F318477

General Info

Members Datasets Scaffolds Average Seq Length
208 163 416 613

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2616644814|2616696413
Length 639
Sequence LESEVLTPSCAPANVVDMSKLRARLLGVLVLLTGFLSAVGAQPAAADGLPDSLWFDAPAAATLTVDKGRFLDGLGREVVLRGYNVSGETKLEENSGLPFASVADAKKSATALRALGGGNSVRFLLSWAHAEPVRGQADSTYLAAATDQIRAFLDAGIRVYPDFHQDLYSRYLFNSGSWYTGDGAPKWAVDAGNYPAESCGICIFWGQNITQNEAVKQAQYDFWHNAYGVQDAFLTTAQATMTYVRQHLTTAQFAGLVGFDPFNEPYAGTYDSGQTSRTWERDLLWPFYVKFRARMDAAGWQDKPAFVEANLFWNSNIDSQKQEGGLLDAGTLGPRYVFNTHFYDQKAISGILMWGNAADGQYATDFGTVRDRASAAATTAIVSEFGHPLSGTVSGKAPTVDKAMYQALDSRLPGATWWTKPASSGPVLSGTQWQWDIYSGRHHELMNGNASKVLTSGDAWNDEDLSAVRLDDSGTAVLRQDARLLDRLYPSATSGSTVAFTYEDRSRDGSTTLTWNPVPSSLPHVSQLVGSGQYGLLLWRSGGGSAPTELHLPASFPTASTTVVSDLGATISPPAYTTTTAIAVAPEPGGTGSRRLLLTAPDSGTLHYALVTNGATAPSVDLLSAARSELSSWAASTVN

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
12 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
18 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
19 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
20 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
36 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
49 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
50 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
51 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
54 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
55 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
67 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
68 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
69 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
78 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
79 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
88 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
89 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
90 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
91 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
96 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
99 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
100 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
101 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
102 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
103 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
104 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
105 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
106 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
107 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
108 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
109 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
110 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
111 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
112 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
113 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
114 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
117 2558860280 Kutzneria sp. 744 Isolate Unclassified
118 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
119 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
120 2643221647 Streptomyces sp. Root369 Isolate Unclassified
121 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
122 2643221714 Streptomyces sp. Root264 Isolate Unclassified
123 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
124 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
125 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
126 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
127 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
