F318877

General Info

Members Datasets Scaffolds Average Seq Length
209 167 208 120

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100620166|Ga0068852_1006201662
Length 140
Sequence VVQPRVTGMGAVVQSGEGYKIIGMNISYPYSFDKTGRTAGVDDDRHIRDMIEQVLFTAPGERVNRPDFGSGLLQLVFEPNSDELVITTQFMVQAALQQWLGDIIEVNNVSVSNEDSSLTVTVTYTIRRTQLIQVAQFLRS

Samples

Sample ID Description Type Environment
1 2902582711 Micromonospora sp. AP08 Isolate Unclassified
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
125 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
131 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
144 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.61
Nodule 0
Rhizoplane 2.87
Rhizosphere 84.21
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1028130 3300000549 Bacteria 656
2 JGI24739J22299_10020099 3300001989 Bacteria 2386
3 JGI25153J46596_10065793 3300003215 Unclassified 962
4 rootH1_10107772 3300003316 Bacteria 1223
5 rootH2_10306058 3300003320 Bacteria 1724
6 rootL2_10015285 3300003322 Bacteria 1654
7 JGI25160J50197_1008469 3300003354 Bacteria 3916
8 Ga0055526_1008006 3300003771 Bacteria 5354
9 Ga0055528_1000068 3300003790 Bacteria 83656
10 Ga0055530_10011359 3300003791 Bacteria 3201
11 Ga0055531_10088322 3300003794 Bacteria 664
12 Ga0055543_1026647 3300004625 Bacteria 1027
13 Ga0065165_1000017 3300005262 Bacteria 278286
14 Ga0065704_10157523 3300005289 Bacteria 1356
15 Ga0065715_10121904 3300005293 Bacteria 2208
16 Ga0065715_10513233 3300005293 Bacteria 770
17 Ga0065707_10045127 3300005295 Unclassified 845
18 Ga0070670_100018852 3300005331 Bacteria 5917
19 Ga0068869_100083490 3300005334 Bacteria 2389
20 Ga0070666_10091559 3300005335 Bacteria 2089
21 Ga0070666_10382493 3300005335 Bacteria 1010
22 Ga0070680_100466015 3300005336 Unclassified 1080
23 Ga0070687_100120130 3300005343 Bacteria 1502
24 Ga0070659_101218041 3300005366 Unclassified 666
25 Ga0070667_100169420 3300005367 Unclassified 1927
26 Ga0070667_100302687 3300005367 Bacteria 1440
27 Ga0070667_100302738 3300005367 Bacteria 1440
28 Ga0070709_11680282 3300005434 Bacteria 518
29 Ga0070714_100799622 3300005435 Unclassified 913
30 Ga0070713_100019424 3300005436 Bacteria 5188
31 Ga0070711_101406437 3300005439 Bacteria 607
32 Ga0070705_100429179 3300005440 Unclassified 986
33 Ga0070694_100241404 3300005444 Bacteria 1363
34 Ga0070694_100568218 3300005444 Unclassified 910
35 Ga0070708_100007847 3300005445 Bacteria 8548
36 Ga0070685_10334027 3300005466 Bacteria 1031
37 Ga0070706_100109422 3300005467 Bacteria 2571
38 Ga0070707_100013835 3300005468 Bacteria 7555
39 Ga0070707_100014522 3300005468 Bacteria 7382
40 Ga0070698_100003316 3300005471 Bacteria 17711
41 Ga0070698_100065472 3300005471 Bacteria 3659
42 Ga0070699_100003159 3300005518 Bacteria 14581
43 Ga0070699_100171861 3300005518 Unclassified 1920
44 Ga0070679_100134794 3300005530 Unclassified 2450
45 Ga0070679_100294754 3300005530 Bacteria 1573
46 Ga0070684_101905807 3300005535 Unclassified 561
47 Ga0070697_100001997 3300005536 Bacteria 15627
48 Ga0070697_100137905 3300005536 Bacteria 2049
49 Ga0068853_100063698 3300005539 Unclassified 3194
