F319607

General Info

Members Datasets Scaffolds Average Seq Length
209 170 418 447

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0001636|Ga0501038_0001636_3187_4689
Length 491
Sequence MPGQLLGLLILLVGPLPPHQWSCSKGNVVFSSFFAPSARRRGATRTXXXXLVSGLVAVGVLTGAGTAAADTAETTQNQGGATATIGGLKTYGAAVIHEATGDQQVSAGLFEMSVDGGGTLQTYCVDLHNPTQRDAKYHETAWSGTSLGANRNAGKIRWILQNSYPQVNDLATLAAKAGVKGGLTEQDAAAGTQVAIWRYSDGADVDAVDPQAERLAAYLEKSAVNLSEPQASLRLDPPAVSGHPGELLGPVTVHTNAAGVAVTPPADAATSGVRIVGKDGKPVTSAVNGSQLFFDVPEDADGGSAAITVQASTTVPVGRAFTSETRSQTQILAGSSESTVSAPASATWAKQGAIPALSAVKDCAKGGLDLAAANQGDEAFTFELMGTEYTIPAGESRTVTIPLQEDQAYDFTIKGPGGLAKRFSGTLDCLTQGNESGDATQVLSEPSPATVGGGTADDTNTPLIAGIAIAFVLIGGAALVLVGKKNAPTQE

