F319038

General Info

Members Datasets Scaffolds Average Seq Length
209 95 418 741

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10021553|Ga0105242_100215533
Length 864
Sequence LSAGLNLEAGLVLSTLAAQRRSGIGLPPQTDCGELPCAQQWSAEERRRAACVSSASRSGAAPVLATFDQTVVGQSSTQWTPRRGIREALRVAELDAQQSAVEVDRSWHLALLAPAERARRNRRTVDAAFLIVASTGTGLAAIVARRAPDVDLEIARALADLFGWAPNLWRACFVLALAYALLIAGDAFLRRRWILARDLAVGVVVVAVVGSLVGRVVDDSWFLSEPHVFSNWGFPELRLACAVSIFAIAGPELVRPARRLSIWLVGAAALTGLPSEVGALVRVVFGSAAGLPPTERVRGALMWLGVDVDGLRVAEHQSIGRAEYYGHTRDGKPIKVRVLGRDAQDTQRLARRWQLLAYRDPLRSAPVDRLAQVEHAAVATLMAAQAGVRVPEVVAVGLGPEDDAILVTRQSEAAPLEASPRDEVTDETLQDLCREVARMHAAGIAHGRLNASNVVLTSDGPMLVDFSAATLGAPLTMLDIDVAELLVACTILVGPERALGTAVDAGWRESIARALPYLQRAALTPHLRDLARAHEVGVDDLRAAAARATGTEAPEVVPLWRIRPKDIVLMAAVVVAAYLLISQLADIGFGTIAGELRDAELAWVVVALVLAQCTFIPSGVSVRGGVATPLPLVPCVVLQSALKFISLTVPSSAGRIATNLRCLQRMGASRSEAIAGGTLDDVSNTVVQVTLFLLVLPFVGVEIETSRFADAGPDRRLLIAIGIAVLVGAVKXRVRVVPGIRGAFLSLWSVARVRRKRIEVFGGSLASELLYAVSLGATCLAYGVHLDLGQVVFVNTAAAVLSGLVPVPGGIGAAEAALSAGLIAMGVDESTAFAVAITQRLCTFYLPPIWGYFSLRWLGQKGYV

