F319229

General Info

Members Datasets Scaffolds Average Seq Length
209 142 418 167

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10047786|Ga0265338_100477862
Length 193
Sequence VTTTSLQELYVEQLQDLYDAEQQIIKALPKMIDAAQAEELRDGLSEHLEVTKQQAARIEKICQDLGEKPQKEKCKGMEGVLKEGGDLVKDVENPEVRDAAIIAAAQRVEHYEMAGYGTARTYATLLGYDDAASALEQTLEEEKEADATLSGLAGKLNVEALDEDTAGTSATHESKRPSSKREMPKSGRGKHAA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
96 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
97 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
111 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
112 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
113 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
114 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
126 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
142 2909042592 Labrys sp. LIt4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.85
Metatranscriptomes 40.19
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.48
Rhizoplane 0.96
Rhizosphere 95.69
Stem 0
Stem Tuber 0
Unclassified 22.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10047786 3300028800 Bacteria 3903
2 Ga0006778J45830_1029673 3300003162 Bacteria 612
3 JGI25406J46586_10070068 3300003203 Bacteria 1103
4 Ga0006777J48905_1029871 3300003308 Bacteria 617
5 Ga0006777J48905_1042320 3300003308 Bacteria 640
6 rootH2_10020267 3300003320 Bacteria 15755
7 rootH2_10090279 3300003320 Bacteria 4646
8 Ga0006781J51513_1021073 3300003568 Bacteria 614
9 Ga0007429J51699_1033594 3300003579 Bacteria 798
10 Ga0007429J51699_1047289 3300003579 Unclassified 627
11 Ga0007429J51699_1080224 3300003579 Unclassified 570
12 Ga0007429J51699_1100370 3300003579 Bacteria 623
13 Ga0032354_1010529 3300003693 Unclassified 619
14 Ga0032354_1015277 3300003693 Bacteria 614
15 Ga0032354_1054802 3300003693 Bacteria 686
16 Ga0032354_1129214 3300003693 Bacteria 579
17 Ga0006780_1023730 3300003735 Bacteria 620
18 Ga0006780_1052917 3300003735 Unclassified 593
19 Ga0006780_1074146 3300003735 Unclassified 590
20 Ga0058863_11495598 3300004799 Bacteria 688
21 Ga0058860_10022229 3300004801 Bacteria 608
22 Ga0070676_10037524 3300005328 Bacteria 2795
23 Ga0070670_100446009 3300005331 Bacteria 1146
24 Ga0068869_100299645 3300005334 Bacteria 1298
25 Ga0068868_100581497 3300005338 Bacteria 990
26 Ga0070668_100230336 3300005347 Unclassified 1531
27 Ga0070675_100007489 3300005354 Bacteria 8435
28 Ga0070675_100525705 3300005354 Bacteria 1068
29 Ga0070659_100216295 3300005366 Bacteria 1580
30 Ga0070667_100003193 3300005367 Bacteria 14042
31 Ga0070709_10273930 3300005434 Unclassified 1224
32 Ga0070714_100027170 3300005435 Bacteria 4736
33 Ga0070713_100025953 3300005436 Bacteria 4591
34 Ga0070713_100632585 3300005436 Bacteria 1018
35 Ga0070710_10077622 3300005437 Unclassified 1931
36 Ga0070711_100141088 3300005439 Bacteria 1807
37 Ga0070662_100110954 3300005457 Bacteria 2089
38 Ga0070698_101886456 3300005471 Bacteria 550
39 Ga0068853_100496271 3300005539 Unclassified 1152
40 Ga0070672_101073155 3300005543 Bacteria 715
41 Ga0070695_100342717 3300005545 Unclassified 1117
42 Ga0070695_100526353 3300005545 Unclassified 918
43 Ga0070696_100159311 3300005546 Unclassified 1662
44 Ga0070665_100943640 3300005548 Bacteria 875
45 Ga0068854_100851445 3300005578 Bacteria 798
46 Ga0068864_100223746 3300005618 Bacteria 1737
47 Ga0068863_100228740 3300005841 Bacteria 1793
48 Ga0068858_100509428 3300005842 Unclassified 1163
