F318842

General Info

Members Datasets Scaffolds Average Seq Length
209 97 209 117

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100765813|Ga0070684_1007658132
Length 119
Sequence MGKRGRARGRVEKLSAPESEYVSPPGDVLVLRGALTAKTRRQYHEVLHGNVLSRDDAWQRASELLFERLAVRWVVAGVPTEGQRELLMRLRVATQDERRWIRDVLREHLAEHFPDVEAP

Samples

Sample ID Description Type Environment
1 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
10 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
11 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
14 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
15 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
16 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
17 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
18 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
29 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
30 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
31 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
32 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
33 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
34 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
35 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
36 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
37 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
38 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
39 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
40 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
41 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
42 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
43 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
44 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
45 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
46 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
47 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
48 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
49 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
50 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
51 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
52 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
53 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
54 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
57 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
58 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
59 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
64 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
65 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
66 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
67 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
68 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
69 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
75 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
76 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
82 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
85 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
86 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
93 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
94 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
95 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
96 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
97 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.57
Rhizosphere 70.81
Stem 0
Stem Tuber 0
Unclassified 19.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070688_100601462 3300005365 Bacteria 842
2 Ga0070709_10563922 3300005434 Unclassified 873
3 Ga0070714_100078416 3300005435 Unclassified 2871
4 Ga0070714_100190065 3300005435 Bacteria 1873
5 Ga0070714_100685128 3300005435 Bacteria 988
6 Ga0070713_100050642 3300005436 Bacteria 3431
7 Ga0070713_100158237 3300005436 Unclassified 2020
8 Ga0070713_100334304 3300005436 Bacteria 1402
9 Ga0070713_100547758 3300005436 Bacteria 1095
10 Ga0070713_102105507 3300005436 Unclassified 547
11 Ga0070713_102284297 3300005436 Bacteria 524
12 Ga0070710_10018622 3300005437 Bacteria 3575
13 Ga0070710_10942484 3300005437 Bacteria 626
14 Ga0070710_11459440 3300005437 Bacteria 513
15 Ga0070711_100043310 3300005439 Bacteria 3048
16 Ga0070711_100353507 3300005439 Bacteria 1182
17 Ga0070711_101929234 3300005439 Unclassified 519
18 Ga0070684_100765813 3300005535 Bacteria 901
19 Ga0068856_100051646 3300005614 Bacteria 4053
20 Ga0070717_10104785 3300006028 Unclassified 2406
21 Ga0070717_10115357 3300006028 Bacteria 2295
22 Ga0070717_11271334 3300006028 Bacteria 669
23 Ga0070716_100332188 3300006173 Bacteria 1069
24 Ga0070712_100006853 3300006175 Bacteria 7098
25 Ga0070712_100422310 3300006175 Bacteria 1105
26 Ga0070712_100560433 3300006175 Bacteria 964
27 Ga0105245_10171774 3300009098 Bacteria 2065
28 Ga0157372_10338276 3300013307 Bacteria 1753
29 Ga0213873_10066346 3300021358 Bacteria 987
30 Ga0213873_10084997 3300021358 Bacteria 891
31 Ga0213873_10271262 3300021358 Unclassified 542
32 Ga0213874_10003572 3300021377 Bacteria 3465
33 Ga0213874_10004007 3300021377 Bacteria 3319
34 Ga0213874_10059148 3300021377 Bacteria 1196
35 Ga0213874_10063162 3300021377 Unclassified 1165
36 Ga0213874_10092840 3300021377 Bacteria 993
37 Ga0213876_10001949 3300021384 Bacteria 12358
38 Ga0213876_10010213 3300021384 Bacteria 5042
39 Ga0213876_10066285 3300021384 Bacteria 1906
40 Ga0213875_10009076 3300021388 Bacteria 5053
41 Ga0213875_10016670 3300021388 Bacteria 3560
42 Ga0213875_10035046 3300021388 Bacteria 2369
43 Ga0213875_10044840 3300021388 Bacteria 2076
44 Ga0213875_10284859 3300021388 Unclassified 780
45 Ga0213875_10521817 3300021388 Bacteria 571
46 Ga0207692_10519353 3300025898 Bacteria 758
47 Ga0207654_11103540 3300025911 Bacteria 578
48 Ga0207693_10318772 3300025915 Bacteria 1217
49 Ga0207693_10421694 3300025915 Bacteria 1043
50 Ga0207663_10031688 3300025916 Bacteria 3131
51 Ga0207700_10031887 3300025928 Bacteria 3750
52 Ga0207700_10163387 3300025928 Unclassified 1851
53 Ga0207664_11309426 3300025929 Bacteria 644
54 Ga0207665_10036404 3300025939 Bacteria 3273
55 Ga0207667_11699477 3300025949 Bacteria 598
56 Ga0207702_10127944 3300026078 Bacteria 2283
57 Ga0207702_10750463 3300026078 Bacteria 963
58 Ga0268266_11372862 3300028379 Bacteria 682
59 Ga0265322_10093011 3300028654 Unclassified 857
60 Ga0265336_10047913 3300028666 Unclassified 1297
61 Ga0265327_10007233 3300031251 Bacteria 8618
62 Ga0373953_0225349 3300035117 Bacteria 812
63 Ga0373943_0649039 3300035170 Bacteria 624
64 Ga0373924_0275048 3300035410 Bacteria 747
65 Ga0373935_0381747 3300035692 Bacteria 1009
66 Ga0373933_0222860 3300035724 Bacteria 1210
67 Ga0373937_0004983 3300036401 Bacteria 11294
68 Ga0373925_1301565 3300037068 Bacteria 596
69 Ga0436364_0011569 3300037853 Bacteria 10709
70 Ga0436364_0147722 3300037853 Bacteria 3493
71 Ga0436364_0156518 3300037853 Bacteria 553
72 Ga0436364_0412200 3300037853 Bacteria 5749
73 Ga0436364_0672888 3300037853 Bacteria 4473
74 Ga0436364_0951400 3300037853 Bacteria 3499
75 Ga0436364_1125502 3300037853 Unclassified 815
76 Ga0436364_1289024 3300037853 Bacteria 3470