128 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
129 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
130 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
131 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
132 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
133 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
134 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
135 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
136 2867428634 Streptomyces sp. RP5T Isolate Unclassified
137 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
138 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
139 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
140 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
141 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
142 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
143 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
144 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
145 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
146 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
147 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
148 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
149 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
150 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
151 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
152 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
153 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
154 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
155 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
156 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
157 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
158 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
159 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
160 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
161 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
162 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
163 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.92
Metatranscriptomes 0
Isolates 23.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.62
Nodule 0.96
Rhizoplane 0.48
Rhizosphere 66.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10005029 3300003316 Bacteria 23039
2 Ga0068869_100101807 3300005334 Bacteria 2173
3 Ga0070668_100000351 3300005347 Bacteria 30405
4 Ga0070668_100000542 3300005347 Bacteria 25226
5 Ga0070668_100004264 3300005347 Bacteria 10609
6 Ga0070669_100120760 3300005353 Bacteria 1999
7 Ga0070714_100137065 3300005435 Bacteria 2193
8 Ga0070663_100047391 3300005455 Bacteria 3044
9 Ga0070665_100094490 3300005548 Bacteria 2995
10 Ga0068855_100034525 3300005563 Bacteria 6031
11 Ga0068856_100123044 3300005614 Bacteria 2597
12 Ga0068852_100010404 3300005616 Bacteria 6952
13 Ga0068858_100025640 3300005842 Bacteria 5485
14 Ga0068860_100079466 3300005843 Bacteria 3119
15 Ga0081455_10078011 3300005937 Bacteria 2723
16 Ga0075368_10006934 3300006042 Bacteria 3985
17 Ga0075363_100009478 3300006048 Bacteria 4577
18 Ga0075367_10006428 3300006178 Bacteria 5935
19 Ga0105240_10047327 3300009093 Bacteria 5442
20 Ga0105241_10001912 3300009174 Bacteria 15764
21 Ga0105237_10019633 3300009545 Bacteria 6979
22 Ga0105238_10007821 3300009551 Bacteria 10690
23 Ga0105239_10032187 3300010375 Bacteria 5763
24 Ga0157374_10016763 3300013296 Bacteria 6446
25 Ga0157375_10153928 3300013308 Bacteria 2437
26 Ga0182007_10002215 3300015262 Bacteria 9856
27 Ga0183367_1016 3300015688 Bacteria 290198
28 Ga0207647_10010187 3300025904 Bacteria 6645