50 Ga0070672_100018294 3300005543 Bacteria 5061
51 Ga0070695_100050977 3300005545 Bacteria 2654
52 Ga0070695_101276274 3300005545 Unclassified 606
53 Ga0070704_100270339 3300005549 Bacteria 1404
54 Ga0068855_100338508 3300005563 Viruses 1659
55 Ga0068855_101589013 3300005563 Bacteria 669
56 Ga0070702_100007398 3300005615 Bacteria 5257
57 Ga0068852_100620166 3300005616 Unclassified 1087
58 Ga0068859_100011283 3300005617 Bacteria 8991
59 Ga0068859_100051169 3300005617 Bacteria 4151
60 Ga0068863_100315568 3300005841 Bacteria 1518
61 Ga0068863_100340516 3300005841 Bacteria 1459
62 Ga0068858_100215509 3300005842 Bacteria 1817
63 Ga0068858_100689677 3300005842 Bacteria 993
64 Ga0068858_101099791 3300005842 Bacteria 780
65 Ga0068860_100136255 3300005843 Bacteria 2358
66 Ga0068860_101142457 3300005843 Bacteria 799
67 Ga0081455_11051004 3300005937 Bacteria 503
68 Ga0070717_10337015 3300006028 Bacteria 1346
69 Ga0097621_100667722 3300006237 Bacteria 955
70 Ga0068871_100176333 3300006358 Unclassified 1835
71 Ga0075428_100698960 3300006844 Unclassified 1080
72 Ga0075434_100483385 3300006871 Unclassified 1259
73 Ga0075429_100325942 3300006880 Unclassified 1344
74 Ga0097620_100011281 3300006931 Bacteria 8991
75 Ga0097620_100051171 3300006931 Bacteria 4151
76 Ga0075435_100296540 3300007076 Unclassified 1382
77 Ga0105240_10000649 3300009093 Bacteria 64145
78 Ga0105240_10726563 3300009093 Bacteria 1082
79 Ga0105245_12576171 3300009098 Bacteria 562
80 Ga0105247_10258903 3300009101 Bacteria 1192
81 Ga0114129_10143042 3300009147 Bacteria 3277
82 Ga0105241_10000325 3300009174 Bacteria 36012
83 Ga0105241_10084903 3300009174 Unclassified 2487
84 Ga0105248_10175302 3300009177 Bacteria 2417
85 Ga0105238_10000947 3300009551 Bacteria 29742
86 Ga0105249_10362704 3300009553 Bacteria 1471
87 Ga0105239_10031131 3300010375 Bacteria 5870
88 Ga0157318_1019594 3300012482 Unclassified 590
89 Ga0157371_10089261 3300013102 Bacteria 2183
90 Ga0157371_10139016 3300013102 Bacteria 1730
91 Ga0157369_10386325 3300013105 Unclassified 1453
92 Ga0157374_10846493 3300013296 Bacteria 931
93 Ga0163162_10074398 3300013306 Bacteria 3456
94 Ga0163162_10369084 3300013306 Bacteria 1568
95 Ga0163162_10813661 3300013306 Unclassified 1051
96 Ga0163162_11684493 3300013306 Unclassified 724
97 Ga0157372_10130066 3300013307 Bacteria 2896
98 Ga0157372_10184590 3300013307 Bacteria 2415
99 Ga0157372_11254968 3300013307 Unclassified 856
100 Ga0157375_11514989 3300013308 Bacteria 792
101 Ga0163163_11677008 3300014325 Unclassified 696
102 Ga0157380_10980508 3300014326 Bacteria 877
103 Ga0157379_11187579 3300014968 Viruses 733
104 Ga0157376_10296870 3300014969 Unclassified 1528
105 Ga0163161_10221160 3300017792 Bacteria 1466
106 Ga0163161_10517201 3300017792 Unclassified 974
107 Ga0209673_1000083 3300025273 Bacteria 216509
108 Ga0209564_1002091 3300025295 Bacteria 17103
109 Ga0209564_1010089 3300025295 Bacteria 4399
110 Ga0209758_1061289 3300025297 Bacteria 1240
111 Ga0209050_1000273 3300025298 Bacteria 110451
112 Ga0207426_1000901 3300025302 Bacteria 29917
113 Ga0207426_1021543 3300025302 Bacteria 2228
114 Ga0209051_1135291 3300025303 Unclassified 602