49 Ga0068862_100383977 3300005844 Bacteria 1311
50 Ga0081539_10010902 3300005985 Bacteria 7297
51 Ga0070712_100816342 3300006175 Unclassified 801
52 Ga0068871_100004430 3300006358 Bacteria 9767
53 Ga0068871_101058823 3300006358 Unclassified 757
54 Ga0075434_100004008 3300006871 Bacteria 13191
55 Ga0075435_100049344 3300007076 Unclassified 3385
56 Ga0105244_10524939 3300009036 Unclassified 545
57 Ga0105245_10181373 3300009098 Bacteria 2012
58 Ga0105247_11473868 3300009101 Bacteria 554
59 Ga0105243_10040904 3300009148 Bacteria 3623
60 Ga0105243_11416146 3300009148 Bacteria 716
61 Ga0105237_10408365 3300009545 Bacteria 1363
62 Ga0105249_10004319 3300009553 Bacteria 12290
63 Ga0099796_10028479 3300010159 Bacteria 1794
64 Ga0157378_10029752 3300013297 Bacteria 4822
65 Ga0157378_10356944 3300013297 Unclassified 1429
66 Ga0163162_10006126 3300013306 Bacteria 11646
67 Ga0163162_10729828 3300013306 Bacteria 1111
68 Ga0157372_10188655 3300013307 Bacteria 2387
69 Ga0157372_11808636 3300013307 Bacteria 702
70 Ga0157375_10826292 3300013308 Bacteria 1074
71 Ga0157375_11118041 3300013308 Unclassified 923
72 Ga0163163_10211003 3300014325 Bacteria 1991
73 Ga0163163_10440636 3300014325 Bacteria 1362
74 Ga0157380_10034364 3300014326 Unclassified 3911
75 Ga0157380_10052016 3300014326 Bacteria 3242
76 Ga0157379_11194872 3300014968 Unclassified 731
77 Ga0197907_10555008 3300020069 Bacteria 619
78 Ga0197907_10996635 3300020069 Bacteria 558
79 Ga0206356_10684795 3300020070 Bacteria 708
80 Ga0206356_10730441 3300020070 Bacteria 616
81 Ga0206356_11707736 3300020070 Unclassified 665
82 Ga0206349_1134898 3300020075 Bacteria 567
83 Ga0206349_1367816 3300020075 Unclassified 668
84 Ga0206349_1684506 3300020075 Bacteria 572
85 Ga0206349_1891274 3300020075 Bacteria 618
86 Ga0206355_1044650 3300020076 Unclassified 752
87 Ga0206355_1113497 3300020076 Unclassified 796
88 Ga0206355_1296722 3300020076 Bacteria 708
89 Ga0206355_1395514 3300020076 Bacteria 529
90 Ga0206355_1497963 3300020076 Bacteria 618
91 Ga0206351_10083536 3300020077 Bacteria 726
92 Ga0206351_10252517 3300020077 Bacteria 562
93 Ga0206351_10954085 3300020077 Bacteria 619
94 Ga0206352_10104355 3300020078 Bacteria 562
95 Ga0206352_10113872 3300020078 Bacteria 614
96 Ga0206352_10360346 3300020078 Bacteria 540
97 Ga0206352_10974067 3300020078 Bacteria 721
98 Ga0206352_11292290 3300020078 Bacteria 766
99 Ga0206350_10423351 3300020080 Bacteria 833
100 Ga0206350_10644674 3300020080 Bacteria 601
101 Ga0206350_10939445 3300020080 Unclassified 612
102 Ga0206350_11515168 3300020080 Bacteria 647
103 Ga0206350_11593254 3300020080 Bacteria 924
104 Ga0206354_10469662 3300020081 Bacteria 572
105 Ga0206354_10640377 3300020081 Bacteria 536
106 Ga0206354_11558639 3300020081 Bacteria 691
107 Ga0206354_11623913 3300020081 Unclassified 617
108 Ga0206353_10272107 3300020082 Unclassified 611
109 Ga0206353_10695887 3300020082 Unclassified 806
110 Ga0206353_11632481 3300020082 Bacteria 630
111 Ga0206353_11740099 3300020082 Bacteria 567
112 Ga0154015_1224037 3300020610 Bacteria 770
113 Ga0154015_1254443 3300020610 Bacteria 651
114 Ga0213871_10078578 3300021441 Bacteria 942
115 Ga0224712_10058495 3300022467 Bacteria 1527
116 Ga0224712_10232628 3300022467 Bacteria 847
117 Ga0224712_10333290 3300022467 Bacteria 715
118 Ga0224712_10354121 3300022467 Bacteria 694
119 Ga0224712_10364897 3300022467 Unclassified 684
120 Ga0224712_10437829 3300022467 Bacteria 626
