F318890
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 209 | 111 | 209 | 57 |
Family's Representative Sequence
| Representative Sequence | 3300005841|Ga0068863_101252774|Ga0068863_1012527742 |
| Length | 61 |
| Sequence | MTTSNELGGAPESFNESSLDDPFLAAAPLDEDAGPLSLFQEINERRARVENAELLAHLRGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 21 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 30 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 79 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 80 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 81 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 82 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 83 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 84 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 85 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 86 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 87 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 97 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 98 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 99 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 101 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 102 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 103 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 104 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 109 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 110 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 111 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.91 |
| Nodule | 0 |
| Rhizoplane | 5.74 |
| Rhizosphere | 91.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.96 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10035779 | 3300005327 | Bacteria | 4000 |
| 2 | Ga0070658_10054293 | 3300005327 | Bacteria | 3253 |
| 3 | Ga0070658_10308308 | 3300005327 | Bacteria | 1350 |
| 4 | Ga0070658_11976428 | 3300005327 | Bacteria | 503 |
| 5 | Ga0070670_100414002 | 3300005331 | Bacteria | 1191 |
| 6 | Ga0070666_10480382 | 3300005335 | Bacteria | 900 |
| 7 | Ga0070680_100054654 | 3300005336 | Bacteria | 3261 |
| 8 | Ga0070680_100148972 | 3300005336 | Bacteria | 1964 |
| 9 | Ga0070680_101029510 | 3300005336 | Bacteria | 711 |
| 10 | Ga0070680_101738800 | 3300005336 | Bacteria | 540 |
| 11 | Ga0070682_100273762 | 3300005337 | Bacteria | 1227 |
| 12 | Ga0070660_100023042 | 3300005339 | Bacteria | 4610 |
| 13 | Ga0070660_100124822 | 3300005339 | Bacteria | 2056 |
| 14 | Ga0070660_100245060 | 3300005339 | Bacteria | 1460 |
| 15 | Ga0070661_101781864 | 3300005344 | Unclassified | 522 |
| 16 | Ga0070671_100009979 | 3300005355 | Bacteria | 7625 |
| 17 | Ga0070671_100148301 | 3300005355 | Bacteria | 1980 |
| 18 | Ga0070671_100448017 | 3300005355 | Bacteria | 1107 |
| 19 | Ga0070671_101061143 | 3300005355 | Bacteria | 711 |
| 20 | Ga0070673_100086441 | 3300005364 | Bacteria | 2555 |
| 21 | Ga0070659_100003250 | 3300005366 | Bacteria | 11567 |
| 22 | Ga0070659_100065204 | 3300005366 | Bacteria | 2884 |
| 23 | Ga0070708_101763075 | 3300005445 | Bacteria | 575 |
| 24 | Ga0070663_100542555 | 3300005455 | Bacteria | 971 |
| 25 | Ga0070662_100102620 | 3300005457 | Bacteria | 2167 |
| 26 | Ga0070681_10016688 | 3300005458 | Bacteria | 7331 |
| 27 | Ga0070681_10053309 | 3300005458 | Bacteria | 4030 |
| 28 | Ga0070681_10593414 | 3300005458 | Bacteria | 1022 |
| 29 | Ga0070679_100057002 | 3300005530 | Bacteria | 3893 |
| 30 | Ga0070679_101765782 | 3300005530 | Bacteria | 567 |
| 31 | Ga0068853_100006770 | 3300005539 | Bacteria | 9132 |
| 32 | Ga0068853_101474713 | 3300005539 | Bacteria | 658 |
