F318447

General Info

Members Datasets Scaffolds Average Seq Length
208 110 416 195

Family's Representative Sequence

Representative Sequence 3300053098|Ga0500650_0020615|Ga0500650_0020615_1539_2216
Length 225
Sequence MQPVWQANCRSFISCRRAAISAKFGNERNFMSFSIELELQKFPKTVKLKDGTKAVLRPLRRDDEKDFHQLFLGIPEHERMFIKHRVMDISVIHDWCQNLDYGRNLPLVALIGGKIVGDATLHQQLGGWKRHIGRVSVLVHPEFRGRGLARMLVNEIVEIARRAGLEKVEAEFIGEQDTAIKMFAMLGFSQLLRLEDYVKDMQAIAHDYVLMGLELKTDEEYTSAG

Samples

Sample ID Description Type Environment
1 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
31 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
32 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
33 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
47 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
48 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
49 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
50 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
51 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
54 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
55 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
59 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
60 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
61 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
66 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
67 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
72 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
75 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
76 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
77 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
78 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
79 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
80 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
81 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
82 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
83 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
84 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
85 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
86 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
89 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
90 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
91 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
92 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
93 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
101 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
102 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 0
Rhizosphere 98.56
Stem 0
Stem Tuber 0
Unclassified 32.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500650_0020615 3300053098 Unclassified 2895
2 rootH2_10048816 3300003320 Bacteria 4109
3 Ga0070690_100018690 3300005330 Bacteria 4190
4 Ga0070690_100752322 3300005330 Bacteria 752
5 Ga0070689_100024652 3300005340 Unclassified 4512
6 Ga0070692_10395654 3300005345 Unclassified 871
7 Ga0070673_100437310 3300005364 Bacteria 1175
8 Ga0070688_100662666 3300005365 Unclassified 805
9 Ga0070700_100366417 3300005441 Unclassified 1073
10 Ga0070708_100065519 3300005445 Bacteria 3258
11 Ga0070685_10589893 3300005466 Unclassified 798
12 Ga0070707_100543323 3300005468 Unclassified 1124
13 Ga0070686_100055457 3300005544 Unclassified 2539
14 Ga0068855_100156533 3300005563 Bacteria 2588
15 Ga0068854_100573467 3300005578 Bacteria 960
16 Ga0068856_100000745 3300005614 Bacteria 35269
17 Ga0068856_100029688 3300005614 Bacteria 5341
18 Ga0068856_100305022 3300005614 Bacteria 1610