Samples

Sample ID Description Type Environment
1 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
7 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
8 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
9 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
10 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
11 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
12 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
13 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
14 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
15 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
16 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
17 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
18 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
19 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
20 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
21 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
22 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
23 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
24 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
25 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
26 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
27 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
28 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
31 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
32 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
33 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
34 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
35 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
36 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
37 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
38 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
39 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
42 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
43 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
48 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
49 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
50 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
51 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
52 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
53 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
54 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
55 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
56 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
57 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
64 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
69 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
70 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
76 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
77 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
78 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
79 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
80 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
81 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
91 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
92 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
93 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
97 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
111 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
112 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
113 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
114 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
115 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
116 2643221714 Streptomyces sp. Root264 Isolate Unclassified
117 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
118 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
119 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
120 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
121 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
122 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
123 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
124 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
125 2808606448 Streptomyces sp. 193411 Isolate Unclassified
126 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
127 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
128 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
129 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
130 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
131 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
132 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
133 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
134 2867428634 Streptomyces sp. RP5T Isolate Unclassified
135 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
136 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
137 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
138 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
139 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
140 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
141 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
142 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
143 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
144 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
145 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
146 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
147 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
148 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
149 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
150 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
151 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
152 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
153 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
154 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
155 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
156 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
157 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
158 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
159 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
160 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
161 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
162 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
163 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
164 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
165 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
166 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
167 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
168 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
169 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
170 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 72.25
Metatranscriptomes 0
Isolates 27.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0.96
Rhizoplane 0.96
Rhizosphere 72.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501038_0001636 3300049574 Bacteria 20835
2 rootH1_10085880 3300003316 Bacteria 3455
3 rootH1_10017338 3300003323 Bacteria 2721
4 Ga0068856_100072063 3300005614 Bacteria 3421
5 Ga0075368_10020674 3300006042 Bacteria 2494
6 Ga0075367_10036899 3300006178 Bacteria 2837
7 Ga0105246_10011435 3300011119 Bacteria 5508
8 Ga0182008_10002936 3300014497 Bacteria 10505
9 Ga0182007_10000813 3300015262 Bacteria 17411
10 Ga0183367_1006 3300015688 Bacteria 648044
11 Ga0209758_1004345 3300025297 Bacteria 11875
12 Ga0207647_10012520 3300025904 Bacteria 5902
13 Ga0209371_1009466 3300027312 Bacteria 3094
14 Ga0307517_10025773 3300028786 Bacteria 7167
15 Ga0307515_10006240 3300028794 Bacteria 23923
16 Ga0307515_10180549 3300028794 Bacteria 2062
17 Ga0307511_10001726 3300030521 Bacteria 23009
18 Ga0307511_10093401 3300030521 Bacteria 2022
19 Ga0307512_10014074 3300030522 Bacteria 7467
20 Ga0307512_10048656 3300030522 Bacteria 3429
21 Ga0307513_10002913 3300031456 Bacteria 23397
22 Ga0307513_10160153 3300031456 Bacteria 2144
23 Ga0307509_10044280 3300031507 Bacteria 4810
24 Ga0307509_10058329 3300031507 Bacteria 4089
25 Ga0307508_10003068 3300031616 Bacteria 17182
26 Ga0307508_10032520 3300031616 Bacteria 4712
27 Ga0307508_10039833 3300031616 Bacteria 4220
28 Ga0307508_10052777 3300031616 Bacteria 3610
29 Ga0307514_10018616 3300031649 Bacteria 5692
30 Ga0307514_10022482 3300031649 Bacteria 5123
31 Ga0307516_10016909 3300031730 Bacteria 7613
32 Ga0307518_10036164 3300031838 Bacteria 3588
33 Ga0307518_10136135 3300031838 Bacteria 1720
34 Ga0307507_10011377 3300033179 Bacteria 11234
35 Ga0307507_10080009 3300033179 Bacteria 2884
36 Ga0307510_10025522 3300033180 Bacteria 6812
37 Ga0307510_10138487 3300033180 Bacteria 2084
38 Ga0395898_0078522 3300037466 Bacteria 3185
39 Ga0439436_0011285 3300041404 Bacteria 2714
40 Ga0439439_0002456 3300041406 Bacteria 3943
41 Ga0451853_3097337 3300041512 Bacteria 1879
42 Ga0439448_0002086 3300042005 Bacteria 5366
43 Ga0439449_0019771 3300042007 Bacteria 2524
44 Ga0439457_000176 3300042014 Bacteria 16680
45 Ga0439462_0003376 3300042015 Bacteria 3827
46 Ga0450894_000342 3300042131 Bacteria 8230
47 Ga0450899_000150 3300042135 Bacteria 6647
48 Ga0450903_001328 3300042138 Bacteria 4620
49 Ga0450908_001926 3300042184 Bacteria 4062
50 Ga0466969_0007274 3300044656 Bacteria 5889
51 Ga0466972_0004427 3300044658 Bacteria 7024
52 Ga0466966_0004177 3300044684 Bacteria 9537
53 Ga0466963_0000044 3300044694 Bacteria 40964
54 Ga0466964_0012444 3300044706 Bacteria 3219
55 Ga0466971_0000057 3300044719 Bacteria 43615
56 Ga0466971_0045566 3300044719 Bacteria 1970
57 Ga0466970_0001231 3300044765 Bacteria 12402
58 Ga0466970_0015860 3300044765 Bacteria 3878
59 Ga0466957_0003762 3300044842 Bacteria 8386
60 Ga0466959_0020201 3300045049 Bacteria 4903
61 Ga0466967_0007565 3300045976 Bacteria 7851
62 Ga0495617_003793 3300046452 Bacteria 5592
63 Ga0495592_0005625 3300046454 Bacteria 9266
64 Ga0495592_0009560 3300046454 Bacteria 7295
65 Ga0495603_0000359 3300046455 Bacteria 24579
66 Ga0495603_0005052 3300046455 Bacteria 7884
67 Ga0495629_0109480 3300046459 Bacteria 1926
68 Ga0495580_0064105 3300046472 Bacteria 2576
69 Ga0495582_0031678 3300046473 Bacteria 2907
70 Ga0495605_0006266 3300046474 Bacteria 6855
71 Ga0495662_0058703 3300046476 Bacteria 1858
72 Ga0495664_0002549 3300046477 Bacteria 9797
73 Ga0495664_0025711 3300046477 Bacteria 3427