77 Ga0436364_1290605 3300037853 Bacteria 5721
78 Ga0436365_0173957 3300039437 Bacteria 1396
79 Ga0436365_0201958 3300039437 Bacteria 19219
80 Ga0436365_0518878 3300039437 Bacteria 4434
81 Ga0436365_0679055 3300039437 Bacteria 7776
82 Ga0436365_0856735 3300039437 Bacteria 10107
83 Ga0436365_0976849 3300039437 Bacteria 3611
84 Ga0436365_1292628 3300039437 Bacteria 10027
85 Ga0436365_1618021 3300039437 Bacteria 6536
86 Ga0436365_1675662 3300039437 Bacteria 1131
87 Ga0436360_0453833 3300039438 Bacteria 735
88 Ga0436363_0760459 3300039450 Bacteria 34430
89 Ga0436363_0855292 3300039450 Bacteria 8292
90 Ga0436363_0923908 3300039450 Bacteria 763
91 Ga0436363_0933593 3300039450 Bacteria 1253
92 Ga0436363_1073174 3300039450 Bacteria 2034
93 Ga0436363_1190451 3300039450 Bacteria 1237
94 Ga0436363_1366250 3300039450 Bacteria 4462
95 Ga0436363_1592290 3300039450 Unclassified 625
96 Ga0436362_0257686 3300039453 Bacteria 1140
97 Ga0436362_0296550 3300039453 Unclassified 1086
98 Ga0436362_0581028 3300039453 Bacteria 3666
99 Ga0436362_0665219 3300039453 Bacteria 1021
100 Ga0451793_1153749 3300041452 Bacteria 801
101 Ga0451839_0160762 3300041496 Bacteria 622
102 Ga0466969_0004040 3300044656 Bacteria 7778
103 Ga0466969_0141474 3300044656 Bacteria 1112
104 Ga0466965_0838679 3300044683 Unclassified 534
105 Ga0466966_0499814 3300044684 Unclassified 731
106 Ga0466966_0861172 3300044684 Bacteria 546
107 Ga0466961_0003860 3300044693 Bacteria 9364
108 Ga0466961_0010602 3300044693 Bacteria 5880
109 Ga0466961_0132227 3300044693 Bacteria 1564
110 Ga0466961_0373683 3300044693 Unclassified 866
111 Ga0466963_0024525 3300044694 Bacteria 3840
112 Ga0466963_0050750 3300044694 Bacteria 2746
113 Ga0466963_0127868 3300044694 Bacteria 1753
114 Ga0466963_0361899 3300044694 Bacteria 1022
115 Ga0466963_0364601 3300044694 Bacteria 1018
116 Ga0466963_0435936 3300044694 Bacteria 924
117 Ga0466963_0680714 3300044694 Bacteria 726
118 Ga0466963_0834342 3300044694 Bacteria 650
119 Ga0466964_0193176 3300044706 Bacteria 973
120 Ga0466964_0618646 3300044706 Unclassified 596
121 Ga0466971_0000736 3300044719 Bacteria 13117
122 Ga0466971_0097176 3300044719 Bacteria 1351
123 Ga0466971_0420926 3300044719 Unclassified 653
124 Ga0466968_0012214 3300044735 Bacteria 3356
125 Ga0466968_0114566 3300044735 Bacteria 1215
126 Ga0466968_0168977 3300044735 Bacteria 1013
127 Ga0466968_0204083 3300044735 Bacteria 927
128 Ga0466968_0446444 3300044735 Bacteria 639
129 Ga0466970_0081922 3300044765 Bacteria 1745
130 Ga0466957_0015679 3300044842 Bacteria 4427
131 Ga0466957_0030206 3300044842 Bacteria 3235
132 Ga0466957_0054818 3300044842 Bacteria 2435
133 Ga0466957_0433856 3300044842 Unclassified 903
134 Ga0466960_0106199 3300044901 Bacteria 1452
135 Ga0466959_0006717 3300045049 Bacteria 8007
136 Ga0466959_0027981 3300045049 Bacteria 4180
137 Ga0466959_0050499 3300045049 Bacteria 3053
138 Ga0466959_0119396 3300045049 Bacteria 1876
139 Ga0466959_0185978 3300045049 Bacteria 1451
140 Ga0466959_0363347 3300045049 Unclassified 986
141 Ga0466959_0382786 3300045049 Bacteria 957
142 Ga0466959_1124912 3300045049 Unclassified 522
143 Ga0466959_1160100 3300045049 Bacteria 513
144 Ga0466958_0006590 3300045836 Bacteria 6329
145 Ga0466958_0043996 3300045836 Bacteria 2690
146 Ga0466958_0058017 3300045836 Bacteria 2353
147 Ga0466958_0082007 3300045836 Bacteria 1986
148 Ga0466958_0163251 3300045836 Bacteria 1408
149 Ga0466958_0208433 3300045836 Unclassified 1245
150 Ga0466958_0474374 3300045836 Unclassified 811
151 Ga0466967_0053019 3300045976 Bacteria 3564
