F319366

General Info

Members Datasets Scaffolds Average Seq Length
209 144 418 190

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0367349|Ga0395898_0367349_539_1210
Length 223
Sequence MGTIRFTSRLCMEAHLTNGAGGRDGDRGAQYRGGVGAQPNPYVLPADLPVPADDGAADHLTGEPVPALSLPSTHGAVDLAAAARGTLVLYVYPRTGRPGEPLPEGWDDIPGARGCTPQSCAFRDHFGELVSLGADVLGLSAQPLGDQVEFARRVGLPYPILSDPELLLAGELRLPTFEVAGMRLYRRLTLVAREGRIVNVFYPVFPPDRNAVEVVAWLETAET

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
73 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
86 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
89 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
97 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
118 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
119 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
132 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
142 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 0
Rhizoplane 10.53
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 4.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0367349 3300037466 Bacteria 1372
2 Ga0070683_100591557 3300005329 Bacteria 1062
3 Ga0070680_100152305 3300005336 Bacteria 1942
4 Ga0070682_100295995 3300005337 Bacteria 1185
5 Ga0068868_100826753 3300005338 Bacteria 837
6 Ga0070660_100272529 3300005339 Bacteria 1383
7 Ga0070689_100666701 3300005340 Bacteria 906
8 Ga0070692_10000862 3300005345 Bacteria 10200
9 Ga0070674_100360885 3300005356 Bacteria 1176
10 Ga0070688_100695154 3300005365 Bacteria 787
11 Ga0070710_10345657 3300005437 Bacteria 983
12 Ga0070681_10023688 3300005458 Bacteria 6179
13 Ga0070681_10113066 3300005458 Bacteria 2655
14 Ga0070707_100260052 3300005468 Bacteria 1689
15 Ga0070679_100022606 3300005530 Bacteria 6148
16 Ga0070684_100025953 3300005535 Bacteria 4930
17 Ga0070684_100603387 3300005535 Bacteria 1021
18 Ga0070686_100063321 3300005544 Bacteria 2395
19 Ga0070696_100520750 3300005546 Bacteria 949
20 Ga0068855_100490791 3300005563 Bacteria 1336
21 Ga0068852_100004826 3300005616 Bacteria 9578
22 Ga0068866_10147422 3300005718 Bacteria 1359
23 Ga0081455_10000560 3300005937 Bacteria 48455
24 Ga0081538_10001182 3300005981 Bacteria 27522
25 Ga0075365_10001801 3300006038 Bacteria 10000
26 Ga0075365_10004662 3300006038 Bacteria 7302
27 Ga0075365_10018571 3300006038 Bacteria 4277
28 Ga0075364_10078013 3300006051 Bacteria 2187
29 Ga0070715_10020608 3300006163 Bacteria 2545
30 Ga0070712_100017609 3300006175 Bacteria 4627
31 Ga0075362_10012185 3300006177 Bacteria 3409
32 Ga0075367_10168359 3300006178 Bacteria 1364
33 Ga0075428_100431282 3300006844 Unclassified 1412
34 Ga0075428_100787207 3300006844 Bacteria 1011
35 Ga0075430_100060102 3300006846 Bacteria 3194
36 Ga0075431_100072132 3300006847 Bacteria 3563
37 Ga0075434_100005300 3300006871 Bacteria 11730
38 Ga0075434_100097171 3300006871 Bacteria 2950
39 Ga0075434_100258151 3300006871 Bacteria 1761
40 Ga0075434_100786216 3300006871 Unclassified 968
41 Ga0068865_100097598 3300006881 Bacteria 2145
42 Ga0075436_100181124 3300006914 Unclassified 1489
43 Ga0075435_100031988 3300007076 Bacteria 4152
44 Ga0075435_100035642 3300007076 Bacteria 3949
45 Ga0075435_100239816 3300007076 Bacteria 1542