115 Ga0209257_1004484 3300025304 Bacteria 10782
116 Ga0207710_10057290 3300025900 Bacteria 1760
117 Ga0207647_10209723 3300025904 Unclassified 1125
118 Ga0207684_10001890 3300025910 Bacteria 21792
119 Ga0207707_10503126 3300025912 Unclassified 1033
120 Ga0207695_10171020 3300025913 Unclassified 2098
121 Ga0207671_10002410 3300025914 Bacteria 20048
122 Ga0207663_10168875 3300025916 Bacteria 1552
123 Ga0207663_11151631 3300025916 Bacteria 624
124 Ga0207662_10029724 3300025918 Bacteria 3168
125 Ga0207652_10286648 3300025921 Bacteria 1486
126 Ga0207646_10004632 3300025922 Bacteria 14850
127 Ga0207646_10200046 3300025922 Bacteria 1805
128 Ga0207650_10035327 3300025925 Bacteria 3628
129 Ga0207700_10003687 3300025928 Bacteria 8934
130 Ga0207700_11648519 3300025928 Bacteria 567
131 Ga0207664_10641491 3300025929 Unclassified 954
132 Ga0207691_10004233 3300025940 Bacteria 13940
133 Ga0207711_10225731 3300025941 Bacteria 1714
134 Ga0207689_10065184 3300025942 Bacteria 2996
135 Ga0207651_10019809 3300025960 Bacteria 4043
136 Ga0207712_10471314 3300025961 Bacteria 1068
137 Ga0207658_10433531 3300025986 Bacteria 1161
138 Ga0207658_10639795 3300025986 Unclassified 958
139 Ga0207703_10175778 3300026035 Bacteria 1886
140 Ga0207703_10484083 3300026035 Bacteria 1160
141 Ga0207703_11681381 3300026035 Bacteria 610
142 Ga0207639_10035719 3300026041 Unclassified 3679
143 Ga0207708_10271881 3300026075 Bacteria 1371
144 Ga0207641_10011898 3300026088 Bacteria 7138
145 Ga0207676_10198538 3300026095 Bacteria 1771
146 Ga0207698_10257564 3300026142 Unclassified 1601
147 Ga0268265_11405380 3300028380 Unclassified 700
148 Ga0307517_10004043 3300028786 Bacteria 22677
149 Ga0307408_100330678 3300031548 Bacteria 1287
150 Ga0307516_10002446 3300031730 Bacteria 24850
151 Ga0307410_10437337 3300031852 Bacteria 1064
152 Ga0307406_10346721 3300031901 Bacteria 1159
153 Ga0307407_10092997 3300031903 Bacteria 1853
154 Ga0307412_11791952 3300031911 Unclassified 564
155 Ga0307416_100198547 3300032002 Bacteria 1901
156 Ga0307411_10617644 3300032005 Bacteria 934
157 Ga0307415_100312281 3300032126 Bacteria 1307
158 Ga0373945_0201762 3300035116 Bacteria 826
159 Ga0373935_0004610 3300035692 Bacteria 8101
160 Ga0373935_0120908 3300035692 Bacteria 1750
161 Ga0373935_0532709 3300035692 Unclassified 855
162 Ga0373933_0465105 3300035724 Bacteria 828
163 Ga0373947_0120617 3300035725 Bacteria 1665
164 Ga0373947_0562723 3300035725 Unclassified 776
165 Ga0373937_0144213 3300036401 Bacteria 2229
166 Ga0373925_0046328 3300037068 Bacteria 3233
167 Ga0373925_0288490 3300037068 Bacteria 1323
168 Ga0400490_31829 3300038726 Bacteria 2212
169 Ga0400483_000440 3300039062 Bacteria 5179
170 Ga0436363_0016455 3300039450 Bacteria 506
171 Ga0439431_0094115 3300041997 Unclassified 819
172 Ga0466972_0120457 3300044658 Unclassified 1238
173 Ga0466965_0922478 3300044683 Unclassified 510
174 Ga0495580_0005390 3300046472 Bacteria 10583
175 Ga0495582_0025637 3300046473 Bacteria 3230
176 Ga0495582_0065797 3300046473 Bacteria 2003
177 Ga0495645_0863530 3300046543 Unclassified 539
178 Ga0495667_0896067 3300046559 Bacteria 544