152 Ga0466967_0202153 3300045976 Bacteria 1882
153 Ga0466967_0296091 3300045976 Bacteria 1556
154 Ga0466967_0298385 3300045976 Unclassified 1550
155 Ga0466967_1112592 3300045976 Unclassified 787
156 Ga0495592_0126728 3300046454 Unclassified 1790
157 Ga0495629_0161536 3300046459 Unclassified 1556
158 Ga0495651_0002925 3300046462 Bacteria 13218
159 Ga0495653_0044922 3300046463 Bacteria 3427
160 Ga0495582_0040507 3300046473 Bacteria 2566
161 Ga0495662_0177535 3300046476 Bacteria 1050
162 Ga0495664_0194040 3300046477 Bacteria 1231
163 Ga0495584_0225840 3300046491 Bacteria 952
164 Ga0495608_0035378 3300046511 Bacteria 3368
165 Ga0495618_0156068 3300046514 Bacteria 1456
166 Ga0495628_0055642 3300046516 Unclassified 3116
167 Ga0495630_0575329 3300046517 Bacteria 864
168 Ga0495640_0017617 3300046533 Bacteria 5318
169 Ga0495587_0007123 3300046536 Bacteria 7256
170 Ga0495587_0404384 3300046536 Unclassified 759
171 Ga0495587_0452106 3300046536 Bacteria 712
172 Ga0495667_0031454 3300046559 Bacteria 3563
173 Ga0495634_0146406 3300046642 Bacteria 1496
174 Ga0495646_0025756 3300046680 Bacteria 3698
175 Ga0495613_0040019 3300046689 Unclassified 3474
176 Ga0495600_0011831 3300046809 Bacteria 5449
177 Ga0495600_0693513 3300046809 Unclassified 613
178 Ga0495604_0002901 3300047317 Bacteria 13743
179 Ga0495674_0015385 3300047319 Bacteria 7154
180 Ga0495680_0096381 3300047322 Unclassified 2209
181 Ga0495675_0069062 3300047444 Unclassified 2232
182 Ga0495684_0035139 3300047471 Bacteria 3845
183 Ga0495602_0022806 3300048088 Bacteria 6119
184 Ga0496102_0037467 3300048905 Bacteria 4374
185 Ga0496104_0019691 3300048907 Bacteria 6179
186 Ga0496104_0024884 3300048907 Bacteria 5513
187 Ga0496105_0004806 3300048908 Bacteria 10207
188 Ga0496105_0926232 3300048908 Bacteria 655
189 Ga0496105_1424001 3300048908 Bacteria 501
190 Ga0496106_0286434 3300048909 Bacteria 1320
191 Ga0496108_0007291 3300048911 Bacteria 8965
192 Ga0496109_0014329 3300048912 Bacteria 6898
193 Ga0496110_0014230 3300048913 Bacteria 6601
194 Ga0496110_1079321 3300048913 Bacteria 711
195 Ga0496111_0008845 3300048914 Bacteria 6690
196 Ga0496111_0038168 3300048914 Bacteria 3440
197 Ga0496112_0022937 3300048915 Bacteria 5956
198 Ga0496112_0807736 3300048915 Bacteria 862
199 Ga0496112_0916043 3300048915 Unclassified 798
200 Ga0496113_0002326 3300048916 Bacteria 10984
201 Ga0496113_0015601 3300048916 Bacteria 5229
202 Ga0496113_0274031 3300048916 Bacteria 1349
203 Ga0495601_0608715 3300053077 Unclassified 701
204 Ga0495595_0019471 3300053084 Bacteria 2944
205 Ga0495619_0027550 3300053085 Bacteria 3660
206 Ga0466962_0025224 3300061719 Bacteria 2854
207 Ga0466962_0036594 3300061719 Bacteria 2349
208 Ga0466962_0047300 3300061719 Bacteria 2056
209 Ga0466962_0116989 3300061719 Unclassified 1285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039453 Ga0436362_0257686 Ga0436362_0257686_181_594 107
2 3300044842 Ga0466957_0433856 Ga0466957_0433856_363_719 109
3 3300045836 Ga0466958_0082007 Ga0466958_0082007_1075_1431 109
4 3300035170 Ga0373943_0649039 Ga0373943_0649039_234_593 112
5 3300046473 Ga0495582_0040507 Ga0495582_0040507_647_1006 112
6 3300046491 Ga0495584_0225840 Ga0495584_0225840_335_694 112
7 3300021377 Ga0213874_10004007 Ga0213874_100040074 113
8 3300021377 Ga0213874_10063162 Ga0213874_100631622 113
9 3300021384 Ga0213876_10010213 Ga0213876_100102132 113
10 3300021388 Ga0213875_10009076 Ga0213875_100090762 113
11 3300037853 Ga0436364_0011569 Ga0436364_0011569_5992_6333 113
12 3300037853 Ga0436364_0147722 Ga0436364_0147722_1928_2269 113
