F318395

General Info

Members Datasets Scaffolds Average Seq Length
208 130 416 80

Family's Representative Sequence

Representative Sequence 3300049651|Ga0501201_053521|Ga0501201_053521_146_442
Length 98
Sequence MLYVVFIMGAWLEKGGSAVARIEGVDPDRAQGPIKAVFEAQTKKWGAPFLNHLLYARRPTIFRGARAMWSGLDSSGLIDGKLVSLINRRVATINGCEF

Samples

Sample ID Description Type Environment
1 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
102 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
103 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
109 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
110 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
119 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
120 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
121 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
122 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
123 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
127 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
128 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 37.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501201_053521 3300049651 Unclassified 509
2 JGI25406J46586_10077190 3300003203 Unclassified 1029
3 Ga0065704_10698781 3300005289 Unclassified 560
4 Ga0065712_10162275 3300005290 Bacteria 1294
5 Ga0065715_10090325 3300005293 Bacteria 7209
6 Ga0070690_100002217 3300005330 Bacteria 10404
7 Ga0070670_100284606 3300005331 Unclassified 1444
8 Ga0068869_100002356 3300005334 Bacteria 11375
9 Ga0068869_100057538 3300005334 Unclassified 2839
10 Ga0068869_100282191 3300005334 Bacteria 1336
11 Ga0070680_100621116 3300005336 Bacteria 928
12 Ga0070682_100000091 3300005337 Bacteria 82460
13 Ga0070689_100181573 3300005340 Bacteria 1709
14 Ga0070689_101153460 3300005340 Unclassified 694
15 Ga0070692_10322501 3300005345 Bacteria 950
16 Ga0070669_100097139 3300005353 Bacteria 2217
17 Ga0070669_100109664 3300005353 Bacteria 2093
18 Ga0070669_101370212 3300005353 Bacteria 613
19 Ga0070669_101525147 3300005353 Bacteria 581
20 Ga0070675_100768762 3300005354 Unclassified 879
21 Ga0070671_100633097 3300005355 Unclassified 925
22 Ga0070674_101315164 3300005356 Unclassified 645
23 Ga0070673_100884592 3300005364 Unclassified 828
24 Ga0070701_10223835 3300005438 Bacteria 1123
25 Ga0070700_100088429 3300005441 Bacteria 2016
26 Ga0070700_100472068 3300005441 Unclassified 959
27 Ga0070700_100750082 3300005441 Unclassified 781
28 Ga0070700_100938523 3300005441 Unclassified 707
29 Ga0070694_100008906 3300005444 Bacteria 6147
30 Ga0070694_100302578 3300005444 Bacteria 1226
31 Ga0070694_101624086 3300005444 Unclassified 549
32 Ga0070708_100593175 3300005445 Unclassified 1044
33 Ga0068867_100052971 3300005459 Bacteria 2996
34 Ga0070706_100004218 3300005467 Bacteria 13949
35 Ga0070706_100724186 3300005467 Bacteria 922
36 Ga0070707_101468129 3300005468 Unclassified 649
37 Ga0070698_100030813 3300005471 Bacteria 5562
38 Ga0070698_101184628 3300005471 Bacteria 713
39 Ga0070699_100029126 3300005518 Bacteria 4761
40 Ga0070699_100251435 3300005518 Bacteria 1579
41 Ga0070699_101415853 3300005518 Bacteria 638
42 Ga0070684_101667556 3300005535 Bacteria 601
43 Ga0070697_100000100 3300005536 Bacteria 70649