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
11 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
60 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
61 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
62 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
63 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
64 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
65 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
68 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
69 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
70 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
71 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
78 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
79 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
80 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
81 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
82 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
83 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
84 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
85 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
88 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
89 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
90 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
91 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
92 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
93 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 18.18
Rhizosphere 81.82
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10021553 3300009176 Bacteria 5061
2 Ga0070690_100036934 3300005330 Unclassified 3075
3 Ga0070666_10047602 3300005335 Unclassified 2879
4 Ga0070668_100018317 3300005347 Bacteria 5256
5 Ga0070668_100023374 3300005347 Bacteria 4675
6 Ga0070668_100035042 3300005347 Bacteria 3825
7 Ga0070659_100028954 3300005366 Bacteria 4279
8 Ga0070711_100012154 3300005439 Bacteria 5372
9 Ga0070700_100007899 3300005441 Bacteria 5773
10 Ga0070662_100005718 3300005457 Bacteria 7965
11 Ga0070698_100108786 3300005471 Bacteria 2739
12 Ga0070686_100038760 3300005544 Bacteria 2964
13 Ga0070702_100012886 3300005615 Bacteria 4210
14 Ga0068864_100033888 3300005618 Bacteria 4342
15 Ga0068861_100000522 3300005719 Bacteria 22465
16 Ga0068861_100006834 3300005719 Bacteria 7790
17 Ga0068862_100051130 3300005844 Bacteria 3534
18 Ga0081455_10007597 3300005937 Bacteria 11395
19 Ga0081455_10020119 3300005937 Bacteria 6297
20 Ga0081455_10020482 3300005937 Bacteria 6224
21 Ga0081538_10001641 3300005981 Bacteria 22957
22 Ga0081538_10003250 3300005981 Bacteria 15441
23 Ga0081538_10004931 3300005981 Bacteria 12155
24 Ga0081538_10009856 3300005981 Bacteria 7901
25 Ga0081540_1002863 3300005983 Bacteria 13952
26 Ga0081540_1006081 3300005983 Bacteria 8874
27 Ga0081539_10002574 3300005985 Bacteria 25042
28 Ga0081539_10003990 3300005985 Bacteria 17035
29 Ga0081539_10024198 3300005985 Bacteria 3949
30 Ga0070715_10013295 3300006163 Bacteria 3019
31 Ga0070712_100006216 3300006175 Bacteria 7389
32 Ga0070712_100042023 3300006175 Unclassified 3142
33 Ga0068871_100049133 3300006358 Bacteria 3408
34 Ga0075428_100000315 3300006844 Bacteria 47699
35 Ga0075431_100007621 3300006847 Bacteria 10777
36 Ga0075433_10019633 3300006852 Bacteria 5636
37 Ga0075434_100026890 3300006871 Bacteria 5643