| 33 | Ga0068853_101890602 | 3300005539 | Bacteria | 579 |
| 34 | Ga0070665_100001582 | 3300005548 | Bacteria | 26236 |
| 35 | Ga0070665_100039395 | 3300005548 | Bacteria | 4752 |
| 36 | Ga0068855_100056393 | 3300005563 | Bacteria | 4610 |
| 37 | Ga0068855_100213978 | 3300005563 | Bacteria | 2164 |
| 38 | Ga0068855_100251795 | 3300005563 | Bacteria | 1970 |
| 39 | Ga0068855_100657895 | 3300005563 | Bacteria | 1124 |
| 40 | Ga0070664_101541779 | 3300005564 | Bacteria | 629 |
| 41 | Ga0068857_101210299 | 3300005577 | Bacteria | 731 |
| 42 | Ga0068854_101777373 | 3300005578 | Bacteria | 565 |
| 43 | Ga0068856_100270305 | 3300005614 | Bacteria | 1716 |
| 44 | Ga0068856_100723141 | 3300005614 | Bacteria | 1016 |
| 45 | Ga0068852_100053465 | 3300005616 | Bacteria | 3476 |
| 46 | Ga0068852_100771749 | 3300005616 | Bacteria | 974 |
| 47 | Ga0068852_101392861 | 3300005616 | Bacteria | 723 |
| 48 | Ga0068852_101544629 | 3300005616 | Bacteria | 686 |
| 49 | Ga0068864_100017687 | 3300005618 | Bacteria | 5945 |
| 50 | Ga0068864_100165929 | 3300005618 | Bacteria | 2010 |
| 51 | Ga0068864_101422161 | 3300005618 | Bacteria | 695 |
| 52 | Ga0068863_100064877 | 3300005841 | Bacteria | 3454 |
| 53 | Ga0068863_101252774 | 3300005841 | Bacteria | 748 |
| 54 | Ga0068863_102269457 | 3300005841 | Bacteria | 552 |
| 55 | Ga0070717_10079677 | 3300006028 | Bacteria | 2747 |
| 56 | Ga0070717_10204700 | 3300006028 | Bacteria | 1730 |
| 57 | Ga0070716_100574201 | 3300006173 | Bacteria | 844 |
| 58 | Ga0097621_101797615 | 3300006237 | Unclassified | 584 |
| 59 | Ga0068871_101188466 | 3300006358 | Bacteria | 715 |
| 60 | Ga0068871_101211113 | 3300006358 | Bacteria | 708 |
| 61 | Ga0105250_10361899 | 3300009092 | Bacteria | 637 |
| 62 | Ga0105240_10262015 | 3300009093 | Bacteria | 1994 |
| 63 | Ga0105240_10272781 | 3300009093 | Bacteria | 1946 |
| 64 | Ga0105240_10323295 | 3300009093 | Bacteria | 1758 |
| 65 | Ga0105240_10725090 | 3300009093 | Bacteria | 1083 |
| 66 | Ga0105240_10781980 | 3300009093 | Bacteria | 1035 |
| 67 | Ga0105240_11102764 | 3300009093 | Bacteria | 844 |
| 68 | Ga0105245_11622858 | 3300009098 | Bacteria | 698 |
| 69 | Ga0105242_10237519 | 3300009176 | Bacteria | 1637 |
| 70 | Ga0105248_10000335 | 3300009177 | Bacteria | 55396 |
| 71 | Ga0105248_10095136 | 3300009177 | Bacteria | 3354 |
| 72 | Ga0105248_12771369 | 3300009177 | Bacteria | 559 |
| 73 | Ga0105237_10460791 | 3300009545 | Bacteria | 1277 |
| 74 | Ga0105238_10187945 | 3300009551 | Bacteria | 2042 |
| 75 | Ga0105238_10435738 | 3300009551 | Bacteria | 1307 |
| 76 | Ga0105238_10919924 | 3300009551 | Bacteria | 893 |
| 77 | Ga0105238_11109850 | 3300009551 | Bacteria | 814 |
| 78 | Ga0105238_11325015 | 3300009551 | Bacteria | 746 |
| 79 | Ga0105249_11324071 | 3300009553 | Bacteria | 792 |
| 80 | Ga0105239_10107197 | 3300010375 | Bacteria | 3095 |
| 81 | Ga0105239_10215104 | 3300010375 | Bacteria | 2155 |
| 82 | Ga0105239_10801844 | 3300010375 | Bacteria | 1079 |
| 83 | Ga0157370_10054656 | 3300013104 | Bacteria | 3806 |
| 84 | Ga0157370_10549742 | 3300013104 | Bacteria | 1058 |
| 85 | Ga0157370_10564557 | 3300013104 | Bacteria | 1043 |
| 86 | Ga0157369_12037177 | 3300013105 | Bacteria | 582 |
| 87 | Ga0163162_10150701 | 3300013306 | Bacteria | 2443 |
| 88 | Ga0163162_11041217 | 3300013306 | Bacteria | 926 |
| 89 | Ga0163162_11176632 | 3300013306 | Bacteria | 870 |
| 90 | Ga0163162_11213460 | 3300013306 | Bacteria | 856 |
| 91 | Ga0157372_10183069 | 3300013307 | Bacteria | 2425 |
| 92 | Ga0157372_10741457 | 3300013307 | Bacteria | 1142 |
| 93 | Ga0157375_10154116 | 3300013308 | Bacteria | 2435 |