19 Ga0070702_100213123 3300005615 Bacteria 1287
20 Ga0070702_100545259 3300005615 Unclassified 860
21 Ga0068859_100124121 3300005617 Bacteria 2650
22 Ga0068859_100126975 3300005617 Bacteria 2620
23 Ga0068864_100733014 3300005618 Unclassified 967
24 Ga0068861_100798989 3300005719 Unclassified 885
25 Ga0068863_100004868 3300005841 Bacteria 13231
26 Ga0068863_100182706 3300005841 Unclassified 2013
27 Ga0068863_101005864 3300005841 Bacteria 836
28 Ga0068858_100089048 3300005842 Bacteria 2872
29 Ga0068871_100842205 3300006358 Unclassified 847
30 Ga0068865_101142648 3300006881 Bacteria 687
31 Ga0097620_100124120 3300006931 Bacteria 2650
32 Ga0097620_100126980 3300006931 Bacteria 2620
33 Ga0097620_100320806 3300006931 Bacteria 1643
34 Ga0105240_10030044 3300009093 Bacteria 7068
35 Ga0105248_10897385 3300009177 Bacteria 1001
36 Ga0105237_10233366 3300009545 Bacteria 1841
37 Ga0105238_10003993 3300009551 Bacteria 14639
38 Ga0105238_10394083 3300009551 Bacteria 1377
39 Ga0105238_10496388 3300009551 Bacteria 1221
40 Ga0105249_10466007 3300009553 Bacteria 1304
41 Ga0105246_10508647 3300011119 Bacteria 1024
42 Ga0157375_10000048 3300013308 Bacteria 140600
43 Ga0163163_10124834 3300014325 Unclassified 2611
44 Ga0207680_10016120 3300025903 Bacteria 3915
45 Ga0207646_10766592 3300025922 Unclassified 860
46 Ga0207694_10271179 3300025924 Bacteria 1392
47 Ga0207670_10012900 3300025936 Unclassified 4908
48 Ga0207670_10077347 3300025936 Bacteria 2318
49 Ga0207711_10608142 3300025941 Bacteria 1020
50 Ga0207712_10202522 3300025961 Unclassified 1575
51 Ga0207703_10081022 3300026035 Bacteria 2705
52 Ga0207708_10510786 3300026075 Bacteria 1008
53 Ga0207702_10003757 3300026078 Bacteria 13710
54 Ga0207702_10015341 3300026078 Bacteria 6350
55 Ga0207641_10214241 3300026088 Unclassified 1783
56 Ga0207676_11173791 3300026095 Unclassified 760
57 Ga0265337_1001120 3300028556 Bacteria 13707
58 Ga0265337_1006510 3300028556 Bacteria 4495
59 Ga0265337_1039743 3300028556 Unclassified 1359
60 Ga0265326_10014449 3300028558 Bacteria 2300
61 Ga0265326_10099364 3300028558 Unclassified 825
62 Ga0265326_10155683 3300028558 Bacteria 653
63 Ga0265319_1000179 3300028563 Bacteria 48318
64 Ga0265319_1011095 3300028563 Bacteria 3714
65 Ga0265319_1025303 3300028563 Unclassified 2126
66 Ga0265319_1047549 3300028563 Unclassified 1427
67 Ga0265319_1064689 3300028563 Unclassified 1180
68 Ga0265334_10010655 3300028573 Bacteria 3881
69 Ga0265334_10025319 3300028573 Bacteria 2402
70 Ga0265334_10043220 3300028573 Bacteria 1754
71 Ga0265334_10108121 3300028573 Unclassified 1001
72 Ga0265334_10110310 3300028573 Unclassified 989
73 Ga0265318_10018719 3300028577 Bacteria 2821
74 Ga0265318_10147853 3300028577 Unclassified 862
75 Ga0265323_10073376 3300028653 Unclassified 1166
76 Ga0265322_10041488 3300028654 Unclassified 1310
77 Ga0265322_10046828 3300028654 Bacteria 1230
78 Ga0265336_10002534 3300028666 Bacteria 7476
79 Ga0265338_10000105 3300028800 Bacteria 156108
80 Ga0265338_10000135 3300028800 Bacteria 135743
81 Ga0265338_10000774 3300028800 Bacteria 54489
82 Ga0265338_10001116 3300028800 Bacteria 44580
83 Ga0265338_10004347 3300028800 Bacteria 19195
84 Ga0265338_10005970 3300028800 Bacteria 15661
85 Ga0265338_10006718 3300028800 Bacteria 14526
86 Ga0265338_10010169 3300028800 Bacteria 11093
87 Ga0265338_10013381 3300028800 Bacteria 9270
88 Ga0265338_10029556 3300028800 Bacteria 5428
89 Ga0265338_10034551 3300028800 Unclassified 4883
90 Ga0265338_10042438 3300028800 Bacteria 4235