179 Ga0495625_0674914 3300046660 Bacteria 613
180 Ga0495599_0391917 3300046678 Bacteria 828
181 Ga0495674_0832700 3300047319 Unclassified 716
182 Ga0495672_0037796 3300047320 Bacteria 2951
183 Ga0495615_0001136 3300048090 Bacteria 3828
184 Ga0496103_0238313 3300048906 Unclassified 1170
185 Ga0496104_1108355 3300048907 Bacteria 695
186 Ga0496106_0406971 3300048909 Bacteria 1093
187 Ga0496112_0613836 3300048915 Unclassified 1019
188 Ga0496112_0915187 3300048915 Unclassified 799
189 Ga0496113_0075810 3300048916 Bacteria 2568
190 Ga0501032_0021567 3300049569 Bacteria 4477
191 Ga0501033_0184041 3300049570 Bacteria 1497
192 Ga0501033_0653901 3300049570 Bacteria 718
193 Ga0501037_0014197 3300049573 Bacteria 5865
194 Ga0501039_0000557 3300049575 Bacteria 26996
195 Ga0501040_0019257 3300049576 Bacteria 4540
196 Ga0501041_0008931 3300049577 Bacteria 5897
197 Ga0501042_0075549 3300049578 Bacteria 2411
198 Ga0501046_0000618 3300049580 Bacteria 34970
199 Ga0501048_0644364 3300049582 Bacteria 761
200 Ga0501083_0900701 3300049744 Unclassified 576
201 Ga0501035_0791635 3300049822 Bacteria 758
202 Ga0501044_1480647 3300049823 Unclassified 544
203 nmdc:mga0k408_734234_c1 3300050493 Unclassified 577
204 nmdc:mga09592_319112_c1 3300050508 Unclassified 1346
205 nmdc:mga0n895_337294_c1 3300050512 Bacteria 1527
206 Ga0495601_0149883 3300053077 Bacteria 1522
207 Ga0495655_0361585 3300053083 Bacteria 510
208 Ga0495595_0506892 3300053084 Bacteria 615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10020099 JGI24739J22299_100200994 116
2 3300003215 JGI25153J46596_10065793 JGI25153J46596_100657932 116
3 3300003316 rootH1_10107772 rootH1_101077722 116
4 3300003320 rootH2_10306058 rootH2_103060582 116
5 3300003322 rootL2_10015285 rootL2_100152854 116
6 3300003354 JGI25160J50197_1008469 JGI25160J50197_10084693 116
7 3300003771 Ga0055526_1008006 Ga0055526_10080062 116
8 3300003790 Ga0055528_1000068 Ga0055528_100006849 116
9 3300003791 Ga0055530_10011359 Ga0055530_100113591 116
10 3300003794 Ga0055531_10088322 Ga0055531_100883221 116
11 3300004625 Ga0055543_1026647 Ga0055543_10266471 116
12 3300005262 Ga0065165_1000017 Ga0065165_100001789 116
13 3300005335 Ga0070666_10091559 Ga0070666_100915592 116
14 3300005335 Ga0070666_10382493 Ga0070666_103824932 116
15 3300005367 Ga0070667_100169420 Ga0070667_1001694202 116
16 3300005367 Ga0070667_100302687 Ga0070667_1003026872 116
17 3300005563 Ga0068855_101589013 Ga0068855_1015890132 116
18 3300005842 Ga0068858_101099791 Ga0068858_1010997912 116
19 3300006358 Ga0068871_100176333 Ga0068871_1001763332 116
20 3300009553 Ga0105249_10362704 Ga0105249_103627043 116
21 3300012482 Ga0157318_1019594 Ga0157318_10195942 116
22 3300013102 Ga0157371_10089261 Ga0157371_100892612 116
23 3300013296 Ga0157374_10846493 Ga0157374_108464931 116
24 3300013306 Ga0163162_10074398 Ga0163162_100743984 116
25 3300014325 Ga0163163_11677008 Ga0163163_116770081 116
26 3300025273 Ga0209673_1000083 Ga0209673_1000083149 116
27 3300025295 Ga0209564_1002091 Ga0209564_100209113 116
28 3300025295 Ga0209564_1010089 Ga0209564_10100897 116
29 3300025297 Ga0209758_1061289 Ga0209758_10612893 116