| 94 | Ga0163163_10031475 | 3300014325 | Bacteria | 5120 |
| 95 | Ga0163163_10485188 | 3300014325 | Bacteria | 1297 |
| 96 | Ga0163163_11592189 | 3300014325 | Bacteria | 714 |
| 97 | Ga0182008_10689321 | 3300014497 | Bacteria | 582 |
| 98 | Ga0157379_11129365 | 3300014968 | Bacteria | 751 |
| 99 | Ga0157379_12253777 | 3300014968 | Unclassified | 542 |
| 100 | Ga0157376_10506848 | 3300014969 | Bacteria | 1187 |
| 101 | Ga0157376_11572559 | 3300014969 | Bacteria | 691 |
| 102 | Ga0163161_10156139 | 3300017792 | Bacteria | 1737 |
| 103 | Ga0207680_11184114 | 3300025903 | Bacteria | 545 |
| 104 | Ga0207705_10008215 | 3300025909 | Bacteria | 7635 |
| 105 | Ga0207705_10138339 | 3300025909 | Bacteria | 1817 |
| 106 | Ga0207707_10059865 | 3300025912 | Bacteria | 3314 |
| 107 | Ga0207707_10159225 | 3300025912 | Bacteria | 1974 |
| 108 | Ga0207695_10002836 | 3300025913 | Bacteria | 25176 |
| 109 | Ga0207695_10080947 | 3300025913 | Bacteria | 3288 |
| 110 | Ga0207695_10103364 | 3300025913 | Bacteria | 2840 |
| 111 | Ga0207695_10228286 | 3300025913 | Bacteria | 1767 |
| 112 | Ga0207695_10312582 | 3300025913 | Bacteria | 1461 |
| 113 | Ga0207695_11183437 | 3300025913 | Bacteria | 644 |
| 114 | Ga0207695_11194635 | 3300025913 | Bacteria | 641 |
| 115 | Ga0207671_10747836 | 3300025914 | Bacteria | 777 |
| 116 | Ga0207660_10000845 | 3300025917 | Bacteria | 20177 |
| 117 | Ga0207660_10113888 | 3300025917 | Bacteria | 2039 |
| 118 | Ga0207660_11106192 | 3300025917 | Bacteria | 646 |
| 119 | Ga0207657_10005562 | 3300025919 | Bacteria | 13157 |
| 120 | Ga0207657_10091138 | 3300025919 | Bacteria | 2543 |
| 121 | Ga0207657_10566686 | 3300025919 | Bacteria | 887 |
| 122 | Ga0207657_11521618 | 3300025919 | Bacteria | 500 |
| 123 | Ga0207652_10019362 | 3300025921 | Bacteria | 5597 |
| 124 | Ga0207694_10220435 | 3300025924 | Bacteria | 1547 |
| 125 | Ga0207694_10303862 | 3300025924 | Bacteria | 1314 |
| 126 | Ga0207694_10755349 | 3300025924 | Bacteria | 821 |
| 127 | Ga0207694_10764643 | 3300025924 | Bacteria | 816 |
| 128 | Ga0207694_11040479 | 3300025924 | Bacteria | 693 |
| 129 | Ga0207650_10265046 | 3300025925 | Bacteria | 1395 |
| 130 | Ga0207644_10111019 | 3300025931 | Bacteria | 2073 |
| 131 | Ga0207644_10128752 | 3300025931 | Bacteria | 1935 |
| 132 | Ga0207690_10000602 | 3300025932 | Bacteria | 23326 |
| 133 | Ga0207690_10088079 | 3300025932 | Bacteria | 2186 |
| 134 | Ga0207706_10042714 | 3300025933 | Bacteria | 4018 |
| 135 | Ga0207686_10887308 | 3300025934 | Bacteria | 719 |
| 136 | Ga0207665_10672472 | 3300025939 | Bacteria | 813 |
| 137 | Ga0207711_10001498 | 3300025941 | Bacteria | 21755 |
| 138 | Ga0207711_10069457 | 3300025941 | Bacteria | 3054 |
| 139 | Ga0207689_10794180 | 3300025942 | Bacteria | 799 |
| 140 | Ga0207679_12168681 | 3300025945 | Bacteria | 504 |
| 141 | Ga0207667_10018155 | 3300025949 | Bacteria | 7897 |
| 142 | Ga0207667_10175391 | 3300025949 | Bacteria | 2203 |
| 143 | Ga0207667_10269485 | 3300025949 | Bacteria | 1741 |
| 144 | Ga0207667_10430122 | 3300025949 | Bacteria | 1343 |
| 145 | Ga0207712_10311463 | 3300025961 | Bacteria | 1295 |
| 146 | Ga0207677_10081017 | 3300026023 | Bacteria | 2328 |
| 147 | Ga0207677_11890447 | 3300026023 | Bacteria | 555 |
| 148 | Ga0207703_10280550 | 3300026035 | Bacteria | 1513 |
| 149 | Ga0207639_10056178 | 3300026041 | Bacteria | 3016 |
| 150 | Ga0207639_10121178 | 3300026041 | Bacteria | 2149 |
| 151 | Ga0207639_11125297 | 3300026041 | Bacteria | 737 |
| 152 | Ga0207639_11582142 | 3300026041 | Bacteria | 615 |
| 153 | Ga0207702_10487196 | 3300026078 | Bacteria | 1201 |