74 Ga0495584_0052843 3300046491 Bacteria 2045
75 Ga0495594_0049551 3300046499 Bacteria 2308
76 Ga0495607_0092864 3300046501 Bacteria 1631
77 Ga0495606_0007460 3300046507 Bacteria 9776
78 Ga0495616_0026464 3300046513 Bacteria 3087
79 Ga0495618_0049592 3300046514 Bacteria 2651
80 Ga0495628_0067621 3300046516 Bacteria 2789
81 Ga0495630_0072208 3300046517 Bacteria 2598
82 Ga0495631_0005069 3300046518 Bacteria 6937
83 Ga0495643_0005711 3300046522 Bacteria 8328
84 Ga0495652_0077572 3300046529 Bacteria 2753
85 Ga0495652_0130288 3300046529 Bacteria 1992
86 Ga0495654_0016371 3300046530 Bacteria 3923
87 Ga0495587_0079738 3300046536 Bacteria 1898
88 Ga0495597_0005241 3300046542 Bacteria 6891
89 Ga0495645_0077231 3300046543 Bacteria 2395
90 Ga0495622_0028007 3300046557 Bacteria 2629
91 Ga0495634_0008055 3300046642 Bacteria 7861
92 Ga0495634_0071763 3300046642 Bacteria 2278
93 Ga0495625_0020675 3300046660 Bacteria 5074
94 Ga0495625_0035339 3300046660 Bacteria 3684
95 Ga0495635_0000663 3300046663 Bacteria 22092
96 Ga0495635_0031941 3300046663 Bacteria 3654
97 Ga0495661_0030404 3300046665 Bacteria 3440
98 Ga0495588_0006938 3300046674 Bacteria 5133
99 Ga0495657_0005443 3300046675 Bacteria 10080
100 Ga0495646_0026437 3300046680 Bacteria 3646
101 Ga0495613_0048464 3300046689 Bacteria 3137
102 Ga0495671_0024074 3300046692 Bacteria 3175
103 Ga0495649_0022460 3300046694 Bacteria 3530
104 Ga0495589_0025056 3300046794 Bacteria 3028
105 Ga0495600_0004168 3300046809 Bacteria 8620
106 Ga0495604_0001796 3300047317 Bacteria 17472
107 Ga0495636_0000776 3300047318 Bacteria 11748
108 Ga0495636_0001545 3300047318 Bacteria 8761
109 Ga0495636_0016724 3300047318 Bacteria 2932
110 Ga0495674_0101889 3300047319 Bacteria 2442
111 Ga0495676_0032236 3300047321 Bacteria 4425
112 Ga0495676_0175235 3300047321 Bacteria 1506
113 Ga0495680_0006363 3300047322 Bacteria 10993
114 Ga0495687_003120 3300047443 Bacteria 12386
115 Ga0495687_003167 3300047443 Bacteria 12243
116 Ga0495687_044213 3300047443 Bacteria 1937
117 Ga0495675_0036864 3300047444 Bacteria 3116
118 Ga0495675_0082944 3300047444 Bacteria 2018
119 Ga0495685_014192 3300047447 Bacteria 2706
120 Ga0495681_0000356 3300047470 Bacteria 35722
121 Ga0495686_0012869 3300047472 Bacteria 5835
122 Ga0495686_0047077 3300047472 Bacteria 2724
123 Ga0495593_0001327 3300047673 Bacteria 14482
124 Ga0495614_0001248 3300048089 Bacteria 10935
125 Ga0495614_0057210 3300048089 Bacteria 1674
126 Ga0495626_0052118 3300048091 Bacteria 1886
127 Ga0496109_0276795 3300048912 Bacteria 1581
128 Ga0501032_0012038 3300049569 Bacteria 6194
129 Ga0501033_0021653 3300049570 Bacteria 4851
130 Ga0501033_0064275 3300049570 Bacteria 2700
131 Ga0501033_0089400 3300049570 Bacteria 2253
132 Ga0501034_0125219 3300049571 Bacteria 2555
133 Ga0501036_0085925 3300049572 Bacteria 2659
134 Ga0501038_0023589 3300049574 Bacteria 5498
135 Ga0501042_0008643 3300049578 Bacteria 6743
136 Ga0501043_0014478 3300049579 Bacteria 6175
137 Ga0501043_0199596 3300049579 Bacteria 1553
138 Ga0501046_0019454 3300049580 Bacteria 5633
139 Ga0501047_0096102 3300049581 Bacteria 2841
140 Ga0501047_0118029 3300049581 Bacteria 2534
141 Ga0501047_0192655 3300049581 Bacteria 1901
142 Ga0501048_0014576 3300049582 Bacteria 5818
143 Ga0501048_0059892 3300049582 Bacteria 2698
144 Ga0501035_0076509 3300049822 Bacteria 2960
145 Ga0501044_0023857 3300049823 Bacteria 6501
146 Ga0501044_0025410 3300049823 Bacteria 6277
147 Ga0501044_0113526 3300049823 Bacteria 2716
148 nmdc:mga04h51_12319_c1 3300050495 Bacteria 2398
149 Ga0500560_008245 3300053107 Bacteria 2498
150 Ga0466962_0000115 3300061719 Bacteria 32485
151 Ga0466962_0062259 3300061719 Bacteria 1781
152 2547406910 2547132111 Bacteria 8013147
153 2585319359 2582581314 Bacteria 11452267
154 2644436469 2643221678 Bacteria 9540101
155 2644625688 2643221714 Bacteria 9015452
156 2784587942 2784132148 Bacteria 8627943
157 2785344196 2784746763 Bacteria 9783172
158 2785368682 2784746768 Bacteria 10036182
159 2786669800 2786546132 Bacteria 10419719
160 2793979478 2791355406 Bacteria 11364898
161 2804844959 2802429296 Bacteria 7227771
162 2808841359 2808606359 Bacteria 9866990
163 2808919894 2808606375 Bacteria 9466072
164 2809231540 2808606448 Bacteria 8656184
165 2812358882 2811994879 Bacteria 9313447
166 2812481154 2811994917 Bacteria 7761064
167 2852642137 2852635781 Bacteria 8251373
168 2862288049 2862281513 Bacteria 9621493
169 2862293867 2862290372 Bacteria 7471434
170 2862392184 2862382967 Bacteria 10317375
171 2862509567 2862507626 Bacteria 9425308
172 2863405449 2863404153 Bacteria 9672205
173 2867433459 2867428634 Bacteria 9590268
174 2873156479 2873151551 Bacteria 8625867
175 2877681820 2877676314 Bacteria 9512378
176 2912720813 2912715099 Bacteria 9460473
177 2912724925 2912723979 Bacteria 8557534
178 2919468754 2919468124 Bacteria 9133025
179 2946067009 2946064051 Bacteria 8957905
180 2946075297 2946072368 Bacteria 8999607
181 2947230238 2947224130 Bacteria 9938529
182 2954003573 2954002825 Bacteria 9173742
183 2954386964 2954380949 Bacteria 10050426
184 2954676228 2954673503 Bacteria 9685905
185 2954687940 2954682443 Bacteria 9862841
186 2954697784 2954691527 Bacteria 10720516
187 2954704432 2954701450 Bacteria 10834262
