F319678

General Info

Members Datasets Scaffolds Average Seq Length
209 170 183 169

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_723584_c1|nmdc:mga06r32_723584_c1_169_762
Length 197
Sequence VLCACGCNDRNCVTREGSLLLMTQTTAAPLNVLFLCTGNSARSIMAEAILNEVGGGRLKAHSAGSHPAGKVNAFALDLLRANRLPTEGLRSKSWDEFAQPGAPFMHFVFTVCDQAAAELCPVWPGKPMTAHWGVPDPAAVQGSDDEKRRAFRAAYTELHRRIALFVSLSFDKLQGLALQQRLDEIGRTKATDTARPA

Samples

Sample ID Description Type Environment
1 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
2 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
3 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
4 2738541277 Variovorax sp. GV051 Isolate Unclassified
5 2738543019 Variovorax sp. GV040 Isolate Unclassified
6 2818991446 Variovorax sp. 1180 Isolate Unclassified
7 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
8 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
9 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
10 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
11 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
12 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
13 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
14 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
15 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
16 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
17 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
18 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
19 2885198086 Variovorax sp. 679 Isolate Unclassified
20 2885211737 Variovorax sp. 553 Isolate Unclassified
21 2928070936 Variovorax gossypii 1167 Isolate Unclassified
22 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
23 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
24 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
25 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
81 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
82 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
83 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
118 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
146 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
170 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.56
Metatranscriptomes 0
Isolates 12.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 6.22
Rhizoplane 0.48
Rhizosphere 80.38
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1016206 3300003781 Bacteria 2504
2 Ga0068869_100203334 3300005334 Bacteria 1563
3 Ga0070668_100045744 3300005347 Bacteria 3358
4 Ga0070675_100466193 3300005354 Bacteria 1134
5 Ga0070671_100215382 3300005355 Bacteria 1629
6 Ga0070674_100103628 3300005356 Bacteria 2078
7 Ga0068867_100038531 3300005459 Bacteria 3480
8 Ga0068867_101328139 3300005459 Bacteria 665
9 Ga0070707_100738193 3300005468 Unclassified 948
10 Ga0070698_100011295 3300005471 Bacteria 9483
11 Ga0070697_101030521 3300005536 Bacteria 732
12 Ga0070686_100923566 3300005544 Bacteria 711
13 Ga0070693_100443368 3300005547 Unclassified 909
14 Ga0068864_100339086 3300005618 Bacteria 1416
15 Ga0068863_100040742 3300005841 Bacteria 4416
16 Ga0068858_100039556 3300005842 Bacteria 4373