| 154 | Ga0207702_11782171 | 3300026078 | Bacteria | 608 |
| 155 | Ga0207702_12208501 | 3300026078 | Bacteria | 539 |
| 156 | Ga0207641_10153572 | 3300026088 | Bacteria | 2087 |
| 157 | Ga0207641_10437519 | 3300026088 | Bacteria | 1262 |
| 158 | Ga0207676_10085722 | 3300026095 | Bacteria | 2571 |
| 159 | Ga0207676_11039744 | 3300026095 | Bacteria | 808 |
| 160 | Ga0207676_11152344 | 3300026095 | Bacteria | 767 |
| 161 | Ga0207674_10474609 | 3300026116 | Bacteria | 1209 |
| 162 | Ga0207674_11017323 | 3300026116 | Bacteria | 798 |
| 163 | Ga0207698_11274248 | 3300026142 | Bacteria | 750 |
| 164 | Ga0268266_10000064 | 3300028379 | Bacteria | 249533 |
| 165 | Ga0307517_10106828 | 3300028786 | Bacteria | 2162 |
| 166 | Ga0265327_10034967 | 3300031251 | Bacteria | 2783 |
| 167 | Ga0307513_10001560 | 3300031456 | Bacteria | 32859 |
| 168 | Ga0373927_0651537 | 3300035695 | Bacteria | 696 |
| 169 | Ga0373947_0097087 | 3300035725 | Bacteria | 1846 |
| 170 | Ga0373937_0574184 | 3300036401 | Bacteria | 1071 |
| 171 | Ga0373925_0873123 | 3300037068 | Bacteria | 741 |
| 172 | Ga0395899_0124158 | 3300037312 | Bacteria | 1847 |
| 173 | Ga0466957_0223163 | 3300044842 | Bacteria | 1245 |
| 174 | Ga0466957_0723309 | 3300044842 | Bacteria | 704 |
| 175 | Ga0495583_0045030 | 3300046506 | Bacteria | 2043 |
| 176 | Ga0495642_0032340 | 3300046528 | Bacteria | 2099 |
| 177 | Ga0495642_0083714 | 3300046528 | Unclassified | 1345 |
| 178 | Ga0495642_0324974 | 3300046528 | Unclassified | 675 |
| 179 | Ga0495645_0065049 | 3300046543 | Bacteria | 2638 |
| 180 | Ga0495611_0376726 | 3300046648 | Bacteria | 650 |
| 181 | Ga0495625_0040987 | 3300046660 | Bacteria | 3372 |
| 182 | Ga0495625_0421650 | 3300046660 | Bacteria | 830 |
| 183 | Ga0495669_0187699 | 3300046684 | Unclassified | 986 |
| 184 | Ga0495669_0521220 | 3300046684 | Bacteria | 578 |
| 185 | Ga0495672_0006993 | 3300047320 | Bacteria | 8575 |
| 186 | Ga0495672_0380120 | 3300047320 | Bacteria | 650 |
| 187 | Ga0495677_0309286 | 3300047445 | Bacteria | 622 |
| 188 | Ga0495677_0340223 | 3300047445 | Unclassified | 592 |
| 189 | Ga0495685_231172 | 3300047447 | Bacteria | 589 |
| 190 | Ga0496100_0474320 | 3300048903 | Bacteria | 962 |
| 191 | Ga0496102_0090741 | 3300048905 | Bacteria | 2828 |
| 192 | Ga0496107_0946452 | 3300048910 | Bacteria | 627 |
| 193 | Ga0496108_0138777 | 3300048911 | Bacteria | 2094 |
| 194 | Ga0496109_0062979 | 3300048912 | Bacteria | 3392 |
| 195 | Ga0496109_0187442 | 3300048912 | Bacteria | 1944 |
| 196 | Ga0496112_0173857 | 3300048915 | Bacteria | 2119 |
| 197 | Ga0496112_0662199 | 3300048915 | Bacteria | 973 |
| 198 | Ga0496112_1050487 | 3300048915 | Bacteria | 733 |
| 199 | Ga0496113_0363102 | 3300048916 | Bacteria | 1162 |
| 200 | Ga0496115_0001515 | 3300048918 | Bacteria | 16693 |
| 201 | Ga0496115_0741604 | 3300048918 | Bacteria | 769 |
| 202 | Ga0501047_1158711 | 3300049581 | Bacteria | 586 |
| 203 | Ga0501048_0035692 | 3300049582 | Bacteria | 3578 |
| 204 | Ga0501073_0911243 | 3300049589 | Unclassified | 605 |
| 205 | Ga0495601_0542471 | 3300053077 | Bacteria | 749 |
| 206 | Ga0500641_0003330 | 3300053096 | Bacteria | 5689 |
| 207 | Ga0500562_001329 | 3300053108 | Bacteria | 6091 |
| 208 | Ga0500594_0277862 | 3300053118 | Unclassified | 560 |
| 209 | Ga0500595_034243 | 3300053119 | Bacteria | 1681 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10034967 | Ga0265327_100349672 | 51 |
| 2 | 3300035695 | Ga0373927_0651537 | Ga0373927_0651537_174_368 | 51 |
| 3 | 3300035725 | Ga0373947_0097087 | Ga0373947_0097087_686_880 | 51 |
| 4 | 3300037068 | Ga0373925_0873123 | Ga0373925_0873123_188_382 | 51 |