38 Ga0075429_100003952 3300006880 Bacteria 12673
39 Ga0075436_100022826 3300006914 Bacteria 4299
40 Ga0075435_100010757 3300007076 Bacteria 6702
41 Ga0075435_100013356 3300007076 Bacteria 6106
42 Ga0111539_10003555 3300009094 Bacteria 20558
43 Ga0111539_10007942 3300009094 Bacteria 13530
44 Ga0111539_10036270 3300009094 Bacteria 5964
45 Ga0105245_10025272 3300009098 Bacteria 5222
46 Ga0105245_10028615 3300009098 Bacteria 4918
47 Ga0114129_10008388 3300009147 Bacteria 14717
48 Ga0114129_10146438 3300009147 Bacteria 3235
49 Ga0105243_10034378 3300009148 Bacteria 3924
50 Ga0105243_10043317 3300009148 Bacteria 3527
51 Ga0105241_10033898 3300009174 Bacteria 3835
52 Ga0105249_10002475 3300009553 Bacteria 15997
53 Ga0105249_10002723 3300009553 Bacteria 15279
54 Ga0105249_10004501 3300009553 Bacteria 12048
55 Ga0105249_10026437 3300009553 Bacteria 5229
56 Ga0105249_10066266 3300009553 Bacteria 3324
57 Ga0105239_10087975 3300010375 Bacteria 3424
58 Ga0157374_10058906 3300013296 Bacteria 3589
59 Ga0163162_10028173 3300013306 Bacteria 5556
60 Ga0157375_10042735 3300013308 Bacteria 4389
61 Ga0157380_10046000 3300014326 Bacteria 3426
62 Ga0157376_10013661 3300014969 Bacteria 6068
63 Ga0163161_10007259 3300017792 Bacteria 7654
64 Ga0163161_10021743 3300017792 Bacteria 4510
65 Ga0207688_10015836 3300025901 Bacteria 4090
66 Ga0207671_10019055 3300025914 Bacteria 5257
67 Ga0207693_10001781 3300025915 Bacteria 18893
68 Ga0207693_10004356 3300025915 Bacteria 11973
69 Ga0207693_10010978 3300025915 Bacteria 7341
70 Ga0207687_10009355 3300025927 Bacteria 6408
71 Ga0207687_10013101 3300025927 Bacteria 5421
72 Ga0207690_10011307 3300025932 Bacteria 5334
73 Ga0207706_10007036 3300025933 Bacteria 10402
74 Ga0207706_10010257 3300025933 Bacteria 8568
75 Ga0207670_10015321 3300025936 Bacteria 4579
76 Ga0207665_10001306 3300025939 Bacteria 16793
77 Ga0207689_10013375 3300025942 Bacteria 7004
78 Ga0207689_10014846 3300025942 Bacteria 6612
79 Ga0207712_10060216 3300025961 Unclassified 2691
80 Ga0207639_10046508 3300026041 Unclassified 3275
81 Ga0207678_10003838 3300026067 Bacteria 13517
82 Ga0207708_10015546 3300026075 Bacteria 5707
83 Ga0207676_10009472 3300026095 Bacteria 6934
84 Ga0207676_10058479 3300026095 Unclassified 3041
85 Ga0207675_100001195 3300026118 Bacteria 25880
86 Ga0207675_100012477 3300026118 Bacteria 7937
87 Ga0207675_100012784 3300026118 Bacteria 7841
88 Ga0207675_100017548 3300026118 Bacteria 6679
89 Ga0207683_10008356 3300026121 Bacteria 8853
90 Ga0207683_10066696 3300026121 Unclassified 3174
91 Ga0265327_10010904 3300031251 Bacteria 6326
92 Ga0373952_0000493 3300035092 Bacteria 6853
93 Ga0373941_0005681 3300035115 Bacteria 2953
94 Ga0373960_0003225 3300035121 Unclassified 3691
95 Ga0373962_0002930 3300035242 Bacteria 4092
96 Ga0373931_0007772 3300035691 Bacteria 5064
97 Ga0373931_0017798 3300035691 Unclassified 3521
98 Ga0395899_0002456 3300037312 Bacteria 15048
99 Ga0395899_0005438 3300037312 Bacteria 9880
100 Ga0395899_0008764 3300037312 Bacteria 7784
101 Ga0395899_0010598 3300037312 Bacteria 7064
102 Ga0395899_0012091 3300037312 Bacteria 6612
103 Ga0395899_0012921 3300037312 Bacteria 6390
104 Ga0395899_0024880 3300037312 Bacteria 4522
105 Ga0395899_0029812 3300037312 Bacteria 4104
106 Ga0395899_0057525 3300037312 Bacteria 2870