30 3300025298 Ga0209050_1000273 Ga0209050_100027353 116
31 3300025302 Ga0207426_1000901 Ga0207426_100090117 116
32 3300025302 Ga0207426_1021543 Ga0207426_10215433 116
33 3300025303 Ga0209051_1135291 Ga0209051_11352912 116
34 3300025304 Ga0209257_1004484 Ga0209257_100448413 116
35 3300025961 Ga0207712_10471314 Ga0207712_104713142 116
36 3300025986 Ga0207658_10639795 Ga0207658_106397951 116
37 3300026035 Ga0207703_11681381 Ga0207703_116813811 116
38 3300028786 Ga0307517_10004043 Ga0307517_100040438 116
39 3300041997 Ga0439431_0094115 Ga0439431_0094115_263_613 116
40 3300044658 Ga0466972_0120457 Ga0466972_0120457_498_848 116
41 3300044683 Ga0466965_0922478 Ga0466965_0922478_74_424 116
42 3300046660 Ga0495625_0674914 Ga0495625_0674914_182_532 116
43 3300047319 Ga0495674_0832700 Ga0495674_0832700_198_548 116
44 3300047320 Ga0495672_0037796 Ga0495672_0037796_271_621 116
45 3300048907 Ga0496104_1108355 Ga0496104_1108355_223_573 116
46 3300049570 Ga0501033_0184041 Ga0501033_0184041_630_980 116
47 3300049570 Ga0501033_0653901 Ga0501033_0653901_195_545 116
48 3300049744 Ga0501083_0900701 Ga0501083_0900701_11_370 116
49 3300049822 Ga0501035_0791635 Ga0501035_0791635_360_710 116
50 3300049823 Ga0501044_1480647 Ga0501044_1480647_157_507 116
51 3300050493 nmdc:mga0k408_734234_c1 nmdc:mga0k408_734234_c1_174_524 116
52 iso_pu_bacteria 2902582711 2902585190 116
53 3300005539 Ga0068853_100063698 Ga0068853_1000636981 117
54 3300005616 Ga0068852_100620166 Ga0068852_1006201662 117
55 3300009093 Ga0105240_10000649 Ga0105240_1000064911 117
56 3300009174 Ga0105241_10000325 Ga0105241_1000032510 117
57 3300009551 Ga0105238_10000947 Ga0105238_1000094722 117
58 3300025914 Ga0207671_10002410 Ga0207671_1000241019 117
59 3300026041 Ga0207639_10035719 Ga0207639_100357194 117
60 3300026142 Ga0207698_10257564 Ga0207698_102575642 117
61 3300005336 Ga0070680_100466015 Ga0070680_1004660152 118
62 3300005445 Ga0070708_100007847 Ga0070708_1000078473 118
63 3300005467 Ga0070706_100109422 Ga0070706_1001094222 118
64 3300005468 Ga0070707_100013835 Ga0070707_1000138352 118
65 3300005471 Ga0070698_100003316 Ga0070698_1000033163 118
66 3300005518 Ga0070699_100003159 Ga0070699_1000031595 118
67 3300005530 Ga0070679_100134794 Ga0070679_1001347944 118
68 3300005536 Ga0070697_100001997 Ga0070697_1000019975 118
69 3300005563 Ga0068855_100338508 Ga0068855_1003385082 118
70 3300006028 Ga0070717_10337015 Ga0070717_103370152 118
71 3300006844 Ga0075428_100698960 Ga0075428_1006989602 118
72 3300009093 Ga0105240_10726563 Ga0105240_107265631 118
73 3300013102 Ga0157371_10139016 Ga0157371_101390162 118
74 3300013105 Ga0157369_10386325 Ga0157369_103863251 118
75 3300013306 Ga0163162_10813661 Ga0163162_108136612 118
76 3300013307 Ga0157372_10130066 Ga0157372_101300662 118
77 3300013307 Ga0157372_10184590 Ga0157372_101845902 118
78 3300013307 Ga0157372_11254968 Ga0157372_112549682 118
79 3300025910 Ga0207684_10001890 Ga0207684_100018909 118
80 3300025912 Ga0207707_10503126 Ga0207707_105031261 118
81 3300025913 Ga0207695_10171020 Ga0207695_101710202 118
82 3300025922 Ga0207646_10004632 Ga0207646_100046329 118