| 5 | 3300037312 | Ga0395899_0124158 | Ga0395899_0124158_1128_1283 | 51 |
| 6 | 3300005564 | Ga0070664_101541779 | Ga0070664_1015417791 | 53 |
| 7 | 3300005578 | Ga0068854_101777373 | Ga0068854_1017773731 | 53 |
| 8 | 3300005616 | Ga0068852_101544629 | Ga0068852_1015446291 | 53 |
| 9 | 3300006028 | Ga0070717_10204700 | Ga0070717_102047002 | 53 |
| 10 | 3300009093 | Ga0105240_11102764 | Ga0105240_111027641 | 53 |
| 11 | 3300009177 | Ga0105248_10000335 | Ga0105248_1000033531 | 53 |
| 12 | 3300009545 | Ga0105237_10460791 | Ga0105237_104607912 | 53 |
| 13 | 3300009551 | Ga0105238_10435738 | Ga0105238_104357382 | 53 |
| 14 | 3300010375 | Ga0105239_10215104 | Ga0105239_102151041 | 53 |
| 15 | 3300013307 | Ga0157372_10183069 | Ga0157372_101830693 | 53 |
| 16 | 3300014325 | Ga0163163_10031475 | Ga0163163_100314753 | 53 |
| 17 | 3300014497 | Ga0182008_10689321 | Ga0182008_106893211 | 53 |
| 18 | 3300025913 | Ga0207695_11183437 | Ga0207695_111834371 | 53 |
| 19 | 3300025914 | Ga0207671_10747836 | Ga0207671_107478362 | 53 |
| 20 | 3300025924 | Ga0207694_10303862 | Ga0207694_103038622 | 53 |
| 21 | 3300025941 | Ga0207711_10001498 | Ga0207711_1000149813 | 53 |
| 22 | 3300025945 | Ga0207679_12168681 | Ga0207679_121686811 | 53 |
| 23 | 3300026142 | Ga0207698_11274248 | Ga0207698_112742482 | 53 |
| 24 | 3300044842 | Ga0466957_0723309 | Ga0466957_0723309_259_423 | 53 |
| 25 | 3300053119 | Ga0500595_034243 | Ga0500595_034243_1463_1624 | 53 |
| 26 | 3300005339 | Ga0070660_100124822 | Ga0070660_1001248222 | 54 |
| 27 | 3300005366 | Ga0070659_100003250 | Ga0070659_1000032501 | 54 |
| 28 | 3300005539 | Ga0068853_101890602 | Ga0068853_1018906021 | 54 |
| 29 | 3300006028 | Ga0070717_10079677 | Ga0070717_100796773 | 54 |
| 30 | 3300013306 | Ga0163162_11213460 | Ga0163162_112134602 | 54 |
| 31 | 3300025919 | Ga0207657_10091138 | Ga0207657_100911383 | 54 |
| 32 | 3300025932 | Ga0207690_10000602 | Ga0207690_100006023 | 54 |
| 33 | 3300026041 | Ga0207639_11582142 | Ga0207639_115821422 | 54 |
| 34 | 3300005327 | Ga0070658_10308308 | Ga0070658_103083082 | 55 |
| 35 | 3300006358 | Ga0068871_101211113 | Ga0068871_1012111132 | 55 |
| 36 | 3300009093 | Ga0105240_10725090 | Ga0105240_107250901 | 55 |
| 37 | 3300010375 | Ga0105239_10107197 | Ga0105239_101071975 | 55 |
| 38 | 3300025909 | Ga0207705_10138339 | Ga0207705_101383392 | 55 |
| 39 | 3300025913 | Ga0207695_10080947 | Ga0207695_100809474 | 55 |
| 40 | 3300036401 | Ga0373937_0574184 | Ga0373937_0574184_710_877 | 55 |
| 41 | 3300046543 | Ga0495645_0065049 | Ga0495645_0065049_752_922 | 55 |
| 42 | 3300046660 | Ga0495625_0421650 | Ga0495625_0421650_206_376 | 55 |
| 43 | 3300053077 | Ga0495601_0542471 | Ga0495601_0542471_72_242 | 55 |
| 44 | 3300053096 | Ga0500641_0003330 | Ga0500641_0003330_5144_5314 | 55 |
| 45 | 3300053108 | Ga0500562_001329 | Ga0500562_001329_1174_1341 | 55 |
| 46 | 3300005614 | Ga0068856_100270305 | Ga0068856_1002703051 | 56 |
| 47 | 3300009551 | Ga0105238_11325015 | Ga0105238_113250152 | 56 |
| 48 | 3300013306 | Ga0163162_11041217 | Ga0163162_110412172 | 56 |
| 49 | 3300025913 | Ga0207695_10103364 | Ga0207695_101033644 | 56 |
| 50 | 3300025924 | Ga0207694_10764643 | Ga0207694_107646432 | 56 |
| 51 | 3300025924 | Ga0207694_11040479 | Ga0207694_110404792 | 56 |
| 52 | 3300026078 | Ga0207702_11782171 | Ga0207702_117821711 | 56 |
| 53 | 3300026116 | Ga0207674_10474609 | Ga0207674_104746092 | 56 |
| 54 | 3300049581 | Ga0501047_1158711 | Ga0501047_1158711_353_523 | 56 |
| 55 | 3300049589 | Ga0501073_0911243 | Ga0501073_0911243_266_436 | 56 |
| 56 | 3300005327 | Ga0070658_10035779 | Ga0070658_100357793 | 57 |