91 Ga0265338_10063425 3300028800 Bacteria 3221
92 Ga0265338_10068316 3300028800 Bacteria 3062
93 Ga0265338_10108206 3300028800 Bacteria 2246
94 Ga0265338_10299004 3300028800 Unclassified 1170
95 Ga0265338_10449796 3300028800 Unclassified 912
96 Ga0265338_10514392 3300028800 Bacteria 841
97 Ga0265338_10775556 3300028800 Unclassified 658
98 Ga0265324_10000614 3300029957 Bacteria 24339
99 Ga0265324_10006028 3300029957 Bacteria 5127
100 Ga0265324_10024989 3300029957 Unclassified 2120
101 Ga0265324_10029589 3300029957 Bacteria 1925
102 Ga0265324_10048492 3300029957 Unclassified 1460
103 Ga0265324_10078793 3300029957 Unclassified 1121
104 Ga0265330_10020873 3300031235 Bacteria 2993
105 Ga0265332_10041985 3300031238 Bacteria 1978
106 Ga0265332_10096987 3300031238 Unclassified 1245
107 Ga0265320_10000990 3300031240 Bacteria 21089
108 Ga0265320_10011003 3300031240 Bacteria 5348
109 Ga0265320_10038280 3300031240 Bacteria 2407
110 Ga0265320_10041673 3300031240 Unclassified 2281
111 Ga0265320_10052410 3300031240 Bacteria 1976
112 Ga0265320_10096898 3300031240 Unclassified 1361
113 Ga0265325_10001373 3300031241 Bacteria 17189
114 Ga0265325_10120937 3300031241 Unclassified 1262
115 Ga0265329_10007546 3300031242 Unclassified 4196
116 Ga0265339_10086368 3300031249 Unclassified 1650
117 Ga0265339_10310482 3300031249 Unclassified 750
118 Ga0265331_10076127 3300031250 Unclassified 1564
119 Ga0265327_10002213 3300031251 Bacteria 21222
120 Ga0265327_10056112 3300031251 Bacteria 2031
121 Ga0265316_10018377 3300031344 Bacteria 6008
122 Ga0265316_10019528 3300031344 Bacteria 5792
123 Ga0265316_10053485 3300031344 Bacteria 3163
124 Ga0265316_10129029 3300031344 Unclassified 1905
125 Ga0265316_10230875 3300031344 Unclassified 1363
126 Ga0265316_10234358 3300031344 Unclassified 1351
127 Ga0265316_10331226 3300031344 Unclassified 1104
128 Ga0265316_10463333 3300031344 Bacteria 908
129 Ga0265313_10003061 3300031595 Bacteria 13878
130 Ga0265313_10007745 3300031595 Bacteria 7267
131 Ga0265313_10154237 3300031595 Unclassified 979
132 Ga0265314_10000453 3300031711 Bacteria 54843
133 Ga0265314_10047789 3300031711 Bacteria 3009
134 Ga0265314_10089515 3300031711 Bacteria 2007
135 Ga0265314_10153876 3300031711 Bacteria 1407
136 Ga0265342_10033893 3300031712 Bacteria 3136
137 Ga0265342_10054692 3300031712 Unclassified 2371
138 Ga0265342_10219208 3300031712 Unclassified 1026
139 Ga0373945_0002374 3300035116 Bacteria 5906
140 Ga0373954_0015504 3300035118 Bacteria 3406
141 Ga0373927_0048865 3300035695 Bacteria 2736
142 Ga0373933_0113596 3300035724 Bacteria 1691
143 Ga0373937_0002552 3300036401 Bacteria 15128
144 Ga0373937_0391261 3300036401 Bacteria 1319
145 Ga0373937_0864995 3300036401 Bacteria 853
146 Ga0453684_1140463 3300044712 Unclassified 821
147 Ga0451576_0077968 3300045051 Unclassified 3448
148 Ga0451576_0138129 3300045051 Bacteria 2542
149 Ga0451576_0223683 3300045051 Unclassified 1965
150 Ga0451576_0277954 3300045051 Unclassified 1751
151 Ga0451576_0713325 3300045051 Unclassified 1054
152 Ga0495582_0006506 3300046473 Bacteria 6484
153 Ga0495639_0149281 3300046475 Bacteria 1127
154 Ga0495608_0244295 3300046511 Bacteria 1121
155 Ga0495618_0015524 3300046514 Bacteria 4648
156 Ga0495618_0168589 3300046514 Bacteria 1394
157 Ga0495618_0204278 3300046514 Unclassified 1250
158 Ga0495628_0193365 3300046516 Bacteria 1536
159 Ga0495630_0000150 3300046517 Bacteria 54165
160 Ga0495630_0081979 3300046517 Bacteria 2434
161 Ga0495630_0148818 3300046517 Bacteria 1781