46 Ga0105240_10017437 3300009093 Bacteria 9676
47 Ga0111539_10001090 3300009094 Bacteria 35870
48 Ga0111539_11813203 3300009094 Bacteria 707
49 Ga0105245_10013232 3300009098 Bacteria 7189
50 Ga0105245_10831454 3300009098 Bacteria 963
51 Ga0105245_10974458 3300009098 Bacteria 892
52 Ga0114129_10041412 3300009147 Bacteria 6490
53 Ga0114129_10247898 3300009147 Bacteria 2392
54 Ga0114129_10254192 3300009147 Unclassified 2358
55 Ga0105243_10167874 3300009148 Bacteria 1898
56 Ga0105237_10030735 3300009545 Bacteria 5452
57 Ga0105238_10007816 3300009551 Bacteria 10696
58 Ga0105249_10213985 3300009553 Bacteria 1893
59 Ga0105249_10497125 3300009553 Bacteria 1264
60 Ga0157370_10032052 3300013104 Bacteria 5135
61 Ga0157369_10008655 3300013105 Bacteria 11672
62 Ga0157378_10055936 3300013297 Bacteria 3515
63 Ga0163162_10041017 3300013306 Bacteria 4630
64 Ga0157372_10016223 3300013307 Bacteria 7992
65 Ga0157375_10402651 3300013308 Bacteria 1535
66 Ga0157375_10419701 3300013308 Bacteria 1504
67 Ga0182008_10127312 3300014497 Bacteria 1269
68 Ga0207707_10205956 3300025912 Bacteria 1714
69 Ga0207693_10009770 3300025915 Bacteria 7810
70 Ga0207663_10018513 3300025916 Bacteria 3905
71 Ga0207660_10318206 3300025917 Bacteria 1242
72 Ga0207657_10016767 3300025919 Bacteria 7053
73 Ga0207657_10286484 3300025919 Bacteria 1307
74 Ga0207652_10090132 3300025921 Bacteria 2694
75 Ga0207652_10189142 3300025921 Bacteria 1852
76 Ga0207687_10035262 3300025927 Bacteria 3402
77 Ga0207687_10100514 3300025927 Bacteria 2128
78 Ga0207670_10733048 3300025936 Bacteria 820
79 Ga0207704_10062874 3300025938 Bacteria 2311
80 Ga0207689_10119275 3300025942 Bacteria 2170
81 Ga0207679_10389975 3300025945 Bacteria 1223
82 Ga0207668_10932497 3300025972 Bacteria 774
83 Ga0207677_10076872 3300026023 Bacteria 2378
84 Ga0207677_10377108 3300026023 Bacteria 1196
85 Ga0207683_10093616 3300026121 Bacteria 2678
86 Ga0207428_10011560 3300027907 Bacteria 7795
87 Ga0207428_10058890 3300027907 Bacteria 3047
88 Ga0207428_10421295 3300027907 Bacteria 976
89 Ga0265331_10059306 3300031250 Bacteria 1810
90 Ga0307416_100030453 3300032002 Bacteria 4049
91 Ga0307416_100306918 3300032002 Bacteria 1581
92 Ga0307415_100250886 3300032126 Bacteria 1438
93 Ga0373927_0525886 3300035695 Bacteria 782
94 Ga0373933_0143642 3300035724 Bacteria 1508
95 Ga0373925_0563972 3300037068 Bacteria 937
96 Ga0395899_0319782 3300037312 Bacteria 1046
97 Ga0395900_0002687 3300037418 Bacteria 19449
98 Ga0395900_0069406 3300037418 Bacteria 3622
99 Ga0395900_0532954 3300037418 Unclassified 1121
100 Ga0395898_0025811 3300037466 Bacteria 5917
101 Ga0395898_0055614 3300037466 Bacteria 3859
102 Ga0395898_0365843 3300037466 Bacteria 1375
103 Ga0395898_1045781 3300037466 Bacteria 751
104 Ga0395905_0634761 3300037471 Bacteria 970
105 Ga0395905_0777337 3300037471 Bacteria 860
106 Ga0395905_1000728 3300037471 Bacteria 739
107 Ga0395901_0021987 3300038443 Bacteria 6538
108 Ga0395901_0075912 3300038443 Bacteria 3506
109 Ga0395901_0180495 3300038443 Bacteria 2214
110 Ga0395901_0241287 3300038443 Bacteria 1885
111 Ga0395901_0484456 3300038443 Bacteria 1261
112 Ga0395901_0511175 3300038443 Bacteria 1222