| 57 | 3300005327 | Ga0070658_10054293 | Ga0070658_100542933 | 57 |
| 58 | 3300005327 | Ga0070658_11976428 | Ga0070658_119764281 | 57 |
| 59 | 3300005331 | Ga0070670_100414002 | Ga0070670_1004140022 | 57 |
| 60 | 3300005335 | Ga0070666_10480382 | Ga0070666_104803821 | 57 |
| 61 | 3300005336 | Ga0070680_100054654 | Ga0070680_1000546542 | 57 |
| 62 | 3300005336 | Ga0070680_100148972 | Ga0070680_1001489723 | 57 |
| 63 | 3300005336 | Ga0070680_101029510 | Ga0070680_1010295101 | 57 |
| 64 | 3300005336 | Ga0070680_101738800 | Ga0070680_1017388002 | 57 |
| 65 | 3300005337 | Ga0070682_100273762 | Ga0070682_1002737623 | 57 |
| 66 | 3300005339 | Ga0070660_100023042 | Ga0070660_1000230422 | 57 |
| 67 | 3300005339 | Ga0070660_100245060 | Ga0070660_1002450601 | 57 |
| 68 | 3300005344 | Ga0070661_101781864 | Ga0070661_1017818641 | 57 |
| 69 | 3300005355 | Ga0070671_100009979 | Ga0070671_1000099797 | 57 |
| 70 | 3300005355 | Ga0070671_100148301 | Ga0070671_1001483012 | 57 |
| 71 | 3300005355 | Ga0070671_100448017 | Ga0070671_1004480171 | 57 |
| 72 | 3300005355 | Ga0070671_101061143 | Ga0070671_1010611431 | 57 |
| 73 | 3300005364 | Ga0070673_100086441 | Ga0070673_1000864412 | 57 |
| 74 | 3300005366 | Ga0070659_100065204 | Ga0070659_1000652043 | 57 |
| 75 | 3300005445 | Ga0070708_101763075 | Ga0070708_1017630751 | 57 |
| 76 | 3300005455 | Ga0070663_100542555 | Ga0070663_1005425551 | 57 |
| 77 | 3300005457 | Ga0070662_100102620 | Ga0070662_1001026204 | 57 |
| 78 | 3300005458 | Ga0070681_10016688 | Ga0070681_100166882 | 57 |
| 79 | 3300005458 | Ga0070681_10053309 | Ga0070681_100533093 | 57 |
| 80 | 3300005458 | Ga0070681_10593414 | Ga0070681_105934142 | 57 |
| 81 | 3300005530 | Ga0070679_100057002 | Ga0070679_1000570025 | 57 |
| 82 | 3300005530 | Ga0070679_101765782 | Ga0070679_1017657821 | 57 |
| 83 | 3300005539 | Ga0068853_100006770 | Ga0068853_10000677011 | 57 |
| 84 | 3300005539 | Ga0068853_101474713 | Ga0068853_1014747131 | 57 |
| 85 | 3300005548 | Ga0070665_100001582 | Ga0070665_10000158223 | 57 |
| 86 | 3300005548 | Ga0070665_100039395 | Ga0070665_1000393952 | 57 |
| 87 | 3300005563 | Ga0068855_100056393 | Ga0068855_1000563933 | 57 |
| 88 | 3300005563 | Ga0068855_100213978 | Ga0068855_1002139782 | 57 |
| 89 | 3300005563 | Ga0068855_100251795 | Ga0068855_1002517952 | 57 |
| 90 | 3300005563 | Ga0068855_100657895 | Ga0068855_1006578952 | 57 |
| 91 | 3300005577 | Ga0068857_101210299 | Ga0068857_1012102991 | 57 |
| 92 | 3300005614 | Ga0068856_100723141 | Ga0068856_1007231412 | 57 |
| 93 | 3300005616 | Ga0068852_100053465 | Ga0068852_1000534654 | 57 |
| 94 | 3300005616 | Ga0068852_100771749 | Ga0068852_1007717492 | 57 |
| 95 | 3300005616 | Ga0068852_101392861 | Ga0068852_1013928612 | 57 |
| 96 | 3300005618 | Ga0068864_100017687 | Ga0068864_1000176878 | 57 |
| 97 | 3300005618 | Ga0068864_100165929 | Ga0068864_1001659292 | 57 |
| 98 | 3300005618 | Ga0068864_101422161 | Ga0068864_1014221611 | 57 |
| 99 | 3300005841 | Ga0068863_100064877 | Ga0068863_1000648772 | 57 |
| 100 | 3300005841 | Ga0068863_101252774 | Ga0068863_1012527742 | 57 |
| 101 | 3300005841 | Ga0068863_102269457 | Ga0068863_1022694571 | 57 |
| 102 | 3300006173 | Ga0070716_100574201 | Ga0070716_1005742012 | 57 |
| 103 | 3300006237 | Ga0097621_101797615 | Ga0097621_1017976151 | 57 |
| 104 | 3300006358 | Ga0068871_101188466 | Ga0068871_1011884662 | 57 |
| 105 | 3300009092 | Ga0105250_10361899 | Ga0105250_103618991 | 57 |
| 106 | 3300009093 | Ga0105240_10262015 | Ga0105240_102620152 | 57 |
| 107 | 3300009093 | Ga0105240_10272781 | Ga0105240_102727813 | 57 |
| 108 | 3300009093 | Ga0105240_10323295 | Ga0105240_103232952 | 57 |