29 Ga0207647_10011266 3300025904 Bacteria 6276
30 Ga0207695_10002757 3300025913 Bacteria 25624
31 Ga0207671_10000066 3300025914 Bacteria 163801
32 Ga0207671_10000083 3300025914 Bacteria 145830
33 Ga0207671_10000094 3300025914 Bacteria 138190
34 Ga0207671_10000419 3300025914 Bacteria 58923
35 Ga0207681_10110290 3300025923 Bacteria 2000
36 Ga0207664_10007019 3300025929 Bacteria 7800
37 Ga0207689_10096181 3300025942 Bacteria 2432
38 Ga0207667_10040704 3300025949 Bacteria 4948
39 Ga0207668_10000506 3300025972 Bacteria 24416
40 Ga0207668_10025300 3300025972 Bacteria 3840
41 Ga0207703_10010525 3300026035 Bacteria 7232
42 Ga0209813_10001823 3300027866 Bacteria 4796
43 Ga0268264_10045603 3300028381 Bacteria 3640
44 Ga0307517_10012706 3300028786 Bacteria 11518
45 Ga0307515_10000476 3300028794 Bacteria 95453
46 Ga0307515_10002184 3300028794 Bacteria 42959
47 Ga0307515_10010121 3300028794 Bacteria 18113
48 Ga0307515_10029195 3300028794 Bacteria 9335
49 Ga0307515_10041851 3300028794 Bacteria 7189
50 Ga0307515_10104843 3300028794 Bacteria 3372
51 Ga0307511_10000075 3300030521 Bacteria 82985
52 Ga0307511_10000392 3300030521 Bacteria 46596
53 Ga0307512_10003422 3300030522 Bacteria 18514
54 Ga0307512_10026431 3300030522 Bacteria 5125
55 Ga0307513_10007316 3300031456 Bacteria 14335
56 Ga0307513_10020764 3300031456 Bacteria 7775
57 Ga0307513_10022104 3300031456 Bacteria 7487
58 Ga0307509_10029933 3300031507 Bacteria 6030
59 Ga0307508_10003723 3300031616 Bacteria 15249
60 Ga0307508_10006657 3300031616 Bacteria 10848
61 Ga0307508_10015261 3300031616 Bacteria 6999
62 Ga0307508_10018414 3300031616 Bacteria 6348
63 Ga0307514_10002664 3300031649 Bacteria 18128
64 Ga0307516_10006459 3300031730 Bacteria 13724
65 Ga0307507_10000038 3300033179 Bacteria 184517
66 Ga0307507_10039436 3300033179 Bacteria 4766
67 Ga0307510_10054619 3300033180 Bacteria 4181
68 Ga0373940_0000234 3300035088 Bacteria 7882
69 Ga0373942_0000026 3300035207 Bacteria 27781
70 Ga0373962_0001264 3300035242 Bacteria 5940
71 Ga0373925_0051239 3300037068 Bacteria 3081
72 Ga0395898_0001353 3300037466 Bacteria 35343
73 Ga0395898_0009293 3300037466 Bacteria 10339
74 Ga0439436_0017296 3300041404 Bacteria 2158
75 Ga0451837_0174407 3300041494 Bacteria 2547
76 Ga0451853_0618006 3300041512 Bacteria 5014
77 Ga0451853_1709893 3300041512 Bacteria 4935
78 Ga0439449_0000158 3300042007 Bacteria 23063
79 Ga0439449_0008336 3300042007 Bacteria 3942
80 Ga0439457_000009 3300042014 Bacteria 41871
81 Ga0439462_0008792 3300042015 Bacteria 2552
82 Ga0450894_000409 3300042131 Bacteria 7387
83 Ga0450903_000478 3300042138 Bacteria 8414
84 Ga0466969_0008458 3300044656 Bacteria 5459
85 Ga0466969_0008538 3300044656 Bacteria 5436
86 Ga0466972_0000654 3300044658 Bacteria 16716
87 Ga0466966_0009100 3300044684 Bacteria 6577
88 Ga0466966_0009961 3300044684 Bacteria 6299
89 Ga0466966_0012662 3300044684 Bacteria 5590
90 Ga0466966_0015932 3300044684 Bacteria 4967
91 Ga0466961_0002400 3300044693 Bacteria 11641
92 Ga0466961_0006885 3300044693 Bacteria 7230
93 Ga0466971_0001459 3300044719 Bacteria 9963
94 Ga0466971_0002084 3300044719 Bacteria 8483
95 Ga0466970_0005661 3300044765 Bacteria 6204
96 Ga0466970_0005683 3300044765 Bacteria 6194
97 Ga0466957_0000619 3300044842 Bacteria 17948
98 Ga0466957_0017826 3300044842 Bacteria 4165
99 Ga0466959_0011845 3300045049 Bacteria 6279
100 Ga0466958_0006510 3300045836 Bacteria 6364
101 Ga0466958_0012436 3300045836 Bacteria 4823
102 Ga0466967_0022963 3300045976 Bacteria 5103
103 Ga0466967_0039642 3300045976 Bacteria 4051
104 Ga0495592_0008316 3300046454 Bacteria 7785
105 Ga0495603_0011656 3300046455 Bacteria 5320