17 Ga0068862_101730403 3300005844 Bacteria 634
18 Ga0081538_10152389 3300005981 Bacteria 1044
19 Ga0070712_100019794 3300006175 Bacteria 4396
20 Ga0075366_10000198 3300006195 Bacteria 26513
21 Ga0075428_100197191 3300006844 Bacteria 2177
22 Ga0075428_100895470 3300006844 Bacteria 941
23 Ga0075431_100122702 3300006847 Bacteria 2681
24 Ga0075431_100230342 3300006847 Bacteria 1888
25 Ga0068865_100208048 3300006881 Bacteria 1523
26 Ga0111539_10133577 3300009094 Bacteria 2906
27 Ga0111539_10744666 3300009094 Bacteria 1141
28 Ga0111539_11275530 3300009094 Bacteria 853
29 Ga0105245_10567867 3300009098 Bacteria 1158
30 Ga0105243_10072205 3300009148 Bacteria 2793
31 Ga0105242_10067939 3300009176 Bacteria 2948
32 Ga0105248_10173718 3300009177 Bacteria 2429
33 Ga0157378_10041501 3300013297 Bacteria 4082
34 Ga0163162_10850938 3300013306 Bacteria 1027
35 Ga0157375_10103817 3300013308 Bacteria 2930
36 Ga0157380_10175612 3300014326 Bacteria 1877
37 Ga0182008_10012542 3300014497 Bacteria 4472
38 Ga0157379_10779225 3300014968 Bacteria 902
39 Ga0157376_10168139 3300014969 Bacteria 1994
40 Ga0209676_1001000 3300025292 Bacteria 33227
41 Ga0209051_1031612 3300025303 Bacteria 2033
42 Ga0207642_10269993 3300025899 Bacteria 974
43 Ga0207680_10148213 3300025903 Bacteria 1562
44 Ga0207647_10151536 3300025904 Bacteria 1355
45 Ga0207695_10081951 3300025913 Bacteria 3264
46 Ga0207693_10010223 3300025915 Bacteria 7619
47 Ga0207700_10109175 3300025928 Bacteria 2223
48 Ga0207664_10074356 3300025929 Bacteria 2745
49 Ga0207686_10854977 3300025934 Bacteria 732
50 Ga0207709_10000211 3300025935 Bacteria 75562
51 Ga0207709_10000338 3300025935 Bacteria 48742
52 Ga0207704_10256940 3300025938 Bacteria 1315
53 Ga0207689_10007008 3300025942 Bacteria 9909
54 Ga0207668_10406646 3300025972 Bacteria 1152
55 Ga0207703_10088496 3300026035 Bacteria 2599
56 Ga0207641_10054122 3300026088 Bacteria 3404
57 Ga0207648_10221282 3300026089 Bacteria 1682
58 Ga0207648_10345173 3300026089 Bacteria 1341
59 Ga0207648_10888134 3300026089 Bacteria 832
60 Ga0207676_10122737 3300026095 Bacteria 2194
61 Ga0207698_10785359 3300026142 Bacteria 953
62 Ga0265334_10000006 3300028573 Bacteria 235168
63 Ga0265338_10027308 3300028800 Bacteria 5729
64 Ga0265330_10097708 3300031235 Bacteria 1258
65 Ga0265332_10123502 3300031238 Bacteria 1087
66 Ga0265328_10073625 3300031239 Bacteria 1256
67 Ga0265325_10293510 3300031241 Bacteria 727
68 Ga0265339_10011421 3300031249 Bacteria 5466
69 Ga0265327_10003316 3300031251 Bacteria 15582
70 Ga0265316_10550035 3300031344 Bacteria 822
71 Ga0307513_10407180 3300031456 Bacteria 1093
72 Ga0307408_100195061 3300031548 Bacteria 1635
73 Ga0265313_10000470 3300031595 Bacteria 42126
74 Ga0265313_10076948 3300031595 Bacteria 1524
75 Ga0265342_10099844 3300031712 Bacteria 1655
76 Ga0307405_10017716 3300031731 Bacteria 3916
77 Ga0307405_10152461 3300031731 Unclassified 1627
78 Ga0307413_10338481 3300031824 Bacteria 1156
79 Ga0307413_10516878 3300031824 Bacteria 962
80 Ga0307410_10113757 3300031852 Bacteria 1962
81 Ga0307406_10012699 3300031901 Bacteria 4804
82 Ga0307406_10364217 3300031901 Bacteria 1134