83 3300035692 Ga0373935_0004610 Ga0373935_0004610_6765_7121 118
84 3300035725 Ga0373947_0120617 Ga0373947_0120617_1247_1603 118
85 3300038726 Ga0400490_31829 Ga0400490_31829_1210_1572 118
86 3300039062 Ga0400483_000440 Ga0400483_000440_2613_2969 118
87 3300046473 Ga0495582_0025637 Ga0495582_0025637_870_1226 118
88 3300049569 Ga0501032_0021567 Ga0501032_0021567_2592_2948 118
89 3300049573 Ga0501037_0014197 Ga0501037_0014197_601_957 118
90 3300049575 Ga0501039_0000557 Ga0501039_0000557_8497_8853 118
91 3300049576 Ga0501040_0019257 Ga0501040_0019257_4170_4526 118
92 3300049577 Ga0501041_0008931 Ga0501041_0008931_3530_3886 118
93 3300049578 Ga0501042_0075549 Ga0501042_0075549_507_863 118
94 3300049580 Ga0501046_0000618 Ga0501046_0000618_17286_17642 118
95 3300049582 Ga0501048_0644364 Ga0501048_0644364_232_588 118
96 3300053083 Ga0495655_0361585 Ga0495655_0361585_43_399 118
97 3300005289 Ga0065704_10157523 Ga0065704_101575232 119
98 3300005937 Ga0081455_11051004 Ga0081455_110510041 119
99 3300006871 Ga0075434_100483385 Ga0075434_1004833852 119
100 3300007076 Ga0075435_100296540 Ga0075435_1002965403 119
101 3300025928 Ga0207700_11648519 Ga0207700_116485191 119
102 3300031548 Ga0307408_100330678 Ga0307408_1003306782 119
103 3300031852 Ga0307410_10437337 Ga0307410_104373372 119
104 3300031901 Ga0307406_10346721 Ga0307406_103467212 119
105 3300031903 Ga0307407_10092997 Ga0307407_100929972 119
106 3300032126 Ga0307415_100312281 Ga0307415_1003122812 119
107 3300039450 Ga0436363_0016455 Ga0436363_0016455_50_412 119
108 3300050512 nmdc:mga0n895_337294_c1 nmdc:mga0n895_337294_c1_962_1321 119
109 3300005331 Ga0070670_100018852 Ga0070670_1000188528 120
110 3300005366 Ga0070659_101218041 Ga0070659_1012180412 120
111 3300005435 Ga0070714_100799622 Ga0070714_1007996222 120
112 3300005436 Ga0070713_100019424 Ga0070713_1000194243 120
113 3300005535 Ga0070684_101905807 Ga0070684_1019058071 120
114 3300009098 Ga0105245_12576171 Ga0105245_125761712 120
115 3300025916 Ga0207663_10168875 Ga0207663_101688752 120
116 3300025925 Ga0207650_10035327 Ga0207650_100353272 120
117 3300025928 Ga0207700_10003687 Ga0207700_100036875 120
118 3300025929 Ga0207664_10641491 Ga0207664_106414912 120
119 3300031730 Ga0307516_10002446 Ga0307516_1000244620 120
120 3300035116 Ga0373945_0201762 Ga0373945_0201762_301_666 120
121 3300035692 Ga0373935_0120908 Ga0373935_0120908_110_475 120
122 3300035724 Ga0373933_0465105 Ga0373933_0465105_355_720 120
123 3300036401 Ga0373937_0144213 Ga0373937_0144213_280_645 120
124 3300046543 Ga0495645_0863530 Ga0495645_0863530_33_398 120
125 3300048090 Ga0495615_0001136 Ga0495615_0001136_2864_3229 120
126 3300000549 LJQas_1028130 LJQas_10281302 121
127 3300005293 Ga0065715_10121904 Ga0065715_101219042 121
128 3300005293 Ga0065715_10513233 Ga0065715_105132332 121
129 3300005295 Ga0065707_10045127 Ga0065707_100451272 121
130 3300005334 Ga0068869_100083490 Ga0068869_1000834902 121
131 3300005343 Ga0070687_100120130 Ga0070687_1001201303 121
132 3300005367 Ga0070667_100302738 Ga0070667_1003027383 121
133 3300005434 Ga0070709_11680282 Ga0070709_116802821 121
134 3300005439 Ga0070711_101406437 Ga0070711_1014064371 121