13 3300039437 Ga0436365_0679055 Ga0436365_0679055_1233_1574 113
14 3300039437 Ga0436365_0856735 Ga0436365_0856735_7859_8200 113
15 3300039438 Ga0436360_0453833 Ga0436360_0453833_257_598 113
16 3300039450 Ga0436363_0855292 Ga0436363_0855292_5191_5532 113
17 3300039450 Ga0436363_1073174 Ga0436363_1073174_843_1184 113
18 3300039450 Ga0436363_1190451 Ga0436363_1190451_677_1018 113
19 3300039450 Ga0436363_1366250 Ga0436363_1366250_3717_4058 113
20 3300039453 Ga0436362_0296550 Ga0436362_0296550_529_870 113
21 3300005435 Ga0070714_100078416 Ga0070714_1000784162 115
22 3300005435 Ga0070714_100190065 Ga0070714_1001900652 115
23 3300005436 Ga0070713_100547758 Ga0070713_1005477582 115
24 3300005436 Ga0070713_102105507 Ga0070713_1021055071 115
25 3300005436 Ga0070713_102284297 Ga0070713_1022842971 115
26 3300005437 Ga0070710_11459440 Ga0070710_114594401 115
27 3300005439 Ga0070711_101929234 Ga0070711_1019292341 115
28 3300006028 Ga0070717_11271334 Ga0070717_112713342 115
29 3300006173 Ga0070716_100332188 Ga0070716_1003321882 115
30 3300006175 Ga0070712_100422310 Ga0070712_1004223102 115
31 3300021358 Ga0213873_10084997 Ga0213873_100849972 115
32 3300021358 Ga0213873_10271262 Ga0213873_102712622 115
33 3300021377 Ga0213874_10003572 Ga0213874_100035722 115
34 3300021377 Ga0213874_10059148 Ga0213874_100591482 115
35 3300021377 Ga0213874_10092840 Ga0213874_100928402 115
36 3300021384 Ga0213876_10001949 Ga0213876_1000194912 115
37 3300021384 Ga0213876_10066285 Ga0213876_100662852 115
38 3300021388 Ga0213875_10016670 Ga0213875_100166702 115
39 3300021388 Ga0213875_10035046 Ga0213875_100350463 115
40 3300021388 Ga0213875_10044840 Ga0213875_100448403 115
41 3300021388 Ga0213875_10284859 Ga0213875_102848592 115
42 3300021388 Ga0213875_10521817 Ga0213875_105218172 115
43 3300025915 Ga0207693_10318772 Ga0207693_103187722 115
44 3300037853 Ga0436364_0156518 Ga0436364_0156518_132_479 115
45 3300037853 Ga0436364_0412200 Ga0436364_0412200_40_387 115
46 3300037853 Ga0436364_0672888 Ga0436364_0672888_388_735 115
47 3300037853 Ga0436364_1125502 Ga0436364_1125502_245_595 115
48 3300037853 Ga0436364_1289024 Ga0436364_1289024_788_1135 115
49 3300037853 Ga0436364_1290605 Ga0436364_1290605_2069_2419 115
50 3300039437 Ga0436365_0173957 Ga0436365_0173957_618_965 115
51 3300039437 Ga0436365_0201958 Ga0436365_0201958_8855_9202 115
52 3300039437 Ga0436365_0518878 Ga0436365_0518878_1730_2077 115
53 3300039437 Ga0436365_0976849 Ga0436365_0976849_452_802 115
54 3300039437 Ga0436365_1292628 Ga0436365_1292628_1933_2283 115
55 3300039437 Ga0436365_1618021 Ga0436365_1618021_364_735 115
56 3300039450 Ga0436363_0760459 Ga0436363_0760459_30622_30993 115
57 3300039450 Ga0436363_0923908 Ga0436363_0923908_324_674 115
58 3300039450 Ga0436363_0933593 Ga0436363_0933593_136_483 115
59 3300039450 Ga0436363_1592290 Ga0436363_1592290_245_592 115
60 3300039453 Ga0436362_0581028 Ga0436362_0581028_2196_2543 115
61 3300039453 Ga0436362_0665219 Ga0436362_0665219_276_626 115
62 3300044683 Ga0466965_0838679 Ga0466965_0838679_52_399 115
63 3300044684 Ga0466966_0499814 Ga0466966_0499814_164_511 115
64 3300044684 Ga0466966_0861172 Ga0466966_0861172_177_524 115
65 3300044693 Ga0466961_0003860 Ga0466961_0003860_5603_5950 115
66 3300044694 Ga0466963_0024525 Ga0466963_0024525_2027_2374 115
67 3300044694 Ga0466963_0050750 Ga0466963_0050750_1593_1940 115
68 3300044694 Ga0466963_0127868 Ga0466963_0127868_294_650 115
69 3300044694 Ga0466963_0364601 Ga0466963_0364601_452_799 115
70 3300044694 Ga0466963_0435936 Ga0466963_0435936_409_756 115