83 Ga0307406_11165380 3300031901 Bacteria 668
84 Ga0307407_10042326 3300031903 Bacteria 2553
85 Ga0307407_10281171 3300031903 Bacteria 1153
86 Ga0307412_10070355 3300031911 Bacteria 2385
87 Ga0307412_10227947 3300031911 Bacteria 1433
88 Ga0307416_100005037 3300032002 Bacteria 8056
89 Ga0307416_100068368 3300032002 Bacteria 2935
90 Ga0307416_100905102 3300032002 Bacteria 982
91 Ga0307416_102232176 3300032002 Unclassified 648
92 Ga0307414_10080363 3300032004 Bacteria 2384
93 Ga0307411_10045568 3300032005 Bacteria 2821
94 Ga0307411_10796160 3300032005 Unclassified 832
95 Ga0307415_100010719 3300032126 Bacteria 5206
96 Ga0373934_0077696 3300035086 Bacteria 1331
97 Ga0373923_0023836 3300035111 Bacteria 2411
98 Ga0373953_0000258 3300035117 Bacteria 14391
99 Ga0373954_0001945 3300035118 Bacteria 8563
100 Ga0373956_0000359 3300035119 Bacteria 18534
101 Ga0373957_0096036 3300035120 Bacteria 1182
102 Ga0373955_0002553 3300035172 Bacteria 7968
103 Ga0373955_0055486 3300035172 Bacteria 2170
104 Ga0373924_0007395 3300035410 Bacteria 3965
105 Ga0373931_0129652 3300035691 Unclassified 1450
106 Ga0373935_0506215 3300035692 Bacteria 877
107 Ga0373927_0035657 3300035695 Bacteria 3235
108 Ga0373933_0001775 3300035724 Bacteria 12481
109 Ga0373937_0005712 3300036401 Bacteria 10684
110 Ga0373937_0187656 3300036401 Bacteria 1942
111 Ga0373937_0200304 3300036401 Bacteria 1877
112 Ga0373937_0661464 3300036401 Bacteria 990
113 Ga0373925_0015930 3300037068 Bacteria 5441
114 Ga0373925_0189798 3300037068 Bacteria 1630
115 Ga0373925_1080917 3300037068 Bacteria 660
116 Ga0395899_0000069 3300037312 Bacteria 194382
117 Ga0395905_0866265 3300037471 Bacteria 806
118 Ga0451835_0762846 3300041492 Bacteria 1063
119 Ga0466969_0016560 3300044656 Bacteria 3855
120 Ga0466969_0137590 3300044656 Bacteria 1130
121 Ga0466970_0001119 3300044765 Bacteria 12995
122 Ga0495591_041211 3300046458 Bacteria 1312
123 Ga0495653_0188265 3300046463 Bacteria 1410
124 Ga0495580_0063595 3300046472 Bacteria 2587
125 Ga0495580_0296683 3300046472 Bacteria 1101
126 Ga0495664_0082521 3300046477 Bacteria 1928
127 Ga0495664_0088060 3300046477 Bacteria 1866
128 Ga0495608_0007088 3300046511 Bacteria 7931
129 Ga0495618_0001773 3300046514 Bacteria 14300
130 Ga0495630_0080557 3300046517 Bacteria 2456
131 Ga0495630_0214564 3300046517 Bacteria 1469
132 Ga0495630_0227744 3300046517 Bacteria 1424
133 Ga0495644_0023793 3300046523 Bacteria 2331
134 Ga0495666_0088466 3300046526 Bacteria 1463
135 Ga0495654_0051801 3300046530 Bacteria 2002
136 Ga0495654_0278897 3300046530 Bacteria 688
137 Ga0495640_0041609 3300046533 Bacteria 3210
138 Ga0495587_0154245 3300046536 Bacteria 1309
139 Ga0495621_0018168 3300046539 Bacteria 2280
140 Ga0495667_0003968 3300046559 Bacteria 9932
141 Ga0495634_0569294 3300046642 Bacteria 659
142 Ga0495625_0130881 3300046660 Bacteria 1699
143 Ga0495588_0341476 3300046674 Bacteria 787
144 Ga0495657_0061403 3300046675 Bacteria 2486
145 Ga0495647_0005657 3300046681 Bacteria 4106
146 Ga0495658_0308725 3300046683 Bacteria 1001
147 Ga0495658_0341284 3300046683 Bacteria 951
148 Ga0495613_0044798 3300046689 Bacteria 3272
149 Ga0495671_0076214 3300046692 Bacteria 1645