106 Ga0495603_0037836 3300046455 Bacteria 2894
107 Ga0495629_0008839 3300046459 Bacteria 7405
108 Ga0495629_0014804 3300046459 Bacteria 5610
109 Ga0495629_0022937 3300046459 Bacteria 4448
110 Ga0495651_0001786 3300046462 Bacteria 16584
111 Ga0495651_0042109 3300046462 Bacteria 3546
112 Ga0495639_0004345 3300046475 Bacteria 6079
113 Ga0495662_0004480 3300046476 Bacteria 7010
114 Ga0495662_0006382 3300046476 Bacteria 5893
115 Ga0495606_0004019 3300046507 Bacteria 15000
116 Ga0495610_0040054 3300046512 Bacteria 2365
117 Ga0495643_0011516 3300046522 Bacteria 5383
118 Ga0495652_0000887 3300046529 Bacteria 34411
119 Ga0495640_0005014 3300046533 Bacteria 10519
120 Ga0495640_0016155 3300046533 Bacteria 5590
121 Ga0495668_0011645 3300046616 Bacteria 5257
122 Ga0495634_0006018 3300046642 Bacteria 9258
123 Ga0495625_0002717 3300046660 Bacteria 18769
124 Ga0495635_0003078 3300046663 Bacteria 11475
125 Ga0495635_0013971 3300046663 Bacteria 5619
126 Ga0495657_0059803 3300046675 Bacteria 2526
127 Ga0495613_0003431 3300046689 Bacteria 11849
128 Ga0495613_0055770 3300046689 Bacteria 2902
129 Ga0495589_0028634 3300046794 Bacteria 2810
130 Ga0495600_0006180 3300046809 Bacteria 7262
131 Ga0495600_0052502 3300046809 Bacteria 2662
132 Ga0495604_0003471 3300047317 Bacteria 12564
133 Ga0495636_0001271 3300047318 Bacteria 9563
134 Ga0495636_0014325 3300047318 Bacteria 3151
135 Ga0495676_0048366 3300047321 Bacteria 3429
136 Ga0495680_0010789 3300047322 Bacteria 8137
137 Ga0495687_021098 3300047443 Bacteria 3161
138 Ga0495675_0052178 3300047444 Bacteria 2597
139 Ga0495685_003202 3300047447 Bacteria 5197
140 Ga0495681_0004001 3300047470 Bacteria 10140
141 Ga0495602_0051327 3300048088 Bacteria 3674
142 Ga0495602_0060405 3300048088 Bacteria 3303
143 nmdc:mga03n38_10734_c1 3300050490 Bacteria 3384
144 nmdc:mga06z11_9616_c1 3300050494 Bacteria 4081
145 nmdc:mga04h51_1964_c1 3300050495 Bacteria 4796
146 nmdc:mga07m45_17486_c1 3300050496 Bacteria 3851
147 Ga0495601_0001520 3300053077 Bacteria 12802
148 Ga0500646_0000746 3300053090 Bacteria 9143
149 Ga0500640_007230 3300053095 Bacteria 4306
150 Ga0500641_0040422 3300053096 Bacteria 1883
151 Ga0500553_040667 3300053101 Bacteria 2280
152 Ga0500560_001944 3300053107 Bacteria 3793
153 Ga0500652_037403 3300053131 Bacteria 1936
154 Ga0500658_0015858 3300053134 Bacteria 2803
155 Ga0500573_0003012 3300053140 Bacteria 8617
156 Ga0500573_0022491 3300053140 Bacteria 3618
157 Ga0500579_008225 3300053143 Bacteria 6573
158 Ga0500616_0013919 3300053153 Bacteria 4643
159 Ga0500634_0003849 3300053161 Bacteria 6795
160 Ga0466962_0000902 3300061719 Bacteria 13479
161 2616696413 2616644814 Bacteria 11555299
162 2559423941 2558860280 Bacteria 11429938
163 2585303233 2582581313 Bacteria 10042643
164 2585320785 2582581314 Bacteria 11452267
165 2644266812 2643221647 Bacteria 10741251
166 2644440579 2643221678 Bacteria 9540101
167 2644627749 2643221714 Bacteria 9015452
168 2753263086 2751185782 Bacteria 11227053
169 2785339236 2784746763 Bacteria 9783172
170 2785374058 2784746768 Bacteria 10036182
171 2786674306 2786546132 Bacteria 10419719
172 2793978240 2791355406 Bacteria 11364898
173 2808845751 2808606359 Bacteria 9866990
174 2808915596 2808606375 Bacteria 9466072
175 2811843393 2808606982 Bacteria 7791042
176 2812353845 2811994879 Bacteria 9313447
177 2852639039 2852635781 Bacteria 8251373
178 2862282661 2862281513 Bacteria 9621493
179 2862387446 2862382967 Bacteria 10317375
180 2863410707 2863404153 Bacteria 9672205
181 2867434801 2867428634 Bacteria 9590268
182 2877677237 2877676314 Bacteria 9512378