135 3300005440 Ga0070705_100429179 Ga0070705_1004291791 121
136 3300005444 Ga0070694_100241404 Ga0070694_1002414043 121
137 3300005444 Ga0070694_100568218 Ga0070694_1005682182 121
138 3300005466 Ga0070685_10334027 Ga0070685_103340271 121
139 3300005468 Ga0070707_100014522 Ga0070707_1000145224 121
140 3300005471 Ga0070698_100065472 Ga0070698_1000654722 121
141 3300005518 Ga0070699_100171861 Ga0070699_1001718614 121
142 3300005530 Ga0070679_100294754 Ga0070679_1002947544 121
143 3300005536 Ga0070697_100137905 Ga0070697_1001379055 121
144 3300005543 Ga0070672_100018294 Ga0070672_1000182944 121
145 3300005545 Ga0070695_100050977 Ga0070695_1000509774 121
146 3300005545 Ga0070695_101276274 Ga0070695_1012762742 121
147 3300005549 Ga0070704_100270339 Ga0070704_1002703393 121
148 3300005615 Ga0070702_100007398 Ga0070702_1000073982 121
149 3300005617 Ga0068859_100011283 Ga0068859_1000112839 121
150 3300005617 Ga0068859_100051169 Ga0068859_1000511691 121
151 3300005841 Ga0068863_100315568 Ga0068863_1003155683 121
152 3300005841 Ga0068863_100340516 Ga0068863_1003405162 121
153 3300005842 Ga0068858_100215509 Ga0068858_1002155094 121
154 3300005842 Ga0068858_100689677 Ga0068858_1006896772 121
155 3300005843 Ga0068860_100136255 Ga0068860_1001362552 121
156 3300005843 Ga0068860_101142457 Ga0068860_1011424572 121
157 3300006237 Ga0097621_100667722 Ga0097621_1006677222 121
158 3300006880 Ga0075429_100325942 Ga0075429_1003259422 121
159 3300006931 Ga0097620_100011281 Ga0097620_1000112813 121
160 3300006931 Ga0097620_100051171 Ga0097620_1000511713 121
161 3300009101 Ga0105247_10258903 Ga0105247_102589033 121
162 3300009147 Ga0114129_10143042 Ga0114129_101430425 121
163 3300009174 Ga0105241_10084903 Ga0105241_100849034 121
164 3300009177 Ga0105248_10175302 Ga0105248_101753022 121
165 3300010375 Ga0105239_10031131 Ga0105239_100311312 121
166 3300013306 Ga0163162_10369084 Ga0163162_103690842 121
167 3300013306 Ga0163162_11684493 Ga0163162_116844931 121
168 3300013308 Ga0157375_11514989 Ga0157375_115149892 121
169 3300014326 Ga0157380_10980508 Ga0157380_109805082 121
170 3300014968 Ga0157379_11187579 Ga0157379_111875792 121
171 3300014969 Ga0157376_10296870 Ga0157376_102968703 121
172 3300017792 Ga0163161_10221160 Ga0163161_102211601 121
173 3300017792 Ga0163161_10517201 Ga0163161_105172012 121
174 3300025900 Ga0207710_10057290 Ga0207710_100572902 121
175 3300025904 Ga0207647_10209723 Ga0207647_102097232 121
176 3300025916 Ga0207663_11151631 Ga0207663_111516311 121
177 3300025918 Ga0207662_10029724 Ga0207662_100297244 121
178 3300025921 Ga0207652_10286648 Ga0207652_102866481 121
179 3300025922 Ga0207646_10200046 Ga0207646_102000462 121
180 3300025940 Ga0207691_10004233 Ga0207691_1000423311 121
181 3300025941 Ga0207711_10225731 Ga0207711_102257312 121
182 3300025942 Ga0207689_10065184 Ga0207689_100651842 121
183 3300025960 Ga0207651_10019809 Ga0207651_100198096 121
184 3300025986 Ga0207658_10433531 Ga0207658_104335311 121
185 3300026035 Ga0207703_10175778 Ga0207703_101757782 121
186 3300026035 Ga0207703_10484083 Ga0207703_104840832 121
187 3300026075 Ga0207708_10271881 Ga0207708_102718812 121