150 Ga0495604_0002129 3300047317 Bacteria 15923
151 Ga0495674_0156721 3300047319 Bacteria 1907
152 Ga0495680_0233995 3300047322 Bacteria 1307
153 Ga0495681_0080865 3300047470 Bacteria 1451
154 Ga0495684_0004274 3300047471 Bacteria 11145
155 Ga0496102_0365936 3300048905 Bacteria 1357
156 Ga0496124_0000236 3300048927 Bacteria 107751
157 Ga0501034_0293755 3300049571 Bacteria 1563
158 Ga0501036_0494953 3300049572 Bacteria 1017
159 Ga0501038_0399131 3300049574 Bacteria 1064
160 Ga0501038_1045564 3300049574 Bacteria 598
161 Ga0501043_0091555 3300049579 Bacteria 2391
162 Ga0501043_0369012 3300049579 Bacteria 1088
163 Ga0501047_0022030 3300049581 Bacteria 6120
164 Ga0501047_0057973 3300049581 Bacteria 3742
165 Ga0501047_0257455 3300049581 Bacteria 1593
166 Ga0501076_0196445 3300049592 Bacteria 1647
167 Ga0501035_0720300 3300049822 Bacteria 803
168 Ga0501044_0016555 3300049823 Bacteria 7913
169 Ga0501044_0219052 3300049823 Bacteria 1854
170 Ga0501045_0293361 3300049824 Bacteria 1210
171 nmdc:mga0k408_35_c1 3300050493 Bacteria 25383
172 nmdc:mga0k408_374482_c1 3300050493 Bacteria 848
173 nmdc:mga06r32_140802_c1 3300050510 Bacteria 1480
174 nmdc:mga06r32_723584_c1 3300050510 Bacteria 960
175 nmdc:mga08y16_396044_c1 3300050511 Bacteria 1414
176 Ga0500626_031850 3300053128 Bacteria 2383
177 Ga0500658_0000227 3300053134 Bacteria 26935
178 Ga0500559_0003442 3300053136 Bacteria 7786
179 Ga0500568_0002509 3300053139 Bacteria 10743
180 Ga0500574_038302 3300053141 Bacteria 1326
181 Ga0500636_0001273 3300053177 Bacteria 13677
182 Ga0500576_120155 3300053725 Bacteria 1037
183 Ga0501084_1177508 3300054114 Bacteria 643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049824 Ga0501045_0293361 Ga0501045_0293361_470_949 159
2 3300009094 Ga0111539_10133577 Ga0111539_101335774 160
3 3300014326 Ga0157380_10175612 Ga0157380_101756122 160
4 3300036401 Ga0373937_0187656 Ga0373937_0187656_990_1472 160
5 3300041492 Ga0451835_0762846 Ga0451835_0762846_110_592 160
6 3300050511 nmdc:mga08y16_396044_c1 nmdc:mga08y16_396044_c1_806_1294 160
7 iso_pu_bacteria 2848858292 2848863871 161
8 3300005471 Ga0070698_100011295 Ga0070698_1000112958 162
9 3300028800 Ga0265338_10027308 Ga0265338_100273082 162
10 3300031239 Ga0265328_10073625 Ga0265328_100736252 162
11 3300031249 Ga0265339_10011421 Ga0265339_100114215 162
12 3300031712 Ga0265342_10099844 Ga0265342_100998442 162
13 3300005468 Ga0070707_100738193 Ga0070707_1007381932 163
14 3300005547 Ga0070693_100443368 Ga0070693_1004433682 163
15 3300025913 Ga0207695_10081951 Ga0207695_100819513 163
16 3300025934 Ga0207686_10854977 Ga0207686_108549772 163
17 3300031456 Ga0307513_10407180 Ga0307513_104071802 163
18 3300031548 Ga0307408_100195061 Ga0307408_1001950613 163
19 3300031901 Ga0307406_11165380 Ga0307406_111653801 163
20 3300032002 Ga0307416_100905102 Ga0307416_1009051021 163
21 3300035172 Ga0373955_0055486 Ga0373955_0055486_686_1177 163
22 3300036401 Ga0373937_0200304 Ga0373937_0200304_393_884 163
23 3300046517 Ga0495630_0214564 Ga0495630_0214564_444_935 163
24 3300047319 Ga0495674_0156721 Ga0495674_0156721_85_576 163
25 3300005356 Ga0070674_100103628 Ga0070674_1001036283 164