162 Ga0495630_0220147 3300046517 Bacteria 1449
163 Ga0495630_0284983 3300046517 Unclassified 1262
164 Ga0495630_0490861 3300046517 Bacteria 942
165 Ga0495666_0035737 3300046526 Bacteria 2420
166 Ga0495665_0106995 3300046531 Bacteria 1467
167 Ga0495640_0117825 3300046533 Bacteria 1728
168 Ga0495586_0000661 3300046535 Bacteria 19669
169 Ga0495586_0120575 3300046535 Unclassified 1465
170 Ga0495586_0662095 3300046535 Unclassified 603
171 Ga0495598_0244977 3300046537 Bacteria 662
172 Ga0495621_0062011 3300046539 Bacteria 1360
173 Ga0495645_0214835 3300046543 Bacteria 1297
174 Ga0495667_0133460 3300046559 Bacteria 1601
175 Ga0495667_0144024 3300046559 Bacteria 1535
176 Ga0495634_0026322 3300046642 Bacteria 4061
177 Ga0495634_0087637 3300046642 Bacteria 2026
178 Ga0495635_0217442 3300046663 Bacteria 1293
179 Ga0495657_0133995 3300046675 Bacteria 1549
180 Ga0495646_0323212 3300046680 Bacteria 812
181 Ga0495647_0043614 3300046681 Bacteria 1717
182 Ga0495658_0018776 3300046683 Bacteria 3601
183 Ga0495613_0051984 3300046689 Bacteria 3018
184 Ga0495581_0190584 3300047315 Bacteria 1199
185 Ga0495604_0677744 3300047317 Unclassified 656
186 Ga0495674_0001882 3300047319 Bacteria 20667
187 Ga0495674_0611759 3300047319 Bacteria 862
188 Ga0495676_0020181 3300047321 Bacteria 5854
189 Ga0495680_0328218 3300047322 Bacteria 1069
190 Ga0495684_0111974 3300047471 Bacteria 2059
191 Ga0495684_0291438 3300047471 Unclassified 1175
192 Ga0495615_0175387 3300048090 Unclassified 651
193 Ga0501297_021253 3300049520 Unclassified 814
194 Ga0501031_0001095 3300049568 Bacteria 16496
195 Ga0501031_0052371 3300049568 Bacteria 2659
196 Ga0501032_0006667 3300049569 Bacteria 8476
197 Ga0501032_0034084 3300049569 Bacteria 3486
198 Ga0501033_0005947 3300049570 Bacteria 9579
199 Ga0501033_0013884 3300049570 Bacteria 6128
200 Ga0501043_0270322 3300049579 Bacteria 1305
201 Ga0501043_0311378 3300049579 Bacteria 1201
202 Ga0501047_0059400 3300049581 Bacteria 3692
203 Ga0501048_0195535 3300049582 Unclassified 1434
204 Ga0501080_1000966 3300049742 Unclassified 725
205 Ga0501035_0003313 3300049822 Bacteria 15431
206 Ga0501044_0000427 3300049823 Bacteria 52004
207 Ga0501044_0018266 3300049823 Bacteria 7517
208 Ga0500650_0164227 3300053098 Unclassified 1023
209 Ga0500650_0020615
210 rootH2_10048816
211 Ga0070690_100018690
212 Ga0070690_100752322
213 Ga0070689_100024652
214 Ga0070692_10395654
215 Ga0070673_100437310
216 Ga0070688_100662666
217 Ga0070700_100366417
218 Ga0070708_100065519
219 Ga0070685_10589893
220 Ga0070707_100543323
221 Ga0070686_100055457
222 Ga0068855_100156533
223 Ga0068854_100573467
224 Ga0068856_100000745
225 Ga0068856_100029688
226 Ga0068856_100305022
227 Ga0070702_100213123
228 Ga0070702_100545259
229 Ga0068859_100124121
230 Ga0068859_100126975
231 Ga0068864_100733014
232 Ga0068861_100798989
233 Ga0068863_100004868
234 Ga0068863_100182706
235 Ga0068863_101005864
236 Ga0068858_100089048
237 Ga0068871_100842205
238 Ga0068865_101142648
239 Ga0097620_100124120
240 Ga0097620_100126980
241 Ga0097620_100320806
242 Ga0105240_10030044
243 Ga0105248_10897385
244 Ga0105237_10233366
245 Ga0105238_10003993
246 Ga0105238_10394083
247 Ga0105238_10496388
248 Ga0105249_10466007
249 Ga0105246_10508647
250 Ga0157375_10000048
251 Ga0163163_10124834
252 Ga0207680_10016120
253 Ga0207646_10766592
254 Ga0207694_10271179
255 Ga0207670_10012900
256 Ga0207670_10077347
257 Ga0207711_10608142
258 Ga0207712_10202522
259 Ga0207703_10081022
260 Ga0207708_10510786
261 Ga0207702_10003757
262 Ga0207702_10015341
263 Ga0207641_10214241