107 Ga0395900_0004723 3300037418 Bacteria 14368
108 Ga0395900_0004915 3300037418 Bacteria 14072
109 Ga0395900_0005534 3300037418 Bacteria 13224
110 Ga0395900_0008268 3300037418 Bacteria 10715
111 Ga0395900_0012896 3300037418 Bacteria 8537
112 Ga0395900_0014063 3300037418 Bacteria 8172
113 Ga0395900_0018832 3300037418 Bacteria 7041
114 Ga0395900_0022116 3300037418 Bacteria 6505
115 Ga0395900_0040522 3300037418 Bacteria 4800
116 Ga0395900_0041466 3300037418 Bacteria 4745
117 Ga0395898_0001743 3300037466 Bacteria 28706
118 Ga0395898_0002041 3300037466 Bacteria 25284
119 Ga0395898_0005797 3300037466 Bacteria 13283
120 Ga0395898_0008766 3300037466 Bacteria 10660
121 Ga0395898_0011017 3300037466 Bacteria 9422
122 Ga0395898_0015488 3300037466 Bacteria 7821
123 Ga0395898_0015972 3300037466 Bacteria 7692
124 Ga0395898_0016604 3300037466 Bacteria 7525
125 Ga0395898_0025334 3300037466 Bacteria 5979
126 Ga0395898_0037613 3300037466 Unclassified 4799
127 Ga0395898_0043427 3300037466 Bacteria 4429
128 Ga0395898_0044352 3300037466 Bacteria 4378
129 Ga0395898_0045779 3300037466 Bacteria 4299
130 Ga0395898_0072579 3300037466 Bacteria 3325
131 Ga0395898_0075809 3300037466 Bacteria 3248
132 Ga0395905_0003748 3300037471 Bacteria 16103
133 Ga0395905_0004371 3300037471 Bacteria 14712
134 Ga0395905_0004683 3300037471 Bacteria 14143
135 Ga0395905_0005558 3300037471 Bacteria 12851
136 Ga0395905_0007193 3300037471 Bacteria 11111
137 Ga0395905_0007565 3300037471 Bacteria 10794
138 Ga0395905_0007981 3300037471 Bacteria 10466
139 Ga0395905_0008908 3300037471 Bacteria 9856
140 Ga0395905_0016848 3300037471 Bacteria 6944
141 Ga0395905_0026252 3300037471 Bacteria 5492
142 Ga0395905_0027257 3300037471 Bacteria 5388
143 Ga0395905_0063556 3300037471 Bacteria 3453
144 Ga0395905_0104842 3300037471 Unclassified 2654
145 Ga0395901_0001186 3300038443 Bacteria 27723
146 Ga0395901_0001961 3300038443 Bacteria 21160
147 Ga0395901_0004416 3300038443 Bacteria 14183
148 Ga0395901_0010217 3300038443 Bacteria 9507
149 Ga0395901_0011346 3300038443 Bacteria 9029
150 Ga0395901_0012235 3300038443 Bacteria 8709
151 Ga0395901_0014334 3300038443 Bacteria 8072
152 Ga0395901_0014392 3300038443 Bacteria 8052
153 Ga0395901_0026252 3300038443 Bacteria 5980
154 Ga0395901_0029000 3300038443 Bacteria 5693
155 Ga0395901_0048892 3300038443 Unclassified 4392
156 Ga0395901_0051020 3300038443 Bacteria 4299
157 Ga0395901_0053336 3300038443 Bacteria 4201
158 Ga0495645_0019550 3300046543 Bacteria 4876
159 Ga0496100_0035264 3300048903 Unclassified 3145
160 Ga0496101_0011546 3300048904 Bacteria 5865
161 Ga0496102_0006271 3300048905 Bacteria 10136
162 Ga0496102_0011568 3300048905 Bacteria 7613
163 Ga0496102_0029773 3300048905 Bacteria 4885
164 Ga0496102_0068167 3300048905 Bacteria 3264
165 Ga0496103_0010907 3300048906 Bacteria 5378
166 Ga0496104_0004593 3300048907 Bacteria 12036
167 Ga0496104_0018374 3300048907 Bacteria 6380
168 Ga0496104_0020844 3300048907 Bacteria 6011
169 Ga0496104_0024015 3300048907 Bacteria 5609
170 Ga0496105_0003501 3300048908 Bacteria 11630
171 Ga0496105_0015139 3300048908 Bacteria 6138
172 Ga0496105_0026941 3300048908 Bacteria 4691
173 Ga0496106_0002715 3300048909 Bacteria 13110
174 Ga0496106_0033585 3300048909 Bacteria 3828
175 Ga0496106_0074797 3300048909 Bacteria 2593
176 Ga0496108_0008042 3300048911 Bacteria 8558