26 3300005459 Ga0068867_100038531 Ga0068867_1000385314 164
27 3300005459 Ga0068867_101328139 Ga0068867_1013281391 164
28 3300005844 Ga0068862_101730403 Ga0068862_1017304032 164
29 3300006195 Ga0075366_10000198 Ga0075366_1000019816 164
30 3300006881 Ga0068865_100208048 Ga0068865_1002080482 164
31 3300009094 Ga0111539_11275530 Ga0111539_112755302 164
32 3300009098 Ga0105245_10567867 Ga0105245_105678672 164
33 3300009148 Ga0105243_10072205 Ga0105243_100722053 164
34 3300009176 Ga0105242_10067939 Ga0105242_100679393 164
35 3300013306 Ga0163162_10850938 Ga0163162_108509382 164
36 3300014969 Ga0157376_10168139 Ga0157376_101681393 164
37 3300025938 Ga0207704_10256940 Ga0207704_102569402 164
38 3300025972 Ga0207668_10406646 Ga0207668_104066462 164
39 3300026089 Ga0207648_10221282 Ga0207648_102212822 164
40 3300026089 Ga0207648_10888134 Ga0207648_108881341 164
41 3300028573 Ga0265334_10000006 Ga0265334_10000006209 164
42 3300031238 Ga0265332_10123502 Ga0265332_101235022 164
43 3300031241 Ga0265325_10293510 Ga0265325_102935101 164
44 3300031595 Ga0265313_10000470 Ga0265313_1000047034 164
45 3300031595 Ga0265313_10076948 Ga0265313_100769482 164
46 3300031911 Ga0307412_10227947 Ga0307412_102279472 164
47 3300032002 Ga0307416_100068368 Ga0307416_1000683683 164
48 3300046517 Ga0495630_0227744 Ga0495630_0227744_631_1161 164
49 3300050493 nmdc:mga0k408_35_c1 nmdc:mga0k408_35_c1_13646_14140 164
50 3300005536 Ga0070697_101030521 Ga0070697_1010305211 165
51 3300031235 Ga0265330_10097708 Ga0265330_100977082 165
52 3300031344 Ga0265316_10550035 Ga0265316_105500351 165
53 3300037312 Ga0395899_0000069 Ga0395899_0000069_171209_171706 165
54 3300044656 Ga0466969_0016560 Ga0466969_0016560_3228_3725 165
55 3300044656 Ga0466969_0137590 Ga0466969_0137590_48_545 165
56 3300044765 Ga0466970_0001119 Ga0466970_0001119_6689_7186 165
57 3300049572 Ga0501036_0494953 Ga0501036_0494953_224_730 165
58 3300049574 Ga0501038_1045564 Ga0501038_1045564_30_536 165
59 3300049579 Ga0501043_0369012 Ga0501043_0369012_397_903 165
60 3300049581 Ga0501047_0022030 Ga0501047_0022030_4910_5416 165
61 3300050493 nmdc:mga0k408_374482_c1 nmdc:mga0k408_374482_c1_267_767 165
62 iso_pu_bacteria 2515075009 2515112522 165
63 iso_pu_bacteria 2582581306 2585269965 165
64 iso_pu_bacteria 2597490356 2599100413 165
65 iso_pu_bacteria 2738541277 2738718405 165
66 iso_pu_bacteria 2738543019 2739281592 165
67 iso_pu_bacteria 2818991446 2819602604 165
68 iso_pu_bacteria 2838680041 2838682022 165
69 iso_pu_bacteria 2838694306 2838696594 165
70 iso_pu_bacteria 2838707686 2838710167 165
71 iso_pu_bacteria 2842077413 2842078340 165
72 iso_pu_bacteria 2842118031 2842119151 165
73 iso_pu_bacteria 2842237096 2842239579 165
74 iso_pu_bacteria 2842291075 2842292002 165
75 iso_pu_bacteria 2842370503 2842372589 165
76 iso_pu_bacteria 2842377471 2842378398 165
77 iso_pu_bacteria 2842384541 2842385661 165
78 iso_pu_bacteria 2885198086 2885201759 165
79 iso_pu_bacteria 2885211737 2885215531 165
80 iso_pu_bacteria 2928070936 2928076901 165
81 iso_pu_bacteria 2928084124 2928084130 165
82 iso_pu_bacteria 2935894831 2935897551 165