183 2912715563 2912715099 Bacteria 9460473
184 2919470628 2919468124 Bacteria 9133025
185 2946071851 2946064051 Bacteria 8957905
186 2946079593 2946072368 Bacteria 8999607
187 2947232731 2947224130 Bacteria 9938529
188 2954009257 2954002825 Bacteria 9173742
189 2954381965 2954380949 Bacteria 10050426
190 2954681105 2954673503 Bacteria 9685905
191 2954683052 2954682443 Bacteria 9862841
192 2954692774 2954691527 Bacteria 10720516
193 2954707847 2954701450 Bacteria 10834262
194 2954712421 2954711539 Bacteria 10867210
195 2954722374 2954721474 Bacteria 10456478
196 2954739481 2954731030 Bacteria 10243860
197 2954741254 2954740390 Bacteria 10229294
198 2954758309 2954749733 Bacteria 10366972
199 2954760270 2954759201 Bacteria 9358192
200 2990066800 2990059506 Bacteria 9321252
201 8003317971 8003314358 Bacteria 10575343
202 8008564742 8008558824 Bacteria 10610750
203 8047902861 8047893842 Bacteria 11723082
204 8048128901 8048127548 Bacteria 11053136
205 8048370658 8048369669 Bacteria 11666822
206 8048388764 8048379754 Bacteria 11877923
207 8048412493 8048406513 Bacteria 8936924
208 8056832429 8056829672 Bacteria 9045328
209 rootH1_10005029
210 Ga0068869_100101807
211 Ga0070668_100000351
212 Ga0070668_100000542
213 Ga0070668_100004264
214 Ga0070669_100120760
215 Ga0070714_100137065
216 Ga0070663_100047391
217 Ga0070665_100094490
218 Ga0068855_100034525
219 Ga0068856_100123044
220 Ga0068852_100010404
221 Ga0068858_100025640
222 Ga0068860_100079466
223 Ga0081455_10078011
224 Ga0075368_10006934
225 Ga0075363_100009478
226 Ga0075367_10006428
227 Ga0105240_10047327
228 Ga0105241_10001912
229 Ga0105237_10019633
230 Ga0105238_10007821
231 Ga0105239_10032187
232 Ga0157374_10016763
233 Ga0157375_10153928
234 Ga0182007_10002215
235 Ga0183367_1016
236 Ga0207647_10010187
237 Ga0207647_10011266
238 Ga0207695_10002757
239 Ga0207671_10000066
240 Ga0207671_10000083
241 Ga0207671_10000094
242 Ga0207671_10000419
243 Ga0207681_10110290
244 Ga0207664_10007019
245 Ga0207689_10096181
246 Ga0207667_10040704
247 Ga0207668_10000506
248 Ga0207668_10025300
249 Ga0207703_10010525
250 Ga0209813_10001823
251 Ga0268264_10045603
252 Ga0307517_10012706
253 Ga0307515_10000476
254 Ga0307515_10002184
255 Ga0307515_10010121
256 Ga0307515_10029195
257 Ga0307515_10041851
258 Ga0307515_10104843
259 Ga0307511_10000075
260 Ga0307511_10000392
261 Ga0307512_10003422
262 Ga0307512_10026431
263 Ga0307513_10007316
264 Ga0307513_10020764
265 Ga0307513_10022104
266 Ga0307509_10029933
267 Ga0307508_10003723
268 Ga0307508_10006657
269 Ga0307508_10015261
270 Ga0307508_10018414
271 Ga0307514_10002664
272 Ga0307516_10006459
273 Ga0307507_10000038
274 Ga0307507_10039436
275 Ga0307510_10054619
276 Ga0373940_0000234
277 Ga0373942_0000026
278 Ga0373962_0001264
279 Ga0373925_0051239
280 Ga0395898_0001353
281 Ga0395898_0009293
282 Ga0439436_0017296
283 Ga0451837_0174407
284 Ga0451853_0618006
285 Ga0451853_1709893
286 Ga0439449_0000158
287 Ga0439449_0008336
288 Ga0439457_000009
289 Ga0439462_0008792
290 Ga0450894_000409
291 Ga0450903_000478
292 Ga0466969_0008458
293 Ga0466969_0008538
294 Ga0466972_0000654
295 Ga0466966_0009100
296 Ga0466966_0009961
297 Ga0466966_0012662
298 Ga0466966_0015932
299 Ga0466961_0002400
300 Ga0466961_0006885
301 Ga0466971_0001459
302 Ga0466971_0002084
303 Ga0466970_0005661
304 Ga0466970_0005683
305 Ga0466957_0000619
306 Ga0466957_0017826
307 Ga0466959_0011845
308 Ga0466958_0006510
309 Ga0466958_0012436
310 Ga0466967_0022963
311 Ga0466967_0039642
312 Ga0495592_0008316
313 Ga0495603_0011656
314 Ga0495603_0037836
315 Ga0495629_0008839
316 Ga0495629_0014804
317 Ga0495629_0022937