113 Ga0395901_0616737 3300038443 Bacteria 1092
114 Ga0395901_0712574 3300038443 Bacteria 1000
115 Ga0395901_0803077 3300038443 Bacteria 930
116 Ga0439460_0230759 3300042461 Bacteria 636
117 Ga0466970_0081095 3300044765 Bacteria 1754
118 Ga0451576_0674772 3300045051 Bacteria 1086
119 Ga0495603_0419957 3300046455 Bacteria 766
120 Ga0495641_0040387 3300046461 Bacteria 2169
121 Ga0495594_0167201 3300046499 Bacteria 1251
122 Ga0495630_0561696 3300046517 Unclassified 875
123 Ga0495644_0207580 3300046523 Bacteria 756
124 Ga0495581_0562216 3300047315 Unclassified 662
125 Ga0495674_0799366 3300047319 Unclassified 734
126 Ga0495672_0010863 3300047320 Bacteria 6459
127 Ga0495676_0033576 3300047321 Bacteria 4319
128 Ga0495677_0153343 3300047445 Unclassified 888
129 Ga0495614_0291289 3300048089 Bacteria 753
130 Ga0496100_0003380 3300048903 Bacteria 8314
131 Ga0496100_0037116 3300048903 Bacteria 3078
132 Ga0496101_0002387 3300048904 Bacteria 11527
133 Ga0496102_0011385 3300048905 Bacteria 7664
134 Ga0496103_0001560 3300048906 Bacteria 15171
135 Ga0496104_0027687 3300048907 Bacteria 5247
136 Ga0496105_0214888 3300048908 Bacteria 1566
137 Ga0496106_0033199 3300048909 Bacteria 3850
138 Ga0496107_0003811 3300048910 Bacteria 10127
139 Ga0496108_0016864 3300048911 Bacteria 5969
140 Ga0496109_0146021 3300048912 Bacteria 2213
141 Ga0496109_0541396 3300048912 Bacteria 1098
142 Ga0496109_0915097 3300048912 Bacteria 815
143 Ga0496110_0199542 3300048913 Bacteria 1817
144 Ga0496110_0714322 3300048913 Bacteria 904
145 Ga0496111_0005036 3300048914 Bacteria 8405
146 Ga0496112_0088174 3300048915 Bacteria 3070
147 Ga0496113_0065491 3300048916 Bacteria 2750
148 Ga0496113_0166896 3300048916 Bacteria 1742
149 Ga0496113_0613015 3300048916 Bacteria 871
150 Ga0496114_0018864 3300048917 Bacteria 5585
151 Ga0496115_0002652 3300048918 Bacteria 12843
152 Ga0496124_0061271 3300048927 Bacteria 3154
153 Ga0501031_0000862 3300049568 Bacteria 18231
154 Ga0501032_0025386 3300049569 Bacteria 4085
155 Ga0501036_0016992 3300049572 Bacteria 6079
156 Ga0501037_0020890 3300049573 Bacteria 4834
157 Ga0501038_0022506 3300049574 Bacteria 5646
158 Ga0501040_0038741 3300049576 Bacteria 3240
159 Ga0501041_0001018 3300049577 Bacteria 15312
160 Ga0501042_0001698 3300049578 Bacteria 13142
161 Ga0501043_0009881 3300049579 Bacteria 7480
162 Ga0501046_0000511 3300049580 Bacteria 38395
163 Ga0501067_0000146 3300049583 Bacteria 39148
164 Ga0501067_0153859 3300049583 Bacteria 1281
165 Ga0501068_0000040 3300049584 Bacteria 48135
166 Ga0501068_0002005 3300049584 Bacteria 10824
167 Ga0501069_0000061 3300049585 Bacteria 61031
168 Ga0501069_0000588 3300049585 Bacteria 16841
169 Ga0501070_0017039 3300049586 Bacteria 6097
170 Ga0501070_0208822 3300049586 Bacteria 1603
171 Ga0501071_0024616 3300049587 Bacteria 4210
172 Ga0501073_0028280 3300049589 Bacteria 4006
173 Ga0501074_0026416 3300049590 Bacteria 4210
174 Ga0501077_0036966 3300049593 Bacteria 3110
175 Ga0501079_0014225 3300049741 Bacteria 6066
176 Ga0501080_0024592 3300049742 Bacteria 5584
177 Ga0501081_0078674 3300049743 Bacteria 2305
178 Ga0501083_0035803 3300049744 Bacteria 3390
179 Ga0501035_0023127 3300049822 Bacteria 5703
180 Ga0501044_0028571 3300049823 Bacteria 5887