83 iso_pu_bacteria 3005409236 3005411966 165
84 iso_pu_bacteria 8005460587 8005463195 165
85 3300006175 Ga0070712_100019794 Ga0070712_1000197945 166
86 3300006844 Ga0075428_100197191 Ga0075428_1001971912 166
87 3300025915 Ga0207693_10010223 Ga0207693_100102232 166
88 3300031251 Ga0265327_10003316 Ga0265327_1000331612 166
89 3300035691 Ga0373931_0129652 Ga0373931_0129652_187_729 166
90 3300035695 Ga0373927_0035657 Ga0373927_0035657_1607_2107 166
91 3300036401 Ga0373937_0661464 Ga0373937_0661464_194_694 166
92 3300037068 Ga0373925_0015930 Ga0373925_0015930_3595_4095 166
93 3300046458 Ga0495591_041211 Ga0495591_041211_546_1046 166
94 3300046472 Ga0495580_0296683 Ga0495580_0296683_359_865 166
95 3300046477 Ga0495664_0088060 Ga0495664_0088060_77_577 166
96 3300046523 Ga0495644_0023793 Ga0495644_0023793_1766_2266 166
97 3300046530 Ga0495654_0278897 Ga0495654_0278897_78_578 166
98 3300046539 Ga0495621_0018168 Ga0495621_0018168_174_674 166
99 3300046681 Ga0495647_0005657 Ga0495647_0005657_961_1461 166
100 3300046683 Ga0495658_0341284 Ga0495658_0341284_108_608 166
101 3300046692 Ga0495671_0076214 Ga0495671_0076214_169_669 166
102 3300047322 Ga0495680_0233995 Ga0495680_0233995_239_739 166
103 3300047470 Ga0495681_0080865 Ga0495681_0080865_114_614 166
104 3300049579 Ga0501043_0091555 Ga0501043_0091555_1737_2246 166
105 3300054114 Ga0501084_1177508 Ga0501084_1177508_55_555 166
106 iso_pu_bacteria 2842922631 2842927461 166
107 iso_pu_bacteria 8054460903 8054465637 166
108 3300005347 Ga0070668_100045744 Ga0070668_1000457442 167
109 3300005981 Ga0081538_10152389 Ga0081538_101523892 167
110 3300025928 Ga0207700_10109175 Ga0207700_101091752 167
111 3300025929 Ga0207664_10074356 Ga0207664_100743562 167
112 3300031901 Ga0307406_10364217 Ga0307406_103642172 167
113 3300035086 Ga0373934_0077696 Ga0373934_0077696_669_1181 167
114 3300035111 Ga0373923_0023836 Ga0373923_0023836_261_773 167
115 3300035117 Ga0373953_0000258 Ga0373953_0000258_4372_4884 167
116 3300035118 Ga0373954_0001945 Ga0373954_0001945_4311_4823 167
117 3300035119 Ga0373956_0000359 Ga0373956_0000359_4416_4928 167
118 3300035120 Ga0373957_0096036 Ga0373957_0096036_627_1139 167
119 3300035172 Ga0373955_0002553 Ga0373955_0002553_4449_4961 167
120 3300035410 Ga0373924_0007395 Ga0373924_0007395_1568_2080 167
121 3300035692 Ga0373935_0506215 Ga0373935_0506215_350_862 167
122 3300035724 Ga0373933_0001775 Ga0373933_0001775_9467_9979 167
123 3300036401 Ga0373937_0005712 Ga0373937_0005712_10001_10513 167
124 3300037068 Ga0373925_1080917 Ga0373925_1080917_21_533 167
125 3300046463 Ga0495653_0188265 Ga0495653_0188265_228_740 167
126 3300046472 Ga0495580_0063595 Ga0495580_0063595_256_768 167
127 3300046477 Ga0495664_0082521 Ga0495664_0082521_460_972 167
128 3300046511 Ga0495608_0007088 Ga0495608_0007088_5297_5809 167
129 3300046514 Ga0495618_0001773 Ga0495618_0001773_4591_5103 167
130 3300046517 Ga0495630_0080557 Ga0495630_0080557_85_597 167
131 3300046526 Ga0495666_0088466 Ga0495666_0088466_588_1100 167
132 3300046533 Ga0495640_0041609 Ga0495640_0041609_1967_2479 167
133 3300046536 Ga0495587_0154245 Ga0495587_0154245_709_1221 167