71 3300044694 Ga0466963_0680714 Ga0466963_0680714_110_457 115
72 3300044694 Ga0466963_0834342 Ga0466963_0834342_74_421 115
73 3300044706 Ga0466964_0193176 Ga0466964_0193176_385_732 115
74 3300044706 Ga0466964_0618646 Ga0466964_0618646_218_565 115
75 3300044719 Ga0466971_0000736 Ga0466971_0000736_3221_3568 115
76 3300044719 Ga0466971_0097176 Ga0466971_0097176_213_560 115
77 3300044735 Ga0466968_0168977 Ga0466968_0168977_495_842 115
78 3300044735 Ga0466968_0204083 Ga0466968_0204083_182_529 115
79 3300044765 Ga0466970_0081922 Ga0466970_0081922_1283_1630 115
80 3300044842 Ga0466957_0015679 Ga0466957_0015679_2394_2741 115
81 3300044842 Ga0466957_0030206 Ga0466957_0030206_1767_2114 115
82 3300044842 Ga0466957_0054818 Ga0466957_0054818_1918_2265 115
83 3300045049 Ga0466959_0027981 Ga0466959_0027981_561_908 115
84 3300045049 Ga0466959_0382786 Ga0466959_0382786_291_638 115
85 3300045049 Ga0466959_1160100 Ga0466959_1160100_113_469 115
86 3300045836 Ga0466958_0006590 Ga0466958_0006590_3366_3713 115
87 3300045836 Ga0466958_0043996 Ga0466958_0043996_2282_2629 115
88 3300045836 Ga0466958_0058017 Ga0466958_0058017_128_475 115
89 3300045836 Ga0466958_0163251 Ga0466958_0163251_920_1267 115
90 3300045976 Ga0466967_0053019 Ga0466967_0053019_675_1025 115
91 3300045976 Ga0466967_0202153 Ga0466967_0202153_1509_1856 115
92 3300045976 Ga0466967_0296091 Ga0466967_0296091_159_506 115
93 3300045976 Ga0466967_1112592 Ga0466967_1112592_163_510 115
94 3300046809 Ga0495600_0693513 Ga0495600_0693513_69_416 115
95 3300053077 Ga0495601_0608715 Ga0495601_0608715_52_399 115
96 3300061719 Ga0466962_0025224 Ga0466962_0025224_1369_1716 115
97 3300061719 Ga0466962_0036594 Ga0466962_0036594_880_1227 115
98 3300061719 Ga0466962_0116989 Ga0466962_0116989_369_716 115
99 3300005437 Ga0070710_10942484 Ga0070710_109424841 116
100 3300044735 Ga0466968_0114566 Ga0466968_0114566_137_487 116
101 3300044735 Ga0466968_0446444 Ga0466968_0446444_133_483 116
102 3300045049 Ga0466959_0185978 Ga0466959_0185978_133_483 116
103 3300045976 Ga0466967_0298385 Ga0466967_0298385_683_1033 116
104 3300046536 Ga0495587_0404384 Ga0495587_0404384_256_606 116
105 3300061719 Ga0466962_0047300 Ga0466962_0047300_359_709 116
106 3300044656 Ga0466969_0141474 Ga0466969_0141474_452_805 117
107 3300044693 Ga0466961_0010602 Ga0466961_0010602_2447_2800 117
108 3300044694 Ga0466963_0361899 Ga0466963_0361899_154_507 117
109 3300045049 Ga0466959_0006717 Ga0466959_0006717_6817_7170 117
110 3300005434 Ga0070709_10563922 Ga0070709_105639222 118
111 3300005435 Ga0070714_100685128 Ga0070714_1006851281 118
112 3300005436 Ga0070713_100050642 Ga0070713_1000506423 118
113 3300005436 Ga0070713_100158237 Ga0070713_1001582372 118
114 3300005436 Ga0070713_100334304 Ga0070713_1003343042 118
115 3300005437 Ga0070710_10018622 Ga0070710_100186224 118
116 3300005439 Ga0070711_100043310 Ga0070711_1000433103 118
117 3300005439 Ga0070711_100353507 Ga0070711_1003535072 118
118 3300006028 Ga0070717_10104785 Ga0070717_101047852 118
119 3300006028 Ga0070717_10115357 Ga0070717_101153572 118
120 3300006175 Ga0070712_100006853 Ga0070712_1000068538 118
121 3300006175 Ga0070712_100560433 Ga0070712_1005604332 118
122 3300021358 Ga0213873_10066346 Ga0213873_100663461 118
123 3300025898 Ga0207692_10519353 Ga0207692_105193532 118
124 3300025915 Ga0207693_10421694 Ga0207693_104216942 118
125 3300025916 Ga0207663_10031688 Ga0207663_100316883 118
126 3300025928 Ga0207700_10031887 Ga0207700_100318873 118
127 3300025928 Ga0207700_10163387 Ga0207700_101633872 118