| 109 | 3300009093 | Ga0105240_10781980 | Ga0105240_107819801 | 57 |
| 110 | 3300009098 | Ga0105245_11622858 | Ga0105245_116228581 | 57 |
| 111 | 3300009176 | Ga0105242_10237519 | Ga0105242_102375193 | 57 |
| 112 | 3300009177 | Ga0105248_10095136 | Ga0105248_100951362 | 57 |
| 113 | 3300009177 | Ga0105248_12771369 | Ga0105248_127713691 | 57 |
| 114 | 3300009551 | Ga0105238_10187945 | Ga0105238_101879452 | 57 |
| 115 | 3300009551 | Ga0105238_10919924 | Ga0105238_109199242 | 57 |
| 116 | 3300009551 | Ga0105238_11109850 | Ga0105238_111098501 | 57 |
| 117 | 3300009553 | Ga0105249_11324071 | Ga0105249_113240712 | 57 |
| 118 | 3300010375 | Ga0105239_10801844 | Ga0105239_108018442 | 57 |
| 119 | 3300013104 | Ga0157370_10054656 | Ga0157370_100546564 | 57 |
| 120 | 3300013104 | Ga0157370_10549742 | Ga0157370_105497422 | 57 |
| 121 | 3300013104 | Ga0157370_10564557 | Ga0157370_105645572 | 57 |
| 122 | 3300013105 | Ga0157369_12037177 | Ga0157369_120371771 | 57 |
| 123 | 3300013306 | Ga0163162_10150701 | Ga0163162_101507013 | 57 |
| 124 | 3300013306 | Ga0163162_11176632 | Ga0163162_111766321 | 57 |
| 125 | 3300013307 | Ga0157372_10741457 | Ga0157372_107414572 | 57 |
| 126 | 3300013308 | Ga0157375_10154116 | Ga0157375_101541162 | 57 |
| 127 | 3300014325 | Ga0163163_10485188 | Ga0163163_104851882 | 57 |
| 128 | 3300014325 | Ga0163163_11592189 | Ga0163163_115921891 | 57 |
| 129 | 3300014968 | Ga0157379_11129365 | Ga0157379_111293651 | 57 |
| 130 | 3300014968 | Ga0157379_12253777 | Ga0157379_122537771 | 57 |
| 131 | 3300014969 | Ga0157376_10506848 | Ga0157376_105068481 | 57 |
| 132 | 3300014969 | Ga0157376_11572559 | Ga0157376_115725592 | 57 |
| 133 | 3300017792 | Ga0163161_10156139 | Ga0163161_101561394 | 57 |
| 134 | 3300025903 | Ga0207680_11184114 | Ga0207680_111841142 | 57 |
| 135 | 3300025909 | Ga0207705_10008215 | Ga0207705_100082153 | 57 |
| 136 | 3300025912 | Ga0207707_10059865 | Ga0207707_100598652 | 57 |
| 137 | 3300025912 | Ga0207707_10159225 | Ga0207707_101592252 | 57 |
| 138 | 3300025913 | Ga0207695_10002836 | Ga0207695_1000283620 | 57 |
| 139 | 3300025913 | Ga0207695_10228286 | Ga0207695_102282862 | 57 |
| 140 | 3300025913 | Ga0207695_10312582 | Ga0207695_103125822 | 57 |
| 141 | 3300025913 | Ga0207695_11194635 | Ga0207695_111946351 | 57 |
| 142 | 3300025917 | Ga0207660_10000845 | Ga0207660_100008454 | 57 |
| 143 | 3300025917 | Ga0207660_10113888 | Ga0207660_101138883 | 57 |
| 144 | 3300025917 | Ga0207660_11106192 | Ga0207660_111061921 | 57 |
| 145 | 3300025919 | Ga0207657_10005562 | Ga0207657_100055623 | 57 |
| 146 | 3300025919 | Ga0207657_10566686 | Ga0207657_105666862 | 57 |
| 147 | 3300025919 | Ga0207657_11521618 | Ga0207657_115216181 | 57 |
| 148 | 3300025921 | Ga0207652_10019362 | Ga0207652_100193622 | 57 |
| 149 | 3300025924 | Ga0207694_10220435 | Ga0207694_102204352 | 57 |
| 150 | 3300025924 | Ga0207694_10755349 | Ga0207694_107553492 | 57 |
| 151 | 3300025925 | Ga0207650_10265046 | Ga0207650_102650462 | 57 |
| 152 | 3300025931 | Ga0207644_10111019 | Ga0207644_101110193 | 57 |
| 153 | 3300025931 | Ga0207644_10128752 | Ga0207644_101287521 | 57 |
| 154 | 3300025932 | Ga0207690_10088079 | Ga0207690_100880793 | 57 |
| 155 | 3300025933 | Ga0207706_10042714 | Ga0207706_100427142 | 57 |
| 156 | 3300025934 | Ga0207686_10887308 | Ga0207686_108873082 | 57 |
| 157 | 3300025939 | Ga0207665_10672472 | Ga0207665_106724721 | 57 |
| 158 | 3300025941 | Ga0207711_10069457 | Ga0207711_100694573 | 57 |
| 159 | 3300025942 | Ga0207689_10794180 | Ga0207689_107941802 | 57 |
| 160 | 3300025949 | Ga0207667_10018155 | Ga0207667_100181556 | 57 |