264 Ga0207676_11173791
265 Ga0265337_1001120
266 Ga0265337_1006510
267 Ga0265337_1039743
268 Ga0265326_10014449
269 Ga0265326_10099364
270 Ga0265326_10155683
271 Ga0265319_1000179
272 Ga0265319_1011095
273 Ga0265319_1025303
274 Ga0265319_1047549
275 Ga0265319_1064689
276 Ga0265334_10010655
277 Ga0265334_10025319
278 Ga0265334_10043220
279 Ga0265334_10108121
280 Ga0265334_10110310
281 Ga0265318_10018719
282 Ga0265318_10147853
283 Ga0265323_10073376
284 Ga0265322_10041488
285 Ga0265322_10046828
286 Ga0265336_10002534
287 Ga0265338_10000105
288 Ga0265338_10000135
289 Ga0265338_10000774
290 Ga0265338_10001116
291 Ga0265338_10004347
292 Ga0265338_10005970
293 Ga0265338_10006718
294 Ga0265338_10010169
295 Ga0265338_10013381
296 Ga0265338_10029556
297 Ga0265338_10034551
298 Ga0265338_10042438
299 Ga0265338_10063425
300 Ga0265338_10068316
301 Ga0265338_10108206
302 Ga0265338_10299004
303 Ga0265338_10449796
304 Ga0265338_10514392
305 Ga0265338_10775556
306 Ga0265324_10000614
307 Ga0265324_10006028
308 Ga0265324_10024989
309 Ga0265324_10029589
310 Ga0265324_10048492
311 Ga0265324_10078793
312 Ga0265330_10020873
313 Ga0265332_10041985
314 Ga0265332_10096987
315 Ga0265320_10000990
316 Ga0265320_10011003
317 Ga0265320_10038280
318 Ga0265320_10041673
319 Ga0265320_10052410
320 Ga0265320_10096898
321 Ga0265325_10001373
322 Ga0265325_10120937
323 Ga0265329_10007546
324 Ga0265339_10086368
325 Ga0265339_10310482
326 Ga0265331_10076127
327 Ga0265327_10002213
328 Ga0265327_10056112
329 Ga0265316_10018377
330 Ga0265316_10019528
331 Ga0265316_10053485
332 Ga0265316_10129029
333 Ga0265316_10230875
334 Ga0265316_10234358
335 Ga0265316_10331226
336 Ga0265316_10463333
337 Ga0265313_10003061
338 Ga0265313_10007745
339 Ga0265313_10154237
340 Ga0265314_10000453
341 Ga0265314_10047789
342 Ga0265314_10089515
343 Ga0265314_10153876
344 Ga0265342_10033893
345 Ga0265342_10054692
346 Ga0265342_10219208
347 Ga0373945_0002374
348 Ga0373954_0015504
349 Ga0373927_0048865
350 Ga0373933_0113596
351 Ga0373937_0002552
352 Ga0373937_0391261
353 Ga0373937_0864995
354 Ga0453684_1140463
355 Ga0451576_0077968
356 Ga0451576_0138129
357 Ga0451576_0223683
358 Ga0451576_0277954
359 Ga0451576_0713325
360 Ga0495582_0006506
361 Ga0495639_0149281
362 Ga0495608_0244295
363 Ga0495618_0015524
364 Ga0495618_0168589
365 Ga0495618_0204278
366 Ga0495628_0193365
367 Ga0495630_0000150
368 Ga0495630_0081979
369 Ga0495630_0148818
370 Ga0495630_0220147
371 Ga0495630_0284983
372 Ga0495630_0490861
373 Ga0495666_0035737
374 Ga0495665_0106995
375 Ga0495640_0117825
376 Ga0495586_0000661
377 Ga0495586_0120575
378 Ga0495586_0662095
379 Ga0495598_0244977
380 Ga0495621_0062011
381 Ga0495645_0214835
382 Ga0495667_0133460
383 Ga0495667_0144024
384 Ga0495634_0026322
385 Ga0495634_0087637
386 Ga0495635_0217442
387 Ga0495657_0133995
388 Ga0495646_0323212
389 Ga0495647_0043614
390 Ga0495658_0018776
391 Ga0495613_0051984
392 Ga0495581_0190584
393 Ga0495604_0677744
394 Ga0495674_0001882
395 Ga0495674_0611759
396 Ga0495676_0020181
397 Ga0495680_0328218
398 Ga0495684_0111974
399 Ga0495684_0291438
400 Ga0495615_0175387
401 Ga0501297_021253
402 Ga0501031_0001095
403 Ga0501031_0052371
404 Ga0501032_0006667
405 Ga0501032_0034084
406 Ga0501033_0005947
407 Ga0501033_0013884
408 Ga0501043_0270322
409 Ga0501043_0311378
410 Ga0501047_0059400
411 Ga0501048_0195535
412 Ga0501080_1000966
413 Ga0501035_0003313
414 Ga0501044_0000427
415 Ga0501044_0018266
416 Ga0500650_0164227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