128 3300025929 Ga0207664_11309426 Ga0207664_113094262 118
129 3300025939 Ga0207665_10036404 Ga0207665_100364043 118
130 3300026078 Ga0207702_10750463 Ga0207702_107504632 118
131 3300035117 Ga0373953_0225349 Ga0373953_0225349_296_652 118
132 3300035410 Ga0373924_0275048 Ga0373924_0275048_202_558 118
133 3300035692 Ga0373935_0381747 Ga0373935_0381747_590_946 118
134 3300035724 Ga0373933_0222860 Ga0373933_0222860_694_1050 118
135 3300036401 Ga0373937_0004983 Ga0373937_0004983_4946_5302 118
136 3300037068 Ga0373925_1301565 Ga0373925_1301565_121_477 118
137 3300037853 Ga0436364_0951400 Ga0436364_0951400_909_1271 118
138 3300039437 Ga0436365_1675662 Ga0436365_1675662_573_941 118
139 3300041496 Ga0451839_0160762 Ga0451839_0160762_26_388 118
140 3300044656 Ga0466969_0004040 Ga0466969_0004040_6554_6934 118
141 3300044693 Ga0466961_0132227 Ga0466961_0132227_472_828 118
142 3300044693 Ga0466961_0373683 Ga0466961_0373683_247_609 118
143 3300044719 Ga0466971_0420926 Ga0466971_0420926_35_394 118
144 3300045049 Ga0466959_0050499 Ga0466959_0050499_1714_2073 118
145 3300045049 Ga0466959_0119396 Ga0466959_0119396_337_693 118
146 3300045049 Ga0466959_0363347 Ga0466959_0363347_576_935 118
147 3300045049 Ga0466959_1124912 Ga0466959_1124912_102_464 118
148 3300045836 Ga0466958_0208433 Ga0466958_0208433_365_724 118
149 3300045836 Ga0466958_0474374 Ga0466958_0474374_144_500 118
150 3300046454 Ga0495592_0126728 Ga0495592_0126728_1020_1376 118
151 3300046459 Ga0495629_0161536 Ga0495629_0161536_1085_1441 118
152 3300046462 Ga0495651_0002925 Ga0495651_0002925_11604_11960 118
153 3300046463 Ga0495653_0044922 Ga0495653_0044922_810_1166 118
154 3300046476 Ga0495662_0177535 Ga0495662_0177535_106_462 118
155 3300046477 Ga0495664_0194040 Ga0495664_0194040_429_785 118
156 3300046511 Ga0495608_0035378 Ga0495608_0035378_2553_2909 118
157 3300046514 Ga0495618_0156068 Ga0495618_0156068_929_1285 118
158 3300046516 Ga0495628_0055642 Ga0495628_0055642_593_949 118
159 3300046517 Ga0495630_0575329 Ga0495630_0575329_262_618 118
160 3300046533 Ga0495640_0017617 Ga0495640_0017617_3002_3358 118
161 3300046536 Ga0495587_0007123 Ga0495587_0007123_3246_3602 118
162 3300046536 Ga0495587_0452106 Ga0495587_0452106_249_605 118
163 3300046559 Ga0495667_0031454 Ga0495667_0031454_2376_2732 118
164 3300046642 Ga0495634_0146406 Ga0495634_0146406_926_1282 118
165 3300046680 Ga0495646_0025756 Ga0495646_0025756_3074_3430 118
166 3300046689 Ga0495613_0040019 Ga0495613_0040019_1025_1381 118
167 3300046809 Ga0495600_0011831 Ga0495600_0011831_593_949 118
168 3300047317 Ga0495604_0002901 Ga0495604_0002901_5396_5752 118
169 3300047319 Ga0495674_0015385 Ga0495674_0015385_6142_6498 118
170 3300047322 Ga0495680_0096381 Ga0495680_0096381_1805_2161 118
171 3300047444 Ga0495675_0069062 Ga0495675_0069062_822_1178 118
172 3300047471 Ga0495684_0035139 Ga0495684_0035139_3442_3798 118
173 3300048088 Ga0495602_0022806 Ga0495602_0022806_2168_2524 118
174 3300048907 Ga0496104_0019691 Ga0496104_0019691_505_861 118
175 3300048908 Ga0496105_0926232 Ga0496105_0926232_33_389 118
176 3300048908 Ga0496105_1424001 Ga0496105_1424001_53_409 118
177 3300048913 Ga0496110_1079321 Ga0496110_1079321_319_675 118
178 3300048915 Ga0496112_0022937 Ga0496112_0022937_2299_2655 118
179 3300048915 Ga0496112_0916043 Ga0496112_0916043_45_401 118
180 3300048916 Ga0496113_0002326 Ga0496113_0002326_10564_10920 118
181 3300048916 Ga0496113_0274031 Ga0496113_0274031_244_600 118
182 3300053084 Ga0495595_0019471 Ga0495595_0019471_902_1258 118
183 3300053085 Ga0495619_0027550 Ga0495619_0027550_1983_2339 118