181 Ga0501045_0014931 3300049824 Bacteria 5509
182 nmdc:mga03683_171245_c1 3300050489 Bacteria 987
183 nmdc:mga0yw44_21240_c1 3300050492 Bacteria 3618
184 nmdc:mga0yw44_4928_c1 3300050492 Bacteria 6214
185 nmdc:mga0yw44_49373_c1 3300050492 Bacteria 2539
186 nmdc:mga06z11_233987_c1 3300050494 Bacteria 1077
187 nmdc:mga04h51_143632_c1 3300050495 Bacteria 907
188 nmdc:mga05p37_14392_c1 3300050507 Bacteria 9498
189 nmdc:mga05p37_29889_c1 3300050507 Bacteria 6650
190 nmdc:mga05p37_4129_c2 3300050507 Bacteria 15927
191 nmdc:mga05p37_565179_c1 3300050507 Bacteria 1291
192 nmdc:mga06r32_105271_c1 3300050510 Bacteria 2772
193 nmdc:mga06r32_6376_c1 3300050510 Bacteria 10604
194 nmdc:mga08y16_17680_c1 3300050511 Bacteria 7510
195 nmdc:mga08y16_586633_c1 3300050511 Bacteria 1125
196 nmdc:mga0n895_248868_c1 3300050512 Bacteria 1804
197 nmdc:mga0n895_3156_c1 3300050512 Bacteria 13163
198 nmdc:mga0n895_82239_c1 3300050512 Bacteria 3210
199 nmdc:mga0n895_83238_c1 3300050512 Bacteria 3191
200 nmdc:mga0rr50_178025_c1 3300050513 Bacteria 1737
201 nmdc:mga0rr50_46871_c1 3300050513 Bacteria 3184
202 nmdc:mga0rr50_87736_c1 3300050513 Bacteria 2415
203 nmdc:mga08x19_168786_c1 3300050514 Unclassified 1489
204 nmdc:mga0a205_226000_c1 3300050515 Bacteria 1756
205 nmdc:mga0a205_23492_c1 3300050515 Bacteria 5849
206 nmdc:mga0a205_46199_c1 3300050515 Bacteria 4200
207 Ga0501082_0171285 3300060353 Bacteria 1888
208 Ga0530510_0012379 3300061734 Bacteria 5992
209 Ga0530510_0056874 3300061734 Bacteria 2826
210 Ga0395898_0367349
211 Ga0070683_100591557
212 Ga0070680_100152305
213 Ga0070682_100295995
214 Ga0068868_100826753
215 Ga0070660_100272529
216 Ga0070689_100666701
217 Ga0070692_10000862
218 Ga0070674_100360885
219 Ga0070688_100695154
220 Ga0070710_10345657
221 Ga0070681_10023688
222 Ga0070681_10113066
223 Ga0070707_100260052
224 Ga0070679_100022606
225 Ga0070684_100025953
226 Ga0070684_100603387
227 Ga0070686_100063321
228 Ga0070696_100520750
229 Ga0068855_100490791
230 Ga0068852_100004826
231 Ga0068866_10147422
232 Ga0081455_10000560
233 Ga0081538_10001182
234 Ga0075365_10001801
235 Ga0075365_10004662
236 Ga0075365_10018571
237 Ga0075364_10078013
238 Ga0070715_10020608
239 Ga0070712_100017609
240 Ga0075362_10012185
241 Ga0075367_10168359
242 Ga0075428_100431282
243 Ga0075428_100787207
244 Ga0075430_100060102
245 Ga0075431_100072132
246 Ga0075434_100005300
247 Ga0075434_100097171
248 Ga0075434_100258151
249 Ga0075434_100786216
250 Ga0068865_100097598
251 Ga0075436_100181124
252 Ga0075435_100031988
253 Ga0075435_100035642
254 Ga0075435_100239816
255 Ga0105240_10017437
256 Ga0111539_10001090
257 Ga0111539_11813203
258 Ga0105245_10013232
259 Ga0105245_10831454
260 Ga0105245_10974458
261 Ga0114129_10041412
262 Ga0114129_10247898
263 Ga0114129_10254192
264 Ga0105243_10167874
265 Ga0105237_10030735
266 Ga0105238_10007816
267 Ga0105249_10213985
268 Ga0105249_10497125
269 Ga0157370_10032052
270 Ga0157369_10008655
271 Ga0157378_10055936
272 Ga0163162_10041017
273 Ga0157372_10016223
274 Ga0157375_10402651
275 Ga0157375_10419701
276 Ga0182008_10127312
277 Ga0207707_10205956
278 Ga0207693_10009770
279 Ga0207663_10018513
280 Ga0207660_10318206