123

197

0.87

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

53

189

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

75

205

0.84

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

65

188

0.83

PF13420

Acetyltransf_4

Acetyltransferase (GNAT) domain

56

209

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

102

190

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ae6-assembly1.cif.gz_D crystal structure of acetyltransferase of gnat family from enterococcus faecalis v583 0.8873 25 184
2ge3-assembly1.cif.gz_B crystal structure of probable acetyltransferase from agrobacterium tumefaciens 0.8867 24 184
3ld2-assembly3.cif.gz_C the crystal structure of smu.2055 from streptococcus mutans ua159 0.8847 26 186
5jtf-assembly1.cif.gz_B crystal structure of arsn n-acetyltransferase from pseudomonas putida kt2440 0.8836 24 187
5dwn-assembly2.cif.gz_C crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa <structure_details = 0.8835 24 186
ID Description Score Start End Superfamily
af_P46854_2_162_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9012 24 184 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8927 136 184 3.40.630.30
1y9wB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8912 73 184 3.40.630.30
6m7gE00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8884 24 187 3.40.630.30
1y9kD01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8858 73 167 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A524PCN1-F1-model_v4 deleted 0.9735 9 124
AF-A0A2M6ZNW7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9685 12 128 GO:0016747
AF-A0A662CEG5-F1-model_v4 N-acetyltransferase domain-containing protein 0.9621 4 186 GO:0016747
AF-A0A661JRG6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9616 8 155 GO:0016747
AF-A0A1W9MY96-F1-model_v4 N-acetyltransferase domain-containing protein 0.9512 9 186 GO:0016747

Map