184 3300005365 Ga0070688_100601462 Ga0070688_1006014622 119
185 3300005535 Ga0070684_100765813 Ga0070684_1007658132 119
186 3300005614 Ga0068856_100051646 Ga0068856_1000516463 119
187 3300009098 Ga0105245_10171774 Ga0105245_101717742 119
188 3300013307 Ga0157372_10338276 Ga0157372_103382762 119
189 3300025911 Ga0207654_11103540 Ga0207654_111035401 119
190 3300025949 Ga0207667_11699477 Ga0207667_116994772 119
191 3300026078 Ga0207702_10127944 Ga0207702_101279442 119
192 3300028379 Ga0268266_11372862 Ga0268266_113728621 119
193 3300028654 Ga0265322_10093011 Ga0265322_100930112 119
194 3300028666 Ga0265336_10047913 Ga0265336_100479131 119
195 3300031251 Ga0265327_10007233 Ga0265327_100072337 119
196 3300041452 Ga0451793_1153749 Ga0451793_1153749_142_501 119
197 3300044735 Ga0466968_0012214 Ga0466968_0012214_1995_2354 119
198 3300044901 Ga0466960_0106199 Ga0466960_0106199_234_593 119
199 3300048905 Ga0496102_0037467 Ga0496102_0037467_354_713 119
200 3300048907 Ga0496104_0024884 Ga0496104_0024884_3087_3446 119
201 3300048908 Ga0496105_0004806 Ga0496105_0004806_4552_4911 119
202 3300048909 Ga0496106_0286434 Ga0496106_0286434_919_1278 119
203 3300048911 Ga0496108_0007291 Ga0496108_0007291_5796_6155 119
204 3300048912 Ga0496109_0014329 Ga0496109_0014329_2353_2712 119
205 3300048913 Ga0496110_0014230 Ga0496110_0014230_5882_6241 119
206 3300048914 Ga0496111_0008845 Ga0496111_0008845_4265_4624 119
207 3300048914 Ga0496111_0038168 Ga0496111_0038168_1920_2279 119
208 3300048915 Ga0496112_0807736 Ga0496112_0807736_308_667 119
209 3300048916 Ga0496113_0015601 Ga0496113_0015601_2533_2892 119

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lur-assembly1.cif.gz_C stable effector functionless 2 (sefl2) igg1 fc scaffold bound to a minimized version of the b-domain (mini-z) from protein a called z34c 0.7665 35 64
7lur-assembly1.cif.gz_C stable effector functionless 2 (sefl2) igg1 fc scaffold bound to a minimized version of the b-domain (mini-z) from protein a called z34c 0.692 35 64
2ob9-assembly1.cif.gz_A structure of bacteriophage hk97 tail assembly chaperone 0.5492 17 105
4xul-assembly1.cif.gz_A crystal structure of m. chilensis mg662 protein complexed with gtp 0.5287 35 87
2ob9-assembly1.cif.gz_A structure of bacteriophage hk97 tail assembly chaperone 0.4729 17 105
ID Description Score Start End Superfamily
af_Q8VHL1_66_110_2.20.110.10 Mainly Beta;Single Sheet;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain;Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.7866 16 32 2.20.110.10
af_C7IVS4_1041_1222_1.10.132.60 Mainly Alpha;Orthogonal Bundle;Topoisomerase I; Chain A, domain 4;B family DNA polymerase, thumb domain 0.785 38 67 1.10.132.60
af_Q9VXG7_464_640_3.40.1110.10 Alpha Beta;3-Layer(aba) Sandwich;Calcium-transporting ATPase, cytoplasmic domain N;Calcium-transporting ATPase, cytoplasmic domain N 0.6738 28 69 3.40.1110.10
af_A0A1D6QHE4_127_334_2.130.10.30 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 0.668 15 31 2.130.10.30
2i2lC01 Mainly Beta;Ribbon;Complement Module; domain 1; 0.668 16 32 2.10.70.50
ID Description Score Start End GO Terms
AF-A0A7K0R839-F1-model_v4 Uncharacterized protein 0.9606 35 119
AF-A0A7K0QQH5-F1-model_v4 Uncharacterized protein 0.9531 14 119
AF-A0A7K0R839-F1-model_v4 Uncharacterized protein 0.9498 35 119
AF-A0A7K0QQH5-F1-model_v4 Uncharacterized protein 0.9278 14 119
AF-A0A7K0PHQ1-F1-model_v4 Uncharacterized protein 0.9259 1 119

Feature Viewer

pLDDT pTM Quality
87 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map