0141754
342 Ga0495628_0312666
343 Ga0495630_0205017
344 Ga0495635_0098797
345 Ga0495613_0154080
346 Ga0495624_0092166
347 Ga0495649_0155831
348 Ga0495674_0304275
349 Ga0495676_0041922
350 Ga0495680_0065474
351 Ga0496102_0094086
352 Ga0496105_0054336
353 Ga0496108_0101262
354 Ga0496109_0311580
355 Ga0496109_0325909
356 Ga0496110_0260635
357 Ga0496111_0286688
358 Ga0496112_0002365
359 Ga0496113_0379494
360 Ga0496114_0135685
361 Ga0496126_0000055
362 Ga0501033_0011671
363 Ga0501034_0001108
364 Ga0501034_0010604
365 Ga0501034_0090561
366 Ga0501034_0117171
367 Ga0501034_0286532
368 Ga0501034_0390882
369 Ga0501036_0063314
370 Ga0501037_0283698
371 Ga0501046_0041072
372 Ga0501046_0252159
373 Ga0501047_0014188
374 Ga0501047_0072433
375 Ga0501047_0238685
376 Ga0501047_0253502
377 Ga0501047_0744750
378 Ga0501048_0277598
379 Ga0501069_0060309
380 Ga0501070_0035693
381 Ga0501071_0258370
382 Ga0501072_0042968
383 Ga0501075_0378919
384 Ga0501044_0002304
385 Ga0501044_0077984
386 Ga0501044_0103171
387 Ga0501045_0658376
388 nmdc:mga03n38_196065_c1
389 nmdc:mga00v17_165697_c1
390 nmdc:mga00v17_59045_c1
391 nmdc:mga0yw44_127970_c1
392 nmdc:mga0yw44_1417_c1
393 nmdc:mga0yw44_19209_c1
394 nmdc:mga0yw44_267940_c1
395 nmdc:mga0yw44_368788_c1
396 nmdc:mga0yw44_65362_c1
397 nmdc:mga06z11_85178_c1
398 nmdc:mga04h51_30901_c1
399 nmdc:mga07m45_37845_c1
400 nmdc:mga07m45_74623_c1
401 nmdc:mga05p37_368658_c1
402 nmdc:mga05p37_382787_c1
403 nmdc:mga09592_25033_c1
404 nmdc:mga06r32_127086_c1
405 nmdc:mga06r32_88270_c1
406 Ga0495601_0246564
407 Ga0495595_0221259
408 Ga0495619_0080238
409 Ga0495619_0156925
410 Ga0500566_0034839
411 Ga0500566_0128460
412 Ga0500597_013093
413 Ga0500564_107575
414 Ga0500603_001189
415 Ga0500603_003093
416 Ga0500636_0095011
417 Ga0530510_0005941
418 3006321762

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.7583 4 258
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.756 4 258
1din-assembly1.cif.gz_A dienelactone hydrolase at 2.8 angstroms 0.7497 4 258
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.7439 4 258
4u2c-assembly1.cif.gz_A crystal structure of dienelactone hydrolase a-6 variant (s7t, a24v, q35h, f38l, q110l, c123s, y145c, e199g and s208g) at 1.95 a resolution 0.7424 4 258
ID Description Score Start End Superfamily
af_A0A0R0EWP2_30_290_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8696 5 61 3.40.50.1820
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7561 178 214 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.756 4 258 3.40.50.1820
af_A0A0R0FIM6_28_181_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7518 20 209 3.40.50.1820
af_Q2FY80_39_164_3.30.450.20 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.7421 6 22 3.30.450.20
ID Description Score Start End GO Terms
AF-X8FJV3-F1-model_v4 deleted 0.9887 121 260
AF-A0A3C2CL25-F1-model_v4 Dienelactone hydrolase 0.988 2 215 GO:0016787
AF-A0A2E9LD44-F1-model_v4 Dienelactone hydrolase 0.9862 3 258 GO:0016787
AF-A0A7K1ED19-F1-model_v4 Uncharacterized protein 0.9858 135 262
AF-A0A1G6IQV4-F1-model_v4 Dienelactone hydrolase 0.9848 5 258 GO:0016787

Map