177 Ga0496108_0013229 3300048911 Bacteria 6725
178 Ga0496108_0015185 3300048911 Bacteria 6282
179 Ga0496109_0001232 3300048912 Bacteria 21266
180 Ga0496109_0002085 3300048912 Bacteria 16614
181 Ga0496109_0005280 3300048912 Bacteria 10793
182 Ga0496110_0003263 3300048913 Bacteria 12368
183 Ga0496110_0037900 3300048913 Bacteria 4192
184 Ga0496110_0038263 3300048913 Bacteria 4173
185 Ga0496110_0042232 3300048913 Unclassified 3980
186 Ga0496111_0000861 3300048914 Bacteria 16447
187 Ga0496112_0004564 3300048915 Bacteria 11768
188 Ga0496112_0018945 3300048915 Bacteria 6487
189 Ga0496112_0073741 3300048915 Bacteria 3374
190 Ga0496113_0012874 3300048916 Bacteria 5641
191 Ga0496113_0027192 3300048916 Bacteria 4098
192 Ga0496113_0042647 3300048916 Bacteria 3353
193 Ga0496114_0015472 3300048917 Bacteria 6134
194 Ga0496115_0002464 3300048918 Bacteria 13299
195 Ga0496115_0012301 3300048918 Bacteria 6436
196 Ga0496115_0062461 3300048918 Bacteria 3005
197 Ga0501040_0034601 3300049576 Bacteria 3422
198 Ga0501067_0015390 3300049583 Bacteria 4235
199 Ga0501067_0017141 3300049583 Bacteria 4003
200 Ga0501076_0087411 3300049592 Unclassified 2506
201 nmdc:mga05p37_161373_c1 3300050507 Unclassified 2738
202 nmdc:mga05p37_5585_c1 3300050507 Bacteria 14788
203 nmdc:mga09592_13390_c1 3300050508 Bacteria 6696
204 nmdc:mga0n895_16088_c1 3300050512 Bacteria 6855
205 nmdc:mga0rr50_10773_c1 3300050513 Bacteria 5826
206 nmdc:mga08x19_14349_c1 3300050514 Bacteria 4805
207 nmdc:mga0a205_64601_c1 3300050515 Bacteria 3535
208 Ga0495601_0022726 3300053077 Bacteria 3853
209 Ga0501084_0053263 3300054114 Bacteria 3384
210 Ga0105242_10021553
211 Ga0070690_100036934
212 Ga0070666_10047602
213 Ga0070668_100018317
214 Ga0070668_100023374
215 Ga0070668_100035042
216 Ga0070659_100028954
217 Ga0070711_100012154
218 Ga0070700_100007899
219 Ga0070662_100005718
220 Ga0070698_100108786
221 Ga0070686_100038760
222 Ga0070702_100012886
223 Ga0068864_100033888
224 Ga0068861_100000522
225 Ga0068861_100006834
226 Ga0068862_100051130
227 Ga0081455_10007597
228 Ga0081455_10020119
229 Ga0081455_10020482
230 Ga0081538_10001641
231 Ga0081538_10003250
232 Ga0081538_10004931
233 Ga0081538_10009856
234 Ga0081540_1002863
235 Ga0081540_1006081
236 Ga0081539_10002574
237 Ga0081539_10003990
238 Ga0081539_10024198
239 Ga0070715_10013295
240 Ga0070712_100006216
241 Ga0070712_100042023
242 Ga0068871_100049133
243 Ga0075428_100000315
244 Ga0075431_100007621
245 Ga0075433_10019633
246 Ga0075434_100026890
247 Ga0075429_100003952
248 Ga0075436_100022826
249 Ga0075435_100010757
250 Ga0075435_100013356
251 Ga0111539_10003555
252 Ga0111539_10007942
253 Ga0111539_10036270
254 Ga0105245_10025272
255 Ga0105245_10028615
256 Ga0114129_10008388
257 Ga0114129_10146438
258 Ga0105243_10034378
259 Ga0105243_10043317
260 Ga0105241_10033898
261 Ga0105249_10002475
262 Ga0105249_10002723
263 Ga0105249_10004501
264 Ga0105249_10026437
265 Ga0105249_10066266
266 Ga0105239_10087975
267 Ga0157374_10058906
268 Ga0163162_10028173
269 Ga0157375_10042735
270 Ga0157380_10046000
271 Ga0157376_10013661
272 Ga0163161_10007259
273 Ga0163161_10021743
274 Ga0207688_10015836
275 Ga0207671_10019055
276 Ga0207693_10001781
277 Ga0207693_10004356
278 Ga0207693_10010978
279 Ga0207687_10009355
280 Ga0207687_10013101
281 Ga0207690_10011307
282 Ga0207706_10007036