| 161 | 3300025949 | Ga0207667_10175391 | Ga0207667_101753912 | 57 |
| 162 | 3300025949 | Ga0207667_10269485 | Ga0207667_102694851 | 57 |
| 163 | 3300025949 | Ga0207667_10430122 | Ga0207667_104301222 | 57 |
| 164 | 3300025961 | Ga0207712_10311463 | Ga0207712_103114632 | 57 |
| 165 | 3300026023 | Ga0207677_10081017 | Ga0207677_100810172 | 57 |
| 166 | 3300026023 | Ga0207677_11890447 | Ga0207677_118904471 | 57 |
| 167 | 3300026035 | Ga0207703_10280550 | Ga0207703_102805503 | 57 |
| 168 | 3300026041 | Ga0207639_10056178 | Ga0207639_100561782 | 57 |
| 169 | 3300026041 | Ga0207639_10121178 | Ga0207639_101211782 | 57 |
| 170 | 3300026041 | Ga0207639_11125297 | Ga0207639_111252971 | 57 |
| 171 | 3300026078 | Ga0207702_10487196 | Ga0207702_104871962 | 57 |
| 172 | 3300026078 | Ga0207702_12208501 | Ga0207702_122085011 | 57 |
| 173 | 3300026088 | Ga0207641_10153572 | Ga0207641_101535722 | 57 |
| 174 | 3300026088 | Ga0207641_10437519 | Ga0207641_104375192 | 57 |
| 175 | 3300026095 | Ga0207676_10085722 | Ga0207676_100857222 | 57 |
| 176 | 3300026095 | Ga0207676_11039744 | Ga0207676_110397442 | 57 |
| 177 | 3300026095 | Ga0207676_11152344 | Ga0207676_111523441 | 57 |
| 178 | 3300026116 | Ga0207674_11017323 | Ga0207674_110173231 | 57 |
| 179 | 3300028379 | Ga0268266_10000064 | Ga0268266_1000006423 | 57 |
| 180 | 3300028786 | Ga0307517_10106828 | Ga0307517_101068282 | 57 |
| 181 | 3300031456 | Ga0307513_10001560 | Ga0307513_1000156026 | 57 |
| 182 | 3300044842 | Ga0466957_0223163 | Ga0466957_0223163_1042_1215 | 57 |
| 183 | 3300046506 | Ga0495583_0045030 | Ga0495583_0045030_1824_2000 | 57 |
| 184 | 3300046528 | Ga0495642_0032340 | Ga0495642_0032340_1746_1922 | 57 |
| 185 | 3300046528 | Ga0495642_0083714 | Ga0495642_0083714_292_468 | 57 |
| 186 | 3300046528 | Ga0495642_0324974 | Ga0495642_0324974_164_340 | 57 |
| 187 | 3300046648 | Ga0495611_0376726 | Ga0495611_0376726_87_263 | 57 |
| 188 | 3300046660 | Ga0495625_0040987 | Ga0495625_0040987_1744_1920 | 57 |
| 189 | 3300046684 | Ga0495669_0187699 | Ga0495669_0187699_332_508 | 57 |
| 190 | 3300046684 | Ga0495669_0521220 | Ga0495669_0521220_218_394 | 57 |
| 191 | 3300047320 | Ga0495672_0006993 | Ga0495672_0006993_8097_8273 | 57 |
| 192 | 3300047320 | Ga0495672_0380120 | Ga0495672_0380120_412_588 | 57 |
| 193 | 3300047445 | Ga0495677_0309286 | Ga0495677_0309286_348_524 | 57 |
| 194 | 3300047445 | Ga0495677_0340223 | Ga0495677_0340223_220_396 | 57 |
| 195 | 3300047447 | Ga0495685_231172 | Ga0495685_231172_390_566 | 57 |
| 196 | 3300048903 | Ga0496100_0474320 | Ga0496100_0474320_33_209 | 57 |
| 197 | 3300048905 | Ga0496102_0090741 | Ga0496102_0090741_401_577 | 57 |
| 198 | 3300048910 | Ga0496107_0946452 | Ga0496107_0946452_31_207 | 57 |
| 199 | 3300048911 | Ga0496108_0138777 | Ga0496108_0138777_755_931 | 57 |
| 200 | 3300048912 | Ga0496109_0062979 | Ga0496109_0062979_2818_2994 | 57 |
| 201 | 3300048912 | Ga0496109_0187442 | Ga0496109_0187442_690_866 | 57 |
| 202 | 3300048915 | Ga0496112_0173857 | Ga0496112_0173857_1703_1882 | 57 |
| 203 | 3300048915 | Ga0496112_0662199 | Ga0496112_0662199_464_640 | 57 |
| 204 | 3300048915 | Ga0496112_1050487 | Ga0496112_1050487_450_626 | 57 |
| 205 | 3300048916 | Ga0496113_0363102 | Ga0496113_0363102_406_582 | 57 |
| 206 | 3300048918 | Ga0496115_0001515 | Ga0496115_0001515_9088_9261 | 57 |
| 207 | 3300048918 | Ga0496115_0741604 | Ga0496115_0741604_286_459 | 57 |
| 208 | 3300049582 | Ga0501048_0035692 | Ga0501048_0035692_1701_1874 | 57 |
| 209 | 3300053118 | Ga0500594_0277862 | Ga0500594_0277862_330_506 | 57 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar