F318890

General Info

Members Datasets Scaffolds Average Seq Length
209 111 209 57

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101252774|Ga0068863_1012527742
Length 61
Sequence MTTSNELGGAPESFNESSLDDPFLAAAPLDEDAGPLSLFQEINERRARVENAELLAHLRGL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
95 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
108 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
109 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
110 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
111 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.91
Nodule 0
Rhizoplane 5.74
Rhizosphere 91.39
Stem 0
Stem Tuber 0
Unclassified 0.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10035779 3300005327 Bacteria 4000
2 Ga0070658_10054293 3300005327 Bacteria 3253
3 Ga0070658_10308308 3300005327 Bacteria 1350
4 Ga0070658_11976428 3300005327 Bacteria 503
5 Ga0070670_100414002 3300005331 Bacteria 1191
6 Ga0070666_10480382 3300005335 Bacteria 900
7 Ga0070680_100054654 3300005336 Bacteria 3261
8 Ga0070680_100148972 3300005336 Bacteria 1964
9 Ga0070680_101029510 3300005336 Bacteria 711
10 Ga0070680_101738800 3300005336 Bacteria 540
11 Ga0070682_100273762 3300005337 Bacteria 1227
12 Ga0070660_100023042 3300005339 Bacteria 4610
13 Ga0070660_100124822 3300005339 Bacteria 2056
14 Ga0070660_100245060 3300005339 Bacteria 1460
15 Ga0070661_101781864 3300005344 Unclassified 522
16 Ga0070671_100009979 3300005355 Bacteria 7625
17 Ga0070671_100148301 3300005355 Bacteria 1980
18 Ga0070671_100448017 3300005355 Bacteria 1107
19 Ga0070671_101061143 3300005355 Bacteria 711
20 Ga0070673_100086441 3300005364 Bacteria 2555
21 Ga0070659_100003250 3300005366 Bacteria 11567
22 Ga0070659_100065204 3300005366 Bacteria 2884
23 Ga0070708_101763075 3300005445 Bacteria 575
24 Ga0070663_100542555 3300005455 Bacteria 971
25 Ga0070662_100102620 3300005457 Bacteria 2167
26 Ga0070681_10016688 3300005458 Bacteria 7331
27 Ga0070681_10053309 3300005458 Bacteria 4030
28 Ga0070681_10593414 3300005458 Bacteria 1022
29 Ga0070679_100057002 3300005530 Bacteria 3893
30 Ga0070679_101765782 3300005530 Bacteria 567
31 Ga0068853_100006770 3300005539 Bacteria 9132
32 Ga0068853_101474713 3300005539 Bacteria 658
33 Ga0068853_101890602 3300005539 Bacteria 579
34 Ga0070665_100001582 3300005548 Bacteria 26236
35 Ga0070665_100039395 3300005548 Bacteria 4752
36 Ga0068855_100056393 3300005563 Bacteria 4610
37 Ga0068855_100213978 3300005563 Bacteria 2164
38 Ga0068855_100251795 3300005563 Bacteria 1970
39 Ga0068855_100657895 3300005563 Bacteria 1124
40 Ga0070664_101541779 3300005564 Bacteria 629
41 Ga0068857_101210299 3300005577 Bacteria 731
42 Ga0068854_101777373 3300005578 Bacteria 565
43 Ga0068856_100270305 3300005614 Bacteria 1716
44 Ga0068856_100723141 3300005614 Bacteria 1016
45 Ga0068852_100053465 3300005616 Bacteria 3476
46 Ga0068852_100771749 3300005616 Bacteria 974
47 Ga0068852_101392861 3300005616 Bacteria 723
48 Ga0068852_101544629 3300005616 Bacteria 686
49 Ga0068864_100017687 3300005618 Bacteria 5945
50 Ga0068864_100165929 3300005618 Bacteria 2010
51 Ga0068864_101422161 3300005618 Bacteria 695
52 Ga0068863_100064877 3300005841 Bacteria 3454
53 Ga0068863_101252774 3300005841 Bacteria 748
54 Ga0068863_102269457 3300005841 Bacteria 552
55 Ga0070717_10079677 3300006028 Bacteria 2747
56 Ga0070717_10204700 3300006028 Bacteria 1730
57 Ga0070716_100574201 3300006173 Bacteria 844
58 Ga0097621_101797615 3300006237 Unclassified 584
59 Ga0068871_101188466 3300006358 Bacteria 715
60 Ga0068871_101211113 3300006358 Bacteria 708
61 Ga0105250_10361899 3300009092 Bacteria 637
62 Ga0105240_10262015 3300009093 Bacteria 1994
63 Ga0105240_10272781 3300009093 Bacteria 1946
64 Ga0105240_10323295 3300009093 Bacteria 1758
65 Ga0105240_10725090 3300009093 Bacteria 1083
66 Ga0105240_10781980 3300009093 Bacteria 1035
67 Ga0105240_11102764 3300009093 Bacteria 844
68 Ga0105245_11622858 3300009098 Bacteria 698
69 Ga0105242_10237519 3300009176 Bacteria 1637
70 Ga0105248_10000335 3300009177 Bacteria 55396
71 Ga0105248_10095136 3300009177 Bacteria 3354
72 Ga0105248_12771369 3300009177 Bacteria 559
73 Ga0105237_10460791 3300009545 Bacteria 1277
74 Ga0105238_10187945 3300009551 Bacteria 2042
75 Ga0105238_10435738 3300009551 Bacteria 1307
76 Ga0105238_10919924 3300009551 Bacteria 893
77 Ga0105238_11109850 3300009551 Bacteria 814
78 Ga0105238_11325015 3300009551 Bacteria 746
79 Ga0105249_11324071 3300009553 Bacteria 792
80 Ga0105239_10107197 3300010375 Bacteria 3095
81 Ga0105239_10215104 3300010375 Bacteria 2155
82 Ga0105239_10801844 3300010375 Bacteria 1079
83 Ga0157370_10054656 3300013104 Bacteria 3806
84 Ga0157370_10549742 3300013104 Bacteria 1058
85 Ga0157370_10564557 3300013104 Bacteria 1043
86 Ga0157369_12037177 3300013105 Bacteria 582
87 Ga0163162_10150701 3300013306 Bacteria 2443
88 Ga0163162_11041217 3300013306 Bacteria 926
89 Ga0163162_11176632 3300013306 Bacteria 870
90 Ga0163162_11213460 3300013306 Bacteria 856
91 Ga0157372_10183069 3300013307 Bacteria 2425
92 Ga0157372_10741457 3300013307 Bacteria 1142
93 Ga0157375_10154116 3300013308 Bacteria 2435
94 Ga0163163_10031475 3300014325 Bacteria 5120
95 Ga0163163_10485188 3300014325 Bacteria 1297
96 Ga0163163_11592189 3300014325 Bacteria 714
97 Ga0182008_10689321 3300014497 Bacteria 582
98 Ga0157379_11129365 3300014968 Bacteria 751
99 Ga0157379_12253777 3300014968 Unclassified 542
100 Ga0157376_10506848 3300014969 Bacteria 1187
101 Ga0157376_11572559 3300014969 Bacteria 691
102 Ga0163161_10156139 3300017792 Bacteria 1737
103 Ga0207680_11184114 3300025903 Bacteria 545
104 Ga0207705_10008215 3300025909 Bacteria 7635
105 Ga0207705_10138339 3300025909 Bacteria 1817
106 Ga0207707_10059865 3300025912 Bacteria 3314
107 Ga0207707_10159225 3300025912 Bacteria 1974
108 Ga0207695_10002836 3300025913 Bacteria 25176
109 Ga0207695_10080947 3300025913 Bacteria 3288
110 Ga0207695_10103364 3300025913 Bacteria 2840
111 Ga0207695_10228286 3300025913 Bacteria 1767
112 Ga0207695_10312582 3300025913 Bacteria 1461
113 Ga0207695_11183437 3300025913 Bacteria 644
114 Ga0207695_11194635 3300025913 Bacteria 641
115 Ga0207671_10747836 3300025914 Bacteria 777
116 Ga0207660_10000845 3300025917 Bacteria 20177
117 Ga0207660_10113888 3300025917 Bacteria 2039
118 Ga0207660_11106192 3300025917 Bacteria 646
119 Ga0207657_10005562 3300025919 Bacteria 13157
120 Ga0207657_10091138 3300025919 Bacteria 2543
121 Ga0207657_10566686 3300025919 Bacteria 887
122 Ga0207657_11521618 3300025919 Bacteria 500
123 Ga0207652_10019362 3300025921 Bacteria 5597
124 Ga0207694_10220435 3300025924 Bacteria 1547
125 Ga0207694_10303862 3300025924 Bacteria 1314
126 Ga0207694_10755349 3300025924 Bacteria 821
127 Ga0207694_10764643 3300025924 Bacteria 816
128 Ga0207694_11040479 3300025924 Bacteria 693
129 Ga0207650_10265046 3300025925 Bacteria 1395
130 Ga0207644_10111019 3300025931 Bacteria 2073
131 Ga0207644_10128752 3300025931 Bacteria 1935
132 Ga0207690_10000602 3300025932 Bacteria 23326
133 Ga0207690_10088079 3300025932 Bacteria 2186
134 Ga0207706_10042714 3300025933 Bacteria 4018
135 Ga0207686_10887308 3300025934 Bacteria 719
136 Ga0207665_10672472 3300025939 Bacteria 813
137 Ga0207711_10001498 3300025941 Bacteria 21755
138 Ga0207711_10069457 3300025941 Bacteria 3054
139 Ga0207689_10794180 3300025942 Bacteria 799
140 Ga0207679_12168681 3300025945 Bacteria 504
141 Ga0207667_10018155 3300025949 Bacteria 7897
142 Ga0207667_10175391 3300025949 Bacteria 2203
143 Ga0207667_10269485 3300025949 Bacteria 1741
144 Ga0207667_10430122 3300025949 Bacteria 1343
145 Ga0207712_10311463 3300025961 Bacteria 1295
146 Ga0207677_10081017 3300026023 Bacteria 2328
147 Ga0207677_11890447 3300026023 Bacteria 555
148 Ga0207703_10280550 3300026035 Bacteria 1513
149 Ga0207639_10056178 3300026041 Bacteria 3016
150 Ga0207639_10121178 3300026041 Bacteria 2149
151 Ga0207639_11125297 3300026041 Bacteria 737
152 Ga0207639_11582142 3300026041 Bacteria 615
153 Ga0207702_10487196 3300026078 Bacteria 1201
154 Ga0207702_11782171 3300026078 Bacteria 608
155 Ga0207702_12208501 3300026078 Bacteria 539
156 Ga0207641_10153572 3300026088 Bacteria 2087
157 Ga0207641_10437519 3300026088 Bacteria 1262
158 Ga0207676_10085722 3300026095 Bacteria 2571
159 Ga0207676_11039744 3300026095 Bacteria 808
160 Ga0207676_11152344 3300026095 Bacteria 767
161 Ga0207674_10474609 3300026116 Bacteria 1209
162 Ga0207674_11017323 3300026116 Bacteria 798
163 Ga0207698_11274248 3300026142 Bacteria 750
164 Ga0268266_10000064 3300028379 Bacteria 249533
165 Ga0307517_10106828 3300028786 Bacteria 2162
166 Ga0265327_10034967 3300031251 Bacteria 2783
167 Ga0307513_10001560 3300031456 Bacteria 32859
168 Ga0373927_0651537 3300035695 Bacteria 696
169 Ga0373947_0097087 3300035725 Bacteria 1846
170 Ga0373937_0574184 3300036401 Bacteria 1071
171 Ga0373925_0873123 3300037068 Bacteria 741
172 Ga0395899_0124158 3300037312 Bacteria 1847
173 Ga0466957_0223163 3300044842 Bacteria 1245
174 Ga0466957_0723309 3300044842 Bacteria 704
175 Ga0495583_0045030 3300046506 Bacteria 2043
176 Ga0495642_0032340 3300046528 Bacteria 2099
177 Ga0495642_0083714 3300046528 Unclassified 1345
178 Ga0495642_0324974 3300046528 Unclassified 675
179 Ga0495645_0065049 3300046543 Bacteria 2638
180 Ga0495611_0376726 3300046648 Bacteria 650
181 Ga0495625_0040987 3300046660 Bacteria 3372
182 Ga0495625_0421650 3300046660 Bacteria 830
183 Ga0495669_0187699 3300046684 Unclassified 986
184 Ga0495669_0521220 3300046684 Bacteria 578
185 Ga0495672_0006993 3300047320 Bacteria 8575
186 Ga0495672_0380120 3300047320 Bacteria 650
187 Ga0495677_0309286 3300047445 Bacteria 622
188 Ga0495677_0340223 3300047445 Unclassified 592
189 Ga0495685_231172 3300047447 Bacteria 589
190 Ga0496100_0474320 3300048903 Bacteria 962
191 Ga0496102_0090741 3300048905 Bacteria 2828
192 Ga0496107_0946452 3300048910 Bacteria 627
193 Ga0496108_0138777 3300048911 Bacteria 2094
194 Ga0496109_0062979 3300048912 Bacteria 3392
195 Ga0496109_0187442 3300048912 Bacteria 1944
196 Ga0496112_0173857 3300048915 Bacteria 2119
197 Ga0496112_0662199 3300048915 Bacteria 973
198 Ga0496112_1050487 3300048915 Bacteria 733
199 Ga0496113_0363102 3300048916 Bacteria 1162
200 Ga0496115_0001515 3300048918 Bacteria 16693
201 Ga0496115_0741604 3300048918 Bacteria 769
202 Ga0501047_1158711 3300049581 Bacteria 586
203 Ga0501048_0035692 3300049582 Bacteria 3578
204 Ga0501073_0911243 3300049589 Unclassified 605
205 Ga0495601_0542471 3300053077 Bacteria 749
206 Ga0500641_0003330 3300053096 Bacteria 5689
207 Ga0500562_001329 3300053108 Bacteria 6091
208 Ga0500594_0277862 3300053118 Unclassified 560
209 Ga0500595_034243 3300053119 Bacteria 1681

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10034967 Ga0265327_100349672 51
2 3300035695 Ga0373927_0651537 Ga0373927_0651537_174_368 51
3 3300035725 Ga0373947_0097087 Ga0373947_0097087_686_880 51
4 3300037068 Ga0373925_0873123 Ga0373925_0873123_188_382 51
5 3300037312 Ga0395899_0124158 Ga0395899_0124158_1128_1283 51
6 3300005564 Ga0070664_101541779 Ga0070664_1015417791 53
7 3300005578 Ga0068854_101777373 Ga0068854_1017773731 53
8 3300005616 Ga0068852_101544629 Ga0068852_1015446291 53
9 3300006028 Ga0070717_10204700 Ga0070717_102047002 53
10 3300009093 Ga0105240_11102764 Ga0105240_111027641 53
11 3300009177 Ga0105248_10000335 Ga0105248_1000033531 53
12 3300009545 Ga0105237_10460791 Ga0105237_104607912 53
13 3300009551 Ga0105238_10435738 Ga0105238_104357382 53
14 3300010375 Ga0105239_10215104 Ga0105239_102151041 53
15 3300013307 Ga0157372_10183069 Ga0157372_101830693 53
16 3300014325 Ga0163163_10031475 Ga0163163_100314753 53
17 3300014497 Ga0182008_10689321 Ga0182008_106893211 53
18 3300025913 Ga0207695_11183437 Ga0207695_111834371 53
19 3300025914 Ga0207671_10747836 Ga0207671_107478362 53
20 3300025924 Ga0207694_10303862 Ga0207694_103038622 53
21 3300025941 Ga0207711_10001498 Ga0207711_1000149813 53
22 3300025945 Ga0207679_12168681 Ga0207679_121686811 53
23 3300026142 Ga0207698_11274248 Ga0207698_112742482 53
24 3300044842 Ga0466957_0723309 Ga0466957_0723309_259_423 53
25 3300053119 Ga0500595_034243 Ga0500595_034243_1463_1624 53
26 3300005339 Ga0070660_100124822 Ga0070660_1001248222 54
27 3300005366 Ga0070659_100003250 Ga0070659_1000032501 54
28 3300005539 Ga0068853_101890602 Ga0068853_1018906021 54
29 3300006028 Ga0070717_10079677 Ga0070717_100796773 54
30 3300013306 Ga0163162_11213460 Ga0163162_112134602 54
31 3300025919 Ga0207657_10091138 Ga0207657_100911383 54
32 3300025932 Ga0207690_10000602 Ga0207690_100006023 54
33 3300026041 Ga0207639_11582142 Ga0207639_115821422 54
34 3300005327 Ga0070658_10308308 Ga0070658_103083082 55
35 3300006358 Ga0068871_101211113 Ga0068871_1012111132 55
36 3300009093 Ga0105240_10725090 Ga0105240_107250901 55
37 3300010375 Ga0105239_10107197 Ga0105239_101071975 55
38 3300025909 Ga0207705_10138339 Ga0207705_101383392 55
39 3300025913 Ga0207695_10080947 Ga0207695_100809474 55
40 3300036401 Ga0373937_0574184 Ga0373937_0574184_710_877 55
41 3300046543 Ga0495645_0065049 Ga0495645_0065049_752_922 55
42 3300046660 Ga0495625_0421650 Ga0495625_0421650_206_376 55
43 3300053077 Ga0495601_0542471 Ga0495601_0542471_72_242 55
44 3300053096 Ga0500641_0003330 Ga0500641_0003330_5144_5314 55
45 3300053108 Ga0500562_001329 Ga0500562_001329_1174_1341 55
46 3300005614 Ga0068856_100270305 Ga0068856_1002703051 56
47 3300009551 Ga0105238_11325015 Ga0105238_113250152 56
48 3300013306 Ga0163162_11041217 Ga0163162_110412172 56
49 3300025913 Ga0207695_10103364 Ga0207695_101033644 56
50 3300025924 Ga0207694_10764643 Ga0207694_107646432 56
51 3300025924 Ga0207694_11040479 Ga0207694_110404792 56
52 3300026078 Ga0207702_11782171 Ga0207702_117821711 56
53 3300026116 Ga0207674_10474609 Ga0207674_104746092 56
54 3300049581 Ga0501047_1158711 Ga0501047_1158711_353_523 56
55 3300049589 Ga0501073_0911243 Ga0501073_0911243_266_436 56
56 3300005327 Ga0070658_10035779 Ga0070658_100357793 57
57 3300005327 Ga0070658_10054293 Ga0070658_100542933 57
58 3300005327 Ga0070658_11976428 Ga0070658_119764281 57
59 3300005331 Ga0070670_100414002 Ga0070670_1004140022 57
60 3300005335 Ga0070666_10480382 Ga0070666_104803821 57
61 3300005336 Ga0070680_100054654 Ga0070680_1000546542 57
62 3300005336 Ga0070680_100148972 Ga0070680_1001489723 57
63 3300005336 Ga0070680_101029510 Ga0070680_1010295101 57
64 3300005336 Ga0070680_101738800 Ga0070680_1017388002 57
65 3300005337 Ga0070682_100273762 Ga0070682_1002737623 57
66 3300005339 Ga0070660_100023042 Ga0070660_1000230422 57
67 3300005339 Ga0070660_100245060 Ga0070660_1002450601 57
68 3300005344 Ga0070661_101781864 Ga0070661_1017818641 57
69 3300005355 Ga0070671_100009979 Ga0070671_1000099797 57
70 3300005355 Ga0070671_100148301 Ga0070671_1001483012 57
71 3300005355 Ga0070671_100448017 Ga0070671_1004480171 57
72 3300005355 Ga0070671_101061143 Ga0070671_1010611431 57
73 3300005364 Ga0070673_100086441 Ga0070673_1000864412 57
74 3300005366 Ga0070659_100065204 Ga0070659_1000652043 57
75 3300005445 Ga0070708_101763075 Ga0070708_1017630751 57
76 3300005455 Ga0070663_100542555 Ga0070663_1005425551 57
77 3300005457 Ga0070662_100102620 Ga0070662_1001026204 57
78 3300005458 Ga0070681_10016688 Ga0070681_100166882 57
79 3300005458 Ga0070681_10053309 Ga0070681_100533093 57
80 3300005458 Ga0070681_10593414 Ga0070681_105934142 57
81 3300005530 Ga0070679_100057002 Ga0070679_1000570025 57
82 3300005530 Ga0070679_101765782 Ga0070679_1017657821 57
83 3300005539 Ga0068853_100006770 Ga0068853_10000677011 57
84 3300005539 Ga0068853_101474713 Ga0068853_1014747131 57
85 3300005548 Ga0070665_100001582 Ga0070665_10000158223 57
86 3300005548 Ga0070665_100039395 Ga0070665_1000393952 57
87 3300005563 Ga0068855_100056393 Ga0068855_1000563933 57
88 3300005563 Ga0068855_100213978 Ga0068855_1002139782 57
89 3300005563 Ga0068855_100251795 Ga0068855_1002517952 57
90 3300005563 Ga0068855_100657895 Ga0068855_1006578952 57
91 3300005577 Ga0068857_101210299 Ga0068857_1012102991 57
92 3300005614 Ga0068856_100723141 Ga0068856_1007231412 57
93 3300005616 Ga0068852_100053465 Ga0068852_1000534654 57
94 3300005616 Ga0068852_100771749 Ga0068852_1007717492 57
95 3300005616 Ga0068852_101392861 Ga0068852_1013928612 57
96 3300005618 Ga0068864_100017687 Ga0068864_1000176878 57
97 3300005618 Ga0068864_100165929 Ga0068864_1001659292 57
98 3300005618 Ga0068864_101422161 Ga0068864_1014221611 57
99 3300005841 Ga0068863_100064877 Ga0068863_1000648772 57
100 3300005841 Ga0068863_101252774 Ga0068863_1012527742 57
101 3300005841 Ga0068863_102269457 Ga0068863_1022694571 57
102 3300006173 Ga0070716_100574201 Ga0070716_1005742012 57
103 3300006237 Ga0097621_101797615 Ga0097621_1017976151 57
104 3300006358 Ga0068871_101188466 Ga0068871_1011884662 57
105 3300009092 Ga0105250_10361899 Ga0105250_103618991 57
106 3300009093 Ga0105240_10262015 Ga0105240_102620152 57
107 3300009093 Ga0105240_10272781 Ga0105240_102727813 57
108 3300009093 Ga0105240_10323295 Ga0105240_103232952 57
109 3300009093 Ga0105240_10781980 Ga0105240_107819801 57
110 3300009098 Ga0105245_11622858 Ga0105245_116228581 57
111 3300009176 Ga0105242_10237519 Ga0105242_102375193 57
112 3300009177 Ga0105248_10095136 Ga0105248_100951362 57
113 3300009177 Ga0105248_12771369 Ga0105248_127713691 57