121 Ga0224712_10460079 3300022467 Bacteria 612
122 Ga0207666_1001745 3300025271 Bacteria 2583
123 Ga0207697_10045484 3300025315 Bacteria 1807
124 Ga0207692_10221036 3300025898 Bacteria 1123
125 Ga0207699_10639763 3300025906 Unclassified 776
126 Ga0207645_10002579 3300025907 Bacteria 14137
127 Ga0207645_10096294 3300025907 Bacteria 1906
128 Ga0207643_10648540 3300025908 Bacteria 681
129 Ga0207693_10227249 3300025915 Bacteria 1466
130 Ga0207663_10554615 3300025916 Unclassified 899
131 Ga0207660_11210730 3300025917 Bacteria 614
132 Ga0207662_10000946 3300025918 Bacteria 13475
133 Ga0207650_10345931 3300025925 Bacteria 1222
134 Ga0207659_10003700 3300025926 Bacteria 9220
135 Ga0207659_10888860 3300025926 Bacteria 766
136 Ga0207700_10225022 3300025928 Bacteria 1592
137 Ga0207700_10680791 3300025928 Bacteria 918
138 Ga0207706_10003825 3300025933 Bacteria 14343
139 Ga0207706_10100264 3300025933 Bacteria 2548
140 Ga0207670_10070537 3300025936 Bacteria 2414
141 Ga0207669_10849706 3300025937 Bacteria 760
142 Ga0207689_10117507 3300025942 Bacteria 2186
143 Ga0207712_10063018 3300025961 Bacteria 2638
144 Ga0207668_10009465 3300025972 Bacteria 5842
145 Ga0207658_10113302 3300025986 Bacteria 2148
146 Ga0207703_10781316 3300026035 Unclassified 911
147 Ga0207639_10916931 3300026041 Unclassified 819
148 Ga0207675_100263994 3300026118 Unclassified 1669
149 Ga0265356_1015810 3300028017 Bacteria 818
150 Ga0268265_10580712 3300028380 Bacteria 1068
151 Ga0268264_10235259 3300028381 Bacteria 1694
152 Ga0265319_1099216 3300028563 Unclassified 915
153 Ga0265334_10167898 3300028573 Bacteria 769
154 Ga0310981_1009213 3300029285 Bacteria 674
155 Ga0265777_115015 3300030877 Bacteria 602
156 Ga0265776_111888 3300030880 Unclassified 529
157 Ga0265332_10141375 3300031238 Bacteria 1008
158 Ga0265325_10101242 3300031241 Bacteria 1410
159 Ga0265325_10128802 3300031241 Bacteria 1213
160 Ga0265339_10017977 3300031249 Bacteria 4178
161 Ga0265316_10041826 3300031344 Bacteria 3665
162 Ga0307414_10684721 3300032004 Unclassified 927
163 Ga0373936_0259890 3300035113 Unclassified 777
164 Ga0373943_0013783 3300035170 Bacteria 3655
165 Ga0373947_0087277 3300035725 Bacteria 1940
166 Ga0373925_0006809 3300037068 Bacteria 8369
167 Ga0395900_0379886 3300037418 Bacteria 1381
168 Ga0436365_0808407 3300039437 Bacteria 697
169 Ga0436360_0125898 3300039438 Bacteria 1870
170 Ga0439465_0142634 3300041413 Bacteria 852
171 Ga0451837_1071500 3300041494 Bacteria 991
172 Ga0450920_117647 3300042122 Bacteria 557
173 Ga0450923_116750 3300042125 Bacteria 627
174 Ga0453683_0428947 3300044673 Unclassified 854
175 Ga0466963_0580306 3300044694 Bacteria 792
176 Ga0451576_0151189 3300045051 Bacteria 2421
177 Ga0466967_0088012 3300045976 Bacteria 2817
178 Ga0466967_0169727 3300045976 Bacteria 2052
179 Ga0466967_0925922 3300045976 Unclassified 867
180 Ga0466967_1432381 3300045976 Bacteria 688
181 Ga0496105_0941418 3300048908 Unclassified 649
182 Ga0496112_0220006 3300048915 Bacteria 1855
183 Ga0501068_0744171 3300049584 Unclassified 642
184 Ga0501070_0496253 3300049586 Bacteria 981
185 nmdc:mga0n895_27653_c1 3300050512 Bacteria 5390
186 nmdc:mga0rr50_40393_c1 3300050513 Unclassified 3392
187 nmdc:mga0a205_470144_c1 3300050515 Unclassified 1116
188 Ga0587066_081826 3300059490 Bacteria 701
189 Ga0587073_0073011 3300059492 Bacteria 833
190 Ga0587073_0086425 3300059492 Bacteria 789
191 Ga0587080_116871 3300059503 Bacteria 587