281 Ga0207657_10016767
282 Ga0207657_10286484
283 Ga0207652_10090132
284 Ga0207652_10189142
285 Ga0207687_10035262
286 Ga0207687_10100514
287 Ga0207670_10733048
288 Ga0207704_10062874
289 Ga0207689_10119275
290 Ga0207679_10389975
291 Ga0207668_10932497
292 Ga0207677_10076872
293 Ga0207677_10377108
294 Ga0207683_10093616
295 Ga0207428_10011560
296 Ga0207428_10058890
297 Ga0207428_10421295
298 Ga0265331_10059306
299 Ga0307416_100030453
300 Ga0307416_100306918
301 Ga0307415_100250886
302 Ga0373927_0525886
303 Ga0373933_0143642
304 Ga0373925_0563972
305 Ga0395899_0319782
306 Ga0395900_0002687
307 Ga0395900_0069406
308 Ga0395900_0532954
309 Ga0395898_0025811
310 Ga0395898_0055614
311 Ga0395898_0365843
312 Ga0395898_1045781
313 Ga0395905_0634761
314 Ga0395905_0777337
315 Ga0395905_1000728
316 Ga0395901_0021987
317 Ga0395901_0075912
318 Ga0395901_0180495
319 Ga0395901_0241287
320 Ga0395901_0484456
321 Ga0395901_0511175
322 Ga0395901_0616737
323 Ga0395901_0712574
324 Ga0395901_0803077
325 Ga0439460_0230759
326 Ga0466970_0081095
327 Ga0451576_0674772
328 Ga0495603_0419957
329 Ga0495641_0040387
330 Ga0495594_0167201
331 Ga0495630_0561696
332 Ga0495644_0207580
333 Ga0495581_0562216
334 Ga0495674_0799366
335 Ga0495672_0010863
336 Ga0495676_0033576
337 Ga0495677_0153343
338 Ga0495614_0291289
339 Ga0496100_0003380
340 Ga0496100_0037116
341 Ga0496101_0002387
342 Ga0496102_0011385
343 Ga0496103_0001560
344 Ga0496104_0027687
345 Ga0496105_0214888
346 Ga0496106_0033199
347 Ga0496107_0003811
348 Ga0496108_0016864
349 Ga0496109_0146021
350 Ga0496109_0541396
351 Ga0496109_0915097
352 Ga0496110_0199542
353 Ga0496110_0714322
354 Ga0496111_0005036
355 Ga0496112_0088174
356 Ga0496113_0065491
357 Ga0496113_0166896
358 Ga0496113_0613015
359 Ga0496114_0018864
360 Ga0496115_0002652
361 Ga0496124_0061271
362 Ga0501031_0000862
363 Ga0501032_0025386
364 Ga0501036_0016992
365 Ga0501037_0020890
366 Ga0501038_0022506
367 Ga0501040_0038741
368 Ga0501041_0001018
369 Ga0501042_0001698
370 Ga0501043_0009881
371 Ga0501046_0000511
372 Ga0501067_0000146
373 Ga0501067_0153859
374 Ga0501068_0000040
375 Ga0501068_0002005
376 Ga0501069_0000061
377 Ga0501069_0000588
378 Ga0501070_0017039
379 Ga0501070_0208822
380 Ga0501071_0024616
381 Ga0501073_0028280
382 Ga0501074_0026416
383 Ga0501077_0036966
384 Ga0501079_0014225
385 Ga0501080_0024592
386 Ga0501081_0078674
387 Ga0501083_0035803
388 Ga0501035_0023127
389 Ga0501044_0028571
390 Ga0501045_0014931
391 nmdc:mga03683_171245_c1
392 nmdc:mga0yw44_21240_c1
393 nmdc:mga0yw44_4928_c1
394 nmdc:mga0yw44_49373_c1
395 nmdc:mga06z11_233987_c1
396 nmdc:mga04h51_143632_c1
397 nmdc:mga05p37_14392_c1
398 nmdc:mga05p37_29889_c1
399 nmdc:mga05p37_4129_c2
400 nmdc:mga05p37_565179_c1
401 nmdc:mga06r32_105271_c1
402 nmdc:mga06r32_6376_c1
403 nmdc:mga08y16_17680_c1
404 nmdc:mga08y16_586633_c1
405 nmdc:mga0n895_248868_c1
406 nmdc:mga0n895_3156_c1
407 nmdc:mga0n895_82239_c1
408 nmdc:mga0n895_83238_c1
409 nmdc:mga0rr50_178025_c1
410 nmdc:mga0rr50_46871_c1
411 nmdc:mga0rr50_87736_c1
412 nmdc:mga08x19_168786_c1
413 nmdc:mga0a205_226000_c1
414 nmdc:mga0a205_23492_c1
415 nmdc:mga0a205_46199_c1
416 Ga0501082_0171285
417 Ga0530510_0012379
418 Ga0530510_0056874