114 3300009551 Ga0105238_10187945 Ga0105238_101879452 57
115 3300009551 Ga0105238_10919924 Ga0105238_109199242 57
116 3300009551 Ga0105238_11109850 Ga0105238_111098501 57
117 3300009553 Ga0105249_11324071 Ga0105249_113240712 57
118 3300010375 Ga0105239_10801844 Ga0105239_108018442 57
119 3300013104 Ga0157370_10054656 Ga0157370_100546564 57
120 3300013104 Ga0157370_10549742 Ga0157370_105497422 57
121 3300013104 Ga0157370_10564557 Ga0157370_105645572 57
122 3300013105 Ga0157369_12037177 Ga0157369_120371771 57
123 3300013306 Ga0163162_10150701 Ga0163162_101507013 57
124 3300013306 Ga0163162_11176632 Ga0163162_111766321 57
125 3300013307 Ga0157372_10741457 Ga0157372_107414572 57
126 3300013308 Ga0157375_10154116 Ga0157375_101541162 57
127 3300014325 Ga0163163_10485188 Ga0163163_104851882 57
128 3300014325 Ga0163163_11592189 Ga0163163_115921891 57
129 3300014968 Ga0157379_11129365 Ga0157379_111293651 57
130 3300014968 Ga0157379_12253777 Ga0157379_122537771 57
131 3300014969 Ga0157376_10506848 Ga0157376_105068481 57
132 3300014969 Ga0157376_11572559 Ga0157376_115725592 57
133 3300017792 Ga0163161_10156139 Ga0163161_101561394 57
134 3300025903 Ga0207680_11184114 Ga0207680_111841142 57
135 3300025909 Ga0207705_10008215 Ga0207705_100082153 57
136 3300025912 Ga0207707_10059865 Ga0207707_100598652 57
137 3300025912 Ga0207707_10159225 Ga0207707_101592252 57
138 3300025913 Ga0207695_10002836 Ga0207695_1000283620 57
139 3300025913 Ga0207695_10228286 Ga0207695_102282862 57
140 3300025913 Ga0207695_10312582 Ga0207695_103125822 57
141 3300025913 Ga0207695_11194635 Ga0207695_111946351 57
142 3300025917 Ga0207660_10000845 Ga0207660_100008454 57
143 3300025917 Ga0207660_10113888 Ga0207660_101138883 57
144 3300025917 Ga0207660_11106192 Ga0207660_111061921 57
145 3300025919 Ga0207657_10005562 Ga0207657_100055623 57
146 3300025919 Ga0207657_10566686 Ga0207657_105666862 57
147 3300025919 Ga0207657_11521618 Ga0207657_115216181 57
148 3300025921 Ga0207652_10019362 Ga0207652_100193622 57
149 3300025924 Ga0207694_10220435 Ga0207694_102204352 57
150 3300025924 Ga0207694_10755349 Ga0207694_107553492 57
151 3300025925 Ga0207650_10265046 Ga0207650_102650462 57
152 3300025931 Ga0207644_10111019 Ga0207644_101110193 57
153 3300025931 Ga0207644_10128752 Ga0207644_101287521 57
154 3300025932 Ga0207690_10088079 Ga0207690_100880793 57
155 3300025933 Ga0207706_10042714 Ga0207706_100427142 57
156 3300025934 Ga0207686_10887308 Ga0207686_108873082 57
157 3300025939 Ga0207665_10672472 Ga0207665_106724721 57
158 3300025941 Ga0207711_10069457 Ga0207711_100694573 57
159 3300025942 Ga0207689_10794180 Ga0207689_107941802 57
160 3300025949 Ga0207667_10018155 Ga0207667_100181556 57
161 3300025949 Ga0207667_10175391 Ga0207667_101753912 57
162 3300025949 Ga0207667_10269485 Ga0207667_102694851 57
163 3300025949 Ga0207667_10430122 Ga0207667_104301222 57