283 Ga0207706_10010257
284 Ga0207670_10015321
285 Ga0207665_10001306
286 Ga0207689_10013375
287 Ga0207689_10014846
288 Ga0207712_10060216
289 Ga0207639_10046508
290 Ga0207678_10003838
291 Ga0207708_10015546
292 Ga0207676_10009472
293 Ga0207676_10058479
294 Ga0207675_100001195
295 Ga0207675_100012477
296 Ga0207675_100012784
297 Ga0207675_100017548
298 Ga0207683_10008356
299 Ga0207683_10066696
300 Ga0265327_10010904
301 Ga0373952_0000493
302 Ga0373941_0005681
303 Ga0373960_0003225
304 Ga0373962_0002930
305 Ga0373931_0007772
306 Ga0373931_0017798
307 Ga0395899_0002456
308 Ga0395899_0005438
309 Ga0395899_0008764
310 Ga0395899_0010598
311 Ga0395899_0012091
312 Ga0395899_0012921
313 Ga0395899_0024880
314 Ga0395899_0029812
315 Ga0395899_0057525
316 Ga0395900_0004723
317 Ga0395900_0004915
318 Ga0395900_0005534
319 Ga0395900_0008268
320 Ga0395900_0012896
321 Ga0395900_0014063
322 Ga0395900_0018832
323 Ga0395900_0022116
324 Ga0395900_0040522
325 Ga0395900_0041466
326 Ga0395898_0001743
327 Ga0395898_0002041
328 Ga0395898_0005797
329 Ga0395898_0008766
330 Ga0395898_0011017
331 Ga0395898_0015488
332 Ga0395898_0015972
333 Ga0395898_0016604
334 Ga0395898_0025334
335 Ga0395898_0037613
336 Ga0395898_0043427
337 Ga0395898_0044352
338 Ga0395898_0045779
339 Ga0395898_0072579
340 Ga0395898_0075809
341 Ga0395905_0003748
342 Ga0395905_0004371
343 Ga0395905_0004683
344 Ga0395905_0005558
345 Ga0395905_0007193
346 Ga0395905_0007565
347 Ga0395905_0007981
348 Ga0395905_0008908
349 Ga0395905_0016848
350 Ga0395905_0026252
351 Ga0395905_0027257
352 Ga0395905_0063556
353 Ga0395905_0104842
354 Ga0395901_0001186
355 Ga0395901_0001961
356 Ga0395901_0004416
357 Ga0395901_0010217
358 Ga0395901_0011346
359 Ga0395901_0012235
360 Ga0395901_0014334
361 Ga0395901_0014392
362 Ga0395901_0026252
363 Ga0395901_0029000
364 Ga0395901_0048892
365 Ga0395901_0051020
366 Ga0395901_0053336
367 Ga0495645_0019550
368 Ga0496100_0035264
369 Ga0496101_0011546
370 Ga0496102_0006271
371 Ga0496102_0011568
372 Ga0496102_0029773
373 Ga0496102_0068167
374 Ga0496103_0010907
375 Ga0496104_0004593
376 Ga0496104_0018374
377 Ga0496104_0020844
378 Ga0496104_0024015
379 Ga0496105_0003501
380 Ga0496105_0015139
381 Ga0496105_0026941
382 Ga0496106_0002715
383 Ga0496106_0033585
384 Ga0496106_0074797
385 Ga0496108_0008042
386 Ga0496108_0013229
387 Ga0496108_0015185
388 Ga0496109_0001232
389 Ga0496109_0002085
390 Ga0496109_0005280
391 Ga0496110_0003263
392 Ga0496110_0037900
393 Ga0496110_0038263
394 Ga0496110_0042232
395 Ga0496111_0000861
396 Ga0496112_0004564
397 Ga0496112_0018945
398 Ga0496112_0073741
399 Ga0496113_0012874
400 Ga0496113_0027192
401 Ga0496113_0042647
402 Ga0496114_0015472
403 Ga0496115_0002464
404 Ga0496115_0012301
405 Ga0496115_0062461
406 Ga0501040_0034601
407 Ga0501067_0015390
408 Ga0501067_0017141
409 Ga0501076_0087411
410 nmdc:mga05p37_161373_c1
411 nmdc:mga05p37_5585_c1
412 nmdc:mga09592_13390_c1
413 nmdc:mga0n895_16088_c1
414 nmdc:mga0rr50_10773_c1
415 nmdc:mga08x19_14349_c1
416 nmdc:mga0a205_64601_c1
417 Ga0495601_0022726
418 Ga0501084_0053263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03706

LPG_synthase_TM

Lysylphosphatidylglycerol synthase TM region

568

851

0.82

PF06293

Kdo

Lipopolysaccharide kinase (Kdo/WaaP) family

351

476

0.8

PF01163

RIO1

RIO1 family

347

486

0.78

Map