188 2954716905 2954711539 Bacteria 10867210
189 2954726855 2954721474 Bacteria 10456478
190 2954734941 2954731030 Bacteria 10243860
191 2954745775 2954740390 Bacteria 10229294
192 2954753813 2954749733 Bacteria 10366972
193 2954764750 2954759201 Bacteria 9358192
194 2990064764 2990059506 Bacteria 9321252
195 2997608097 2997600082 Bacteria 9896405
196 3006396863 3006393351 Bacteria 6615579
197 3006501852 3006493962 Bacteria 8825450
198 8008559623 8008558824 Bacteria 10610750
199 8008579516 8008574985 Bacteria 7815457
200 8023630357 8023623736 Bacteria 8593882
201 8025418924 8025413630 Bacteria 7014048
202 8033691647 8033684223 Bacteria 6906479
203 8047898870 8047893842 Bacteria 11723082
204 8048127762 8048127548 Bacteria 11053136
205 8048360049 8048356638 Bacteria 11044339
206 8048375828 8048369669 Bacteria 11666822
207 8048382379 8048379754 Bacteria 11877923
208 8048409282 8048406513 Bacteria 8936924
209 8056833997 8056829672 Bacteria 9045328
210 Ga0501038_0001636
211 rootH1_10085880
212 rootH1_10017338
213 Ga0068856_100072063
214 Ga0075368_10020674
215 Ga0075367_10036899
216 Ga0105246_10011435
217 Ga0182008_10002936
218 Ga0182007_10000813
219 Ga0183367_1006
220 Ga0209758_1004345
221 Ga0207647_10012520
222 Ga0209371_1009466
223 Ga0307517_10025773
224 Ga0307515_10006240
225 Ga0307515_10180549
226 Ga0307511_10001726
227 Ga0307511_10093401
228 Ga0307512_10014074
229 Ga0307512_10048656
230 Ga0307513_10002913
231 Ga0307513_10160153
232 Ga0307509_10044280
233 Ga0307509_10058329
234 Ga0307508_10003068
235 Ga0307508_10032520
236 Ga0307508_10039833
237 Ga0307508_10052777
238 Ga0307514_10018616
239 Ga0307514_10022482
240 Ga0307516_10016909
241 Ga0307518_10036164
242 Ga0307518_10136135
243 Ga0307507_10011377
244 Ga0307507_10080009
245 Ga0307510_10025522
246 Ga0307510_10138487
247 Ga0395898_0078522
248 Ga0439436_0011285
249 Ga0439439_0002456
250 Ga0451853_3097337
251 Ga0439448_0002086
252 Ga0439449_0019771
253 Ga0439457_000176
254 Ga0439462_0003376
255 Ga0450894_000342
256 Ga0450899_000150
257 Ga0450903_001328
258 Ga0450908_001926
259 Ga0466969_0007274
260 Ga0466972_0004427
261 Ga0466966_0004177
262 Ga0466963_0000044
263 Ga0466964_0012444
264 Ga0466971_0000057
265 Ga0466971_0045566
266 Ga0466970_0001231
267 Ga0466970_0015860
268 Ga0466957_0003762
269 Ga0466959_0020201
270 Ga0466967_0007565
271 Ga0495617_003793
272 Ga0495592_0005625
273 Ga0495592_0009560
274 Ga0495603_0000359
275 Ga0495603_0005052
276 Ga0495629_0109480
277 Ga0495580_0064105
278 Ga0495582_0031678
279 Ga0495605_0006266
280 Ga0495662_0058703
281 Ga0495664_0002549
282 Ga0495664_0025711
283 Ga0495584_0052843
284 Ga0495594_0049551
285 Ga0495607_0092864
286 Ga0495606_0007460
287 Ga0495616_0026464
288 Ga0495618_0049592
289 Ga0495628_0067621
290 Ga0495630_0072208
291 Ga0495631_0005069
292 Ga0495643_0005711
293 Ga0495652_0077572
294 Ga0495652_0130288
295 Ga0495654_0016371
296 Ga0495587_0079738
297 Ga0495597_0005241
298 Ga0495645_0077231
299 Ga0495622_0028007
300 Ga0495634_0008055
301 Ga0495634_0071763
302 Ga0495625_0020675
303 Ga0495625_0035339
304 Ga0495635_0000663
305 Ga0495635_0031941
306 Ga0495661_0030404
307 Ga0495588_0006938
308 Ga0495657_0005443
309 Ga0495646_0026437
310 Ga0495613_0048464
311 Ga0495671_0024074
312 Ga0495649_0022460
313 Ga0495589_0025056
314 Ga0495600_0004168
315 Ga0495604_0001796
316 Ga0495636_0000776
317 Ga0495636_0001545
318 Ga0495636_0016724
319 Ga0495674_0101889
320 Ga0495676_0032236
321 Ga0495676_0175235
322 Ga0495680_0006363
323 Ga0495687_003120
324 Ga0495687_003167
325 Ga0495687_044213
326 Ga0495675_0036864
327 Ga0495675_0082944
328 Ga0495685_014192
329 Ga0495681_0000356
330 Ga0495686_0012869
331 Ga0495686_0047077
332 Ga0495593_0001327
333 Ga0495614_0001248
334 Ga0495614_0057210
335 Ga0495626_0052118
336 Ga0496109_0276795
337 Ga0501032_0012038
338 Ga0501033_0021653
339 Ga0501033_0064275
340 Ga0501033_0089400
341 Ga0501034_0125219
342 Ga0501036_0085925
343 Ga0501038_0023589
344 Ga0501042_0008643
345 Ga0501043_0014478
346 Ga0501043_0199596
347 Ga0501046_0019454
348 Ga0501047_0096102
349 Ga0501047_0118029
350 Ga0501047_0192655
351 Ga0501048_0014576
352 Ga0501048_0059892
353 Ga0501035_0076509
354 Ga0501044_0023857
355 Ga0501044_0025410
356 Ga0501044_0113526
357 nmdc:mga04h51_12319_c1
358 Ga0500560_008245
359 Ga0466962_0000115
360 Ga0466962_0062259
361 2547406910
362 2585319359
363 2644436469
364 2644625688
365 2784587942
366 2785344196
367 2785368682
368 2786669800
369 2793979478
370 2804844959
371 2808841359
372 2808919894
373 2809231540
374 2812358882
375 2812481154
376 2852642137
377 2862288049
378 2862293867
379 2862392184
380 2862509567
381 2863405449
382 2867433459
383 2873156479
384 2877681820
385 2912720813
386 2912724925
387 2919468754
388 2946067009
389 2946075297
390 2947230238
391 2954003573
392 2954386964
393 2954676228
394 2954687940
395 2954697784
396 2954704432
397 2954716905
398 2954726855
399 2954734941
400 2954745775
401 2954753813
402 2954764750
403 2990064764
404 2997608097
405 3006396863
406 3006501852
407 8008559623
408 8008579516
409 8023630357
410 8025418924
411 8033691647
412 8047898870
413 8048127762
414 8048360049
415 8048375828
416 8048382379
417 8048409282
418 8056833997