164 3300025961 Ga0207712_10311463 Ga0207712_103114632 57
165 3300026023 Ga0207677_10081017 Ga0207677_100810172 57
166 3300026023 Ga0207677_11890447 Ga0207677_118904471 57
167 3300026035 Ga0207703_10280550 Ga0207703_102805503 57
168 3300026041 Ga0207639_10056178 Ga0207639_100561782 57
169 3300026041 Ga0207639_10121178 Ga0207639_101211782 57
170 3300026041 Ga0207639_11125297 Ga0207639_111252971 57
171 3300026078 Ga0207702_10487196 Ga0207702_104871962 57
172 3300026078 Ga0207702_12208501 Ga0207702_122085011 57
173 3300026088 Ga0207641_10153572 Ga0207641_101535722 57
174 3300026088 Ga0207641_10437519 Ga0207641_104375192 57
175 3300026095 Ga0207676_10085722 Ga0207676_100857222 57
176 3300026095 Ga0207676_11039744 Ga0207676_110397442 57
177 3300026095 Ga0207676_11152344 Ga0207676_111523441 57
178 3300026116 Ga0207674_11017323 Ga0207674_110173231 57
179 3300028379 Ga0268266_10000064 Ga0268266_1000006423 57
180 3300028786 Ga0307517_10106828 Ga0307517_101068282 57
181 3300031456 Ga0307513_10001560 Ga0307513_1000156026 57
182 3300044842 Ga0466957_0223163 Ga0466957_0223163_1042_1215 57
183 3300046506 Ga0495583_0045030 Ga0495583_0045030_1824_2000 57
184 3300046528 Ga0495642_0032340 Ga0495642_0032340_1746_1922 57
185 3300046528 Ga0495642_0083714 Ga0495642_0083714_292_468 57
186 3300046528 Ga0495642_0324974 Ga0495642_0324974_164_340 57
187 3300046648 Ga0495611_0376726 Ga0495611_0376726_87_263 57
188 3300046660 Ga0495625_0040987 Ga0495625_0040987_1744_1920 57
189 3300046684 Ga0495669_0187699 Ga0495669_0187699_332_508 57
190 3300046684 Ga0495669_0521220 Ga0495669_0521220_218_394 57
191 3300047320 Ga0495672_0006993 Ga0495672_0006993_8097_8273 57
192 3300047320 Ga0495672_0380120 Ga0495672_0380120_412_588 57
193 3300047445 Ga0495677_0309286 Ga0495677_0309286_348_524 57
194 3300047445 Ga0495677_0340223 Ga0495677_0340223_220_396 57
195 3300047447 Ga0495685_231172 Ga0495685_231172_390_566 57
196 3300048903 Ga0496100_0474320 Ga0496100_0474320_33_209 57
197 3300048905 Ga0496102_0090741 Ga0496102_0090741_401_577 57
198 3300048910 Ga0496107_0946452 Ga0496107_0946452_31_207 57
199 3300048911 Ga0496108_0138777 Ga0496108_0138777_755_931 57
200 3300048912 Ga0496109_0062979 Ga0496109_0062979_2818_2994 57
201 3300048912 Ga0496109_0187442 Ga0496109_0187442_690_866 57
202 3300048915 Ga0496112_0173857 Ga0496112_0173857_1703_1882 57
203 3300048915 Ga0496112_0662199 Ga0496112_0662199_464_640 57
204 3300048915 Ga0496112_1050487 Ga0496112_1050487_450_626 57
205 3300048916 Ga0496113_0363102 Ga0496113_0363102_406_582 57
206 3300048918 Ga0496115_0001515 Ga0496115_0001515_9088_9261 57
207 3300048918 Ga0496115_0741604 Ga0496115_0741604_286_459 57
208 3300049582 Ga0501048_0035692 Ga0501048_0035692_1701_1874 57
209 3300053118 Ga0500594_0277862 Ga0500594_0277862_330_506 57

Feature Viewer

pLDDT pTM Quality
72.07 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map