192 Ga0587082_035890 3300059504 Bacteria 887
193 Ga0587082_061440 3300059504 Bacteria 742
194 Ga0587083_0064468 3300059505 Bacteria 835
195 Ga0587083_0197832 3300059505 Bacteria 572
196 Ga0587088_093695 3300059508 Bacteria 661
197 Ga0587091_057440 3300059511 Bacteria 817
198 Ga0587098_066222 3300059604 Unclassified 577
199 Ga0587098_071907 3300059604 Bacteria 562
200 Ga0587115_019048 3300059626 Viruses 940
201 Ga0587128_116570 3300059630 Bacteria 577
202 Ga0587067_024944 3300059640 Bacteria 1060
203 Ga0587075_045217 3300059644 Unclassified 752
204 Ga0587079_059166 3300059647 Bacteria 826
205 Ga0587107_043479 3300059652 Bacteria 735
206 Ga0587114_020912 3300059655 Bacteria 922
207 Ga0587114_103820 3300059655 Bacteria 557
208 2688391895 2687453341 Bacteria 6534136
209 2909048651 2909042592 Bacteria 6499737
210 Ga0265338_10047786
211 Ga0006778J45830_1029673
212 JGI25406J46586_10070068
213 Ga0006777J48905_1029871
214 Ga0006777J48905_1042320
215 rootH2_10020267
216 rootH2_10090279
217 Ga0006781J51513_1021073
218 Ga0007429J51699_1033594
219 Ga0007429J51699_1047289
220 Ga0007429J51699_1080224
221 Ga0007429J51699_1100370
222 Ga0032354_1010529
223 Ga0032354_1015277
224 Ga0032354_1054802
225 Ga0032354_1129214
226 Ga0006780_1023730
227 Ga0006780_1052917
228 Ga0006780_1074146
229 Ga0058863_11495598
230 Ga0058860_10022229
231 Ga0070676_10037524
232 Ga0070670_100446009
233 Ga0068869_100299645
234 Ga0068868_100581497
235 Ga0070668_100230336
236 Ga0070675_100007489
237 Ga0070675_100525705
238 Ga0070659_100216295
239 Ga0070667_100003193
240 Ga0070709_10273930
241 Ga0070714_100027170
242 Ga0070713_100025953
243 Ga0070713_100632585
244 Ga0070710_10077622
245 Ga0070711_100141088
246 Ga0070662_100110954
247 Ga0070698_101886456
248 Ga0068853_100496271
249 Ga0070672_101073155
250 Ga0070695_100342717
251 Ga0070695_100526353
252 Ga0070696_100159311
253 Ga0070665_100943640
254 Ga0068854_100851445
255 Ga0068864_100223746
256 Ga0068863_100228740
257 Ga0068858_100509428
258 Ga0068862_100383977
259 Ga0081539_10010902
260 Ga0070712_100816342
261 Ga0068871_100004430
262 Ga0068871_101058823
263 Ga0075434_100004008
264 Ga0075435_100049344
265 Ga0105244_10524939
266 Ga0105245_10181373
267 Ga0105247_11473868
268 Ga0105243_10040904
269 Ga0105243_11416146
270 Ga0105237_10408365
271 Ga0105249_10004319
272 Ga0099796_10028479
273 Ga0157378_10029752
274 Ga0157378_10356944
275 Ga0163162_10006126
276 Ga0163162_10729828
277 Ga0157372_10188655
278 Ga0157372_11808636
279 Ga0157375_10826292
280 Ga0157375_11118041
281 Ga0163163_10211003
282 Ga0163163_10440636
283 Ga0157380_10034364
284 Ga0157380_10052016
285 Ga0157379_11194872
286 Ga0197907_10555008
287 Ga0197907_10996635
288 Ga0206356_10684795
289 Ga0206356_10730441
290 Ga0206356_11707736
291 Ga0206349_1134898
292 Ga0206349_1367816
293 Ga0206349_1684506
294 Ga0206349_1891274
295 Ga0206355_1044650
296 Ga0206355_1113497
297 Ga0206355_1296722
298 Ga0206355_1395514
299 Ga0206355_1497963
300 Ga0206351_10083536
301 Ga0206351_10252517
302 Ga0206351_10954085
303 Ga0206352_10104355
304 Ga0206352_10113872
305 Ga0206352_10360346
306 Ga0206352_10974067
307 Ga0206352_11292290
308 Ga0206350_10423351
309 Ga0206350_10644674
310 Ga0206350_10939445
311 Ga0206350_11515168
312 Ga0206350_11593254
313 Ga0206354_10469662
314 Ga0206354_10640377
315 Ga0206354_11558639
316 Ga0206354_11623913
317 Ga0206353_10272107
318 Ga0206353_10695887
319 Ga0206353_11632481
320 Ga0206353_11740099