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05506

PLipase_C_C

Bacterial phospholipase C, C-terminal domain

355

426

0.9

PF08341

TED

Thioester domain

121

225

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iby-assembly1.cif.gz_C red copper protein nitrosocyanin from nitrosomonas europaea 0.7044 308 368
7skp-assembly1.cif.gz_B de novo synthetic protein dig14 (tetragonal space group) 0.6673 294 347
5u7n-assembly7.cif.gz_G crystal structure of a chimeric cua domain (subunit ii) of cytochrome ba3 from thermus thermophilus with the amicyanin loop 0.6379 319 366
2mry-assembly1.cif.gz_A nmr solution structure of copper binding protein in the apo form 0.6345 319 366
2cua-assembly1.cif.gz_A the cua domain of cytochrome ba3 from thermus thermophilus 0.6238 319 367
ID Description Score Start End Superfamily
af_P9WN15_1246_1325_2.60.420.10 Mainly Beta;Sandwich;Maltose phosphorylase, domain 3;Maltose phosphorylase, domain 3 0.7377 295 343 2.60.420.10
4hcfA00 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.7038 311 366 2.60.40.420
3rnsA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6859 311 342 2.60.120.10
af_P9WN13_680_764_2.60.420.10 Mainly Beta;Sandwich;Maltose phosphorylase, domain 3;Maltose phosphorylase, domain 3 0.6853 293 347 2.60.420.10
af_F4JEI7_15_122_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.6478 297 342 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A5C6J5Z1-F1-model_v4 TQXA domain-containing protein 0.9577 1 376 GO:0004629
GO:0016042
AF-A0A5P2DUJ2-F1-model_v4 TQXA domain-containing protein 0.9526 27 292 GO:0016020
AF-A0A646J141-F1-model_v4 TQXA domain-containing protein 0.9363 1 356
AF-A0A646J141-F1-model_v4 TQXA domain-containing protein 0.9337 1 356
AF-A0A344UA31-F1-model_v4 TQXA domain-containing protein 0.9174 1 292 GO:0016020

Map