318 Ga0495651_0001786
319 Ga0495651_0042109
320 Ga0495639_0004345
321 Ga0495662_0004480
322 Ga0495662_0006382
323 Ga0495606_0004019
324 Ga0495610_0040054
325 Ga0495643_0011516
326 Ga0495652_0000887
327 Ga0495640_0005014
328 Ga0495640_0016155
329 Ga0495668_0011645
330 Ga0495634_0006018
331 Ga0495625_0002717
332 Ga0495635_0003078
333 Ga0495635_0013971
334 Ga0495657_0059803
335 Ga0495613_0003431
336 Ga0495613_0055770
337 Ga0495589_0028634
338 Ga0495600_0006180
339 Ga0495600_0052502
340 Ga0495604_0003471
341 Ga0495636_0001271
342 Ga0495636_0014325
343 Ga0495676_0048366
344 Ga0495680_0010789
345 Ga0495687_021098
346 Ga0495675_0052178
347 Ga0495685_003202
348 Ga0495681_0004001
349 Ga0495602_0051327
350 Ga0495602_0060405
351 nmdc:mga03n38_10734_c1
352 nmdc:mga06z11_9616_c1
353 nmdc:mga04h51_1964_c1
354 nmdc:mga07m45_17486_c1
355 Ga0495601_0001520
356 Ga0500646_0000746
357 Ga0500640_007230
358 Ga0500641_0040422
359 Ga0500553_040667
360 Ga0500560_001944
361 Ga0500652_037403
362 Ga0500658_0015858
363 Ga0500573_0003012
364 Ga0500573_0022491
365 Ga0500579_008225
366 Ga0500616_0013919
367 Ga0500634_0003849
368 Ga0466962_0000902
369 2616696413
370 2559423941
371 2585303233
372 2585320785
373 2644266812
374 2644440579
375 2644627749
376 2753263086
377 2785339236
378 2785374058
379 2786674306
380 2793978240
381 2808845751
382 2808915596
383 2811843393
384 2812353845
385 2852639039
386 2862282661
387 2862387446
388 2863410707
389 2867434801
390 2877677237
391 2912715563
392 2919470628
393 2946071851
394 2946079593
395 2947232731
396 2954009257
397 2954381965
398 2954681105
399 2954683052
400 2954692774
401 2954707847
402 2954712421
403 2954722374
404 2954739481
405 2954741254
406 2954758309
407 2954760270
408 2990066800
409 8003317971
410 8008564742
411 8047902861
412 8048128901
413 8048370658
414 8048388764
415 8048412493
416 8056832429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00150

Cellulase

Cellulase (glycosyl hydrolase family 5)

71

424

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
2osy-assembly2.cif.gz_B endo-glycoceramidase ii from rhodococcus sp.: lactosyl-enzyme intermediate 0.8055 49 594
2oym-assembly2.cif.gz_B endo-glycoceramidase ii from rhodococcus sp.: five-membered iminocyclitol complex 0.8022 49 594
2osy-assembly1.cif.gz_A endo-glycoceramidase ii from rhodococcus sp.: lactosyl-enzyme intermediate 0.8014 49 594
2osy-assembly2.cif.gz_B endo-glycoceramidase ii from rhodococcus sp.: lactosyl-enzyme intermediate 0.8005 49 594
2osw-assembly1.cif.gz_A endo-glycoceramidase ii from rhodococcus sp. 0.7993 49 594
ID Description Score Start End Superfamily
2oykA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7427 60 430 3.20.20.80
af_Q2G0M8_295_394_3.90.1150.10 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.7292 587 617 3.90.1150.10
2oykA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7224 60 430 3.20.20.80
af_Q2G2D0_205_378_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7223 82 146 3.40.50.300
af_Q9VGE7_17_296_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7193 40 363 3.20.20.80
ID Description Score Start End GO Terms
AF-D9XDE1-F1-model_v4 Endoglycosylceramidase 0.982 35 617 GO:0000272
GO:0008422
AF-D9XDE1-F1-model_v4 Endoglycosylceramidase 0.9754 35 617 GO:0000272
GO:0008422
AF-A0A1H9IX96-F1-model_v4 Cellulase (Glycosyl hydrolase family 5) 0.9699 102 292
AF-A0A499VUL9-F1-model_v4 Glycoside hydrolase family 5 domain-containing protein 0.9599 196 617 GO:0000272
GO:0004553
AF-A0A499VUL9-F1-model_v4 Glycoside hydrolase family 5 domain-containing protein 0.9511 196 617 GO:0000272
GO:0004553

Map