188 3300026088 Ga0207641_10011898 Ga0207641_100118982 121
189 3300026095 Ga0207676_10198538 Ga0207676_101985382 121
190 3300028380 Ga0268265_11405380 Ga0268265_114053802 121
191 3300031911 Ga0307412_11791952 Ga0307412_117919521 121
192 3300032002 Ga0307416_100198547 Ga0307416_1001985473 121
193 3300032005 Ga0307411_10617644 Ga0307411_106176442 121
194 3300035692 Ga0373935_0532709 Ga0373935_0532709_464_829 121
195 3300035725 Ga0373947_0562723 Ga0373947_0562723_199_564 121
196 3300037068 Ga0373925_0046328 Ga0373925_0046328_1503_1868 121
197 3300037068 Ga0373925_0288490 Ga0373925_0288490_560_928 121
198 3300046472 Ga0495580_0005390 Ga0495580_0005390_3126_3491 121
199 3300046473 Ga0495582_0065797 Ga0495582_0065797_1350_1715 121
200 3300046559 Ga0495667_0896067 Ga0495667_0896067_37_405 121
201 3300046678 Ga0495599_0391917 Ga0495599_0391917_197_565 121
202 3300048906 Ga0496103_0238313 Ga0496103_0238313_484_849 121
203 3300048909 Ga0496106_0406971 Ga0496106_0406971_667_1032 121
204 3300048915 Ga0496112_0613836 Ga0496112_0613836_333_698 121
205 3300048915 Ga0496112_0915187 Ga0496112_0915187_63_428 121
206 3300048916 Ga0496113_0075810 Ga0496113_0075810_696_1061 121
207 3300050508 nmdc:mga09592_319112_c1 nmdc:mga09592_319112_c1_188_553 121
208 3300053077 Ga0495601_0149883 Ga0495601_0149883_311_679 121
209 3300053084 Ga0495595_0506892 Ga0495595_0506892_121_489 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04965

GPW_gp25

Baseplate wedge protein gp25

41

131

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j7m-assembly1.cif.gz_M complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.8666 83 115
2ia7-assembly1.cif.gz_A crystal structure of putative tail lysozyme (np_952040.1) from geobacter sulfurreducens at 1.44 a resolution 0.8647 14 117
1bkb-assembly1.cif.gz_A initiation factor 5a from archebacterium pyrobaculum aerophilum 0.8598 81 114
6j7m-assembly2.cif.gz_N complex structure of the pseudomonas aeruginosa rhamnosyltransferase earp with the acceptor elongation factor ef-p 0.8321 83 117
3oyy-assembly2.cif.gz_B structure of pseudomonas aeruginosa elongation factor p 0.8316 81 118
ID Description Score Start End Superfamily
af_P06864_732_1002_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9106 81 103 2.70.98.10
af_A0A0P0V197_32_95_3.10.450.700 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.891 80 119 3.10.450.700
af_A0A1D6L8D5_102_153_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8805 81 115 2.30.30.30
1bkbA01 Mainly Beta;Roll;SH3 type barrels.; 0.8598 81 114 2.30.30.30
af_Q9NEW7_1_162_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8588 83 120 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1P8YPY5-F1-model_v4 Lysozyme family protein 0.9676 21 116
AF-A0A0C2D3V1-F1-model_v4 Uncharacterized protein 0.949 69 117
AF-A0A7V4G7W4-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9265 23 121
AF-A0A075MN45-F1-model_v4 Phage baseplate assembly protein W 0.9252 5 117
AF-A4YW46-F1-model_v4 IraD/Gp25-like domain-containing protein 0.9139 5 117

Feature Viewer

pLDDT pTM Quality
83.46 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map