134 3300046559 Ga0495667_0003968 Ga0495667_0003968_4062_4574 167
135 3300046642 Ga0495634_0569294 Ga0495634_0569294_53_565 167
136 3300046675 Ga0495657_0061403 Ga0495657_0061403_1018_1530 167
137 3300046683 Ga0495658_0308725 Ga0495658_0308725_108_620 167
138 3300046689 Ga0495613_0044798 Ga0495613_0044798_1734_2246 167
139 3300047317 Ga0495604_0002129 Ga0495604_0002129_14499_15011 167
140 3300047471 Ga0495684_0004274 Ga0495684_0004274_4432_4944 167
141 3300049581 Ga0501047_0257455 Ga0501047_0257455_1059_1568 167
142 3300006844 Ga0075428_100895470 Ga0075428_1008954702 168
143 3300006847 Ga0075431_100122702 Ga0075431_1001227026 168
144 3300031731 Ga0307405_10017716 Ga0307405_100177162 168
145 3300031824 Ga0307413_10516878 Ga0307413_105168782 168
146 3300031852 Ga0307410_10113757 Ga0307410_101137572 168
147 3300031901 Ga0307406_10012699 Ga0307406_100126994 168
148 3300031903 Ga0307407_10042326 Ga0307407_100423263 168
149 3300031911 Ga0307412_10070355 Ga0307412_100703552 168
150 3300032002 Ga0307416_102232176 Ga0307416_1022321761 168
151 3300032004 Ga0307414_10080363 Ga0307414_100803632 168
152 3300032005 Ga0307411_10045568 Ga0307411_100455684 168
153 3300032126 Ga0307415_100010719 Ga0307415_1000107192 168
154 3300049571 Ga0501034_0293755 Ga0501034_0293755_288_803 168
155 3300049574 Ga0501038_0399131 Ga0501038_0399131_267_782 168
156 3300049823 Ga0501044_0219052 Ga0501044_0219052_267_782 168
157 3300050510 nmdc:mga06r32_140802_c1 nmdc:mga06r32_140802_c1_376_903 168
158 3300003781 Ga0055536_1016206 Ga0055536_10162063 169
159 3300005334 Ga0068869_100203334 Ga0068869_1002033342 169
160 3300005354 Ga0070675_100466193 Ga0070675_1004661932 169
161 3300005355 Ga0070671_100215382 Ga0070671_1002153822 169
162 3300005544 Ga0070686_100923566 Ga0070686_1009235661 169
163 3300005618 Ga0068864_100339086 Ga0068864_1003390862 169
164 3300005841 Ga0068863_100040742 Ga0068863_1000407424 169
165 3300005842 Ga0068858_100039556 Ga0068858_1000395565 169
166 3300006847 Ga0075431_100230342 Ga0075431_1002303422 169
167 3300009094 Ga0111539_10744666 Ga0111539_107446662 169
168 3300009177 Ga0105248_10173718 Ga0105248_101737182 169
169 3300013297 Ga0157378_10041501 Ga0157378_100415012 169
170 3300013308 Ga0157375_10103817 Ga0157375_101038173 169
171 3300014497 Ga0182008_10012542 Ga0182008_100125427 169
172 3300014968 Ga0157379_10779225 Ga0157379_107792252 169
173 3300025292 Ga0209676_1001000 Ga0209676_100100034 169
174 3300025303 Ga0209051_1031612 Ga0209051_10316122 169
175 3300025899 Ga0207642_10269993 Ga0207642_102699931 169
176 3300025903 Ga0207680_10148213 Ga0207680_101482132 169
177 3300025904 Ga0207647_10151536 Ga0207647_101515362 169
178 3300025935 Ga0207709_10000211 Ga0207709_1000021154 169
179 3300025935 Ga0207709_10000338 Ga0207709_1000033816 169
180 3300025942 Ga0207689_10007008 Ga0207689_100070088 169
181 3300026035 Ga0207703_10088496 Ga0207703_100884963 169
182 3300026088 Ga0207641_10054122 Ga0207641_100541223 169
183 3300026089 Ga0207648_10345173 Ga0207648_103451732 169
184 3300026095 Ga0207676_10122737 Ga0207676_101227374 169
185 3300026142 Ga0207698_10785359 Ga0207698_107853592 169