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08534

Redoxin

Redoxin

60

215

0.93

PF00578

AhpC-TSA

AhpC/TSA family

109

200

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eo3-assembly1.cif.gz_B peroxiredoxin nitroreductase fusion enzyme 0.8582 27 184
3drn-assembly2.cif.gz_B the crystal structure of bcp1 from sulfolobus sulfataricus 0.8508 26 186
5enu-assembly2.cif.gz_B crystal structure of an alkyl hyroperoxide reductase from burkholderia ambifaria 0.8451 25 183
5epf-assembly1.cif.gz_A crystal structure of peroxidoxin bcpb from mycobacterium tuberculosis 0.837 24 183
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.8343 26 185
ID Description Score Start End Superfamily
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8742 24 187 3.40.30.10
af_Q54W30_4_152_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8633 24 187 3.40.30.10
af_I1MS47_66_213_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.863 25 183 3.40.30.10
af_Q5A7P9_48_194_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8601 27 186 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8582 27 184 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0SVD2-F1-model_v4 Peroxiredoxin 0.9855 1 183 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A210S0D5-F1-model_v4 Peroxiredoxin 0.9838 3 183 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A536PUT8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9829 24 183 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A7W0QVQ7-F1-model_v4 Peroxiredoxin 0.9823 5 186 GO:0005737
GO:0008379
GO:0034599
GO:0045454
AF-A0A1Q7NBS3-F1-model_v4 Peroxiredoxin 0.9819 5 183 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map