321 Ga0154015_1224037
322 Ga0154015_1254443
323 Ga0213871_10078578
324 Ga0224712_10058495
325 Ga0224712_10232628
326 Ga0224712_10333290
327 Ga0224712_10354121
328 Ga0224712_10364897
329 Ga0224712_10437829
330 Ga0224712_10460079
331 Ga0207666_1001745
332 Ga0207697_10045484
333 Ga0207692_10221036
334 Ga0207699_10639763
335 Ga0207645_10002579
336 Ga0207645_10096294
337 Ga0207643_10648540
338 Ga0207693_10227249
339 Ga0207663_10554615
340 Ga0207660_11210730
341 Ga0207662_10000946
342 Ga0207650_10345931
343 Ga0207659_10003700
344 Ga0207659_10888860
345 Ga0207700_10225022
346 Ga0207700_10680791
347 Ga0207706_10003825
348 Ga0207706_10100264
349 Ga0207670_10070537
350 Ga0207669_10849706
351 Ga0207689_10117507
352 Ga0207712_10063018
353 Ga0207668_10009465
354 Ga0207658_10113302
355 Ga0207703_10781316
356 Ga0207639_10916931
357 Ga0207675_100263994
358 Ga0265356_1015810
359 Ga0268265_10580712
360 Ga0268264_10235259
361 Ga0265319_1099216
362 Ga0265334_10167898
363 Ga0310981_1009213
364 Ga0265777_115015
365 Ga0265776_111888
366 Ga0265332_10141375
367 Ga0265325_10101242
368 Ga0265325_10128802
369 Ga0265339_10017977
370 Ga0265316_10041826
371 Ga0307414_10684721
372 Ga0373936_0259890
373 Ga0373943_0013783
374 Ga0373947_0087277
375 Ga0373925_0006809
376 Ga0395900_0379886
377 Ga0436365_0808407
378 Ga0436360_0125898
379 Ga0439465_0142634
380 Ga0451837_1071500
381 Ga0450920_117647
382 Ga0450923_116750
383 Ga0453683_0428947
384 Ga0466963_0580306
385 Ga0451576_0151189
386 Ga0466967_0088012
387 Ga0466967_0169727
388 Ga0466967_0925922
389 Ga0466967_1432381
390 Ga0496105_0941418
391 Ga0496112_0220006
392 Ga0501068_0744171
393 Ga0501070_0496253
394 nmdc:mga0n895_27653_c1
395 nmdc:mga0rr50_40393_c1
396 nmdc:mga0a205_470144_c1
397 Ga0587066_081826
398 Ga0587073_0073011
399 Ga0587073_0086425
400 Ga0587080_116871
401 Ga0587082_035890
402 Ga0587082_061440
403 Ga0587083_0064468
404 Ga0587083_0197832
405 Ga0587088_093695
406 Ga0587091_057440
407 Ga0587098_066222
408 Ga0587098_071907
409 Ga0587115_019048
410 Ga0587128_116570
411 Ga0587067_024944
412 Ga0587075_045217
413 Ga0587079_059166
414 Ga0587107_043479
415 Ga0587114_020912
416 Ga0587114_103820
417 2688391895
418 2909048651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

5

162

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9761 2 155
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.975 3 152
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.9684 3 153
7tmv-assembly1.cif.gz_B crystal structure of a putative structural protein from klebsiella pneumoniae 0.9638 2 155
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.9458 1 152
ID Description Score Start End Superfamily
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9684 3 153 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9669 3 156 1.20.1260.10
4eruA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9419 1 153 1.20.1260.10
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9264 3 153 1.20.1260.10
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9143 3 156 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A2T3WAF8-F1-model_v4 Ferritin-like domain-containing protein 0.9982 3 167
AF-A0A7V8VTU4-F1-model_v4 Ferritin-like domain-containing protein 0.995 1 118
AF-A0A7S8IDU9-F1-model_v4 Ferritin-like domain-containing protein 0.9947 1 167
AF-A0A2V9X2A8-F1-model_v4 Ferritin-like domain-containing protein 0.9947 6 169
AF-A0A7R8B7J5-F1-model_v4 deleted 0.9932 1 152

Map