186 3300031731 Ga0307405_10152461 Ga0307405_101524613 169
187 3300031824 Ga0307413_10338481 Ga0307413_103384811 169
188 3300031903 Ga0307407_10281171 Ga0307407_102811712 169
189 3300032002 Ga0307416_100005037 Ga0307416_1000050379 169
190 3300032005 Ga0307411_10796160 Ga0307411_107961602 169
191 3300037068 Ga0373925_0189798 Ga0373925_0189798_837_1355 169
192 3300037471 Ga0395905_0866265 Ga0395905_0866265_244_762 169
193 3300046530 Ga0495654_0051801 Ga0495654_0051801_760_1269 169
194 3300046660 Ga0495625_0130881 Ga0495625_0130881_1000_1509 169
195 3300046674 Ga0495588_0341476 Ga0495588_0341476_197_706 169
196 3300048905 Ga0496102_0365936 Ga0496102_0365936_492_1016 169
197 3300048927 Ga0496124_0000236 Ga0496124_0000236_28258_28788 169
198 3300049581 Ga0501047_0057973 Ga0501047_0057973_2802_3332 169
199 3300049592 Ga0501076_0196445 Ga0501076_0196445_853_1380 169
200 3300049822 Ga0501035_0720300 Ga0501035_0720300_193_723 169
201 3300049823 Ga0501044_0016555 Ga0501044_0016555_3312_3842 169
202 3300050510 nmdc:mga06r32_723584_c1 nmdc:mga06r32_723584_c1_169_762 169
203 3300053128 Ga0500626_031850 Ga0500626_031850_878_1387 169
204 3300053134 Ga0500658_0000227 Ga0500658_0000227_21771_22280 169
205 3300053136 Ga0500559_0003442 Ga0500559_0003442_3450_3959 169
206 3300053139 Ga0500568_0002509 Ga0500568_0002509_8230_8739 169
207 3300053141 Ga0500574_038302 Ga0500574_038302_580_1089 169
208 3300053177 Ga0500636_0001273 Ga0500636_0001273_5735_6265 169
209 3300053725 Ga0500576_120155 Ga0500576_120155_235_777 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01451

LMWPc

Low molecular weight phosphotyrosine protein phosphatase

32

166

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9604 6 144
8p6m-assembly1.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus 0.9392 6 144
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9336 6 149
8p5n-assembly2.cif.gz_B arsenate reductase (arsc2) from deinococcus indicus, co-crystallized with arsenate 0.927 6 144
8p6m-assembly1.cif.gz_A arsenate reductase (arsc2) from deinococcus indicus 0.9197 6 149
ID Description Score Start End Superfamily
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9001 7 142 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8916 5 142 3.40.50.2300
1jl3B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8614 5 142 3.40.50.2300
2myuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8609 5 143 3.40.50.2300
1jl3C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.858 7 142 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A410UT89-F1-model_v4 Arsenate reductase ArsC 0.9866 1 162 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A7U7EJV0-F1-model_v4 Arsenate reductase (EC 1.20.4.4) 0.9853 1 164 GO:0016491
GO:0046685
AF-A0A832R726-F1-model_v4 Arsenate reductase ArsC 0.9847 1 164 GO:0046685
AF-A0A1Q7WRM0-F1-model_v4 Protein-tyrosine-phosphatase 0.9845 22 164 GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A511XQ01-F1-model_v4 Arsenate reductase (EC 1.20.4.1) 0.984 1 163 GO:0004726
GO:0008794
GO:0030946
GO:0046685
GO:0140793

Feature Viewer

pLDDT pTM Quality
91.62 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map