44 Ga0070697_100121300 3300005536 Bacteria 2187
45 Ga0070697_100239174 3300005536 Unclassified 1550
46 Ga0070697_100338375 3300005536 Bacteria 1298
47 Ga0070697_100545174 3300005536 Bacteria 1017
48 Ga0070686_100760553 3300005544 Bacteria 778
49 Ga0070695_100034793 3300005545 Bacteria 3161
50 Ga0070696_100025225 3300005546 Bacteria 4040
51 Ga0070696_100261554 3300005546 Bacteria 1312
52 Ga0070696_100375666 3300005546 Unclassified 1106
53 Ga0070696_100451812 3300005546 Bacteria 1014
54 Ga0070696_100894214 3300005546 Unclassified 736
55 Ga0070693_100016379 3300005547 Bacteria 3836
56 Ga0070693_100640558 3300005547 Unclassified 772
57 Ga0070704_100051539 3300005549 Bacteria 2899
58 Ga0070704_100109650 3300005549 Bacteria 2098
59 Ga0070704_100192909 3300005549 Unclassified 1639
60 Ga0068855_101436954 3300005563 Unclassified 710
61 Ga0068854_100036985 3300005578 Bacteria 3424
62 Ga0068854_101106078 3300005578 Unclassified 706
63 Ga0070702_100647214 3300005615 Bacteria 799
64 Ga0070702_101797872 3300005615 Unclassified 512
65 Ga0068861_100489981 3300005719 Bacteria 1109
66 Ga0068861_101112251 3300005719 Bacteria 760
67 Ga0068861_101205221 3300005719 Unclassified 732
68 Ga0068861_101304469 3300005719 Bacteria 706
69 Ga0068870_10629944 3300005840 Unclassified 732
70 Ga0068860_100197386 3300005843 Bacteria 1949
71 Ga0068860_101859267 3300005843 Unclassified 624
72 Ga0068862_100042313 3300005844 Bacteria 3881
73 Ga0081538_10029146 3300005981 Bacteria 3778
74 Ga0081539_10000900 3300005985 Bacteria 56522
75 Ga0081539_10025971 3300005985 Bacteria 3752
76 Ga0081539_10032506 3300005985 Bacteria 3195
77 Ga0075433_10143078 3300006852 Bacteria 2126
78 Ga0075433_11459767 3300006852 Bacteria 591
79 Ga0075434_100035890 3300006871 Bacteria 4902
80 Ga0075434_100616188 3300006871 Bacteria 1104
81 Ga0075434_100704381 3300006871 Bacteria 1027
82 Ga0075429_101840190 3300006880 Bacteria 525
83 Ga0068865_101053107 3300006881 Unclassified 714
84 Ga0075435_100308831 3300007076 Unclassified 1353
85 Ga0075435_100390683 3300007076 Unclassified 1196
86 Ga0111539_10015244 3300009094 Bacteria 9574
87 Ga0105245_10000024 3300009098 Bacteria 178565
88 Ga0105245_10229520 3300009098 Unclassified 1795
89 Ga0105245_10787312 3300009098 Unclassified 988
90 Ga0114129_10034598 3300009147 Bacteria 7137
91 Ga0114129_10385714 3300009147 Bacteria 1849
92 Ga0114129_10710645 3300009147 Bacteria 1291
93 Ga0105243_10296998 3300009148 Bacteria 1462
94 Ga0105243_10387041 3300009148 Unclassified 1295
95 Ga0105243_12282022 3300009148 Bacteria 579
96 Ga0105241_12034102 3300009174 Unclassified 566
97 Ga0105242_10209940 3300009176 Bacteria 1735
98 Ga0105242_10258373 3300009176 Bacteria 1572
99 Ga0105242_10288716 3300009176 Unclassified 1493
100 Ga0105242_13050050 3300009176 Bacteria 519
101 Ga0105237_10879227 3300009545 Unclassified 903
102 Ga0105249_10015645 3300009553 Bacteria 6717
103 Ga0105246_10802383 3300011119 Bacteria 835
104 Ga0105246_10969878 3300011119 Unclassified 767
105 Ga0157374_10000010 3300013296 Bacteria 505635
106 Ga0157378_10455423 3300013297 Unclassified 1270
107 Ga0157378_10704038 3300013297 Unclassified 1030
108 Ga0157378_11890919 3300013297 Unclassified 646
109 Ga0157372_11014894 3300013307 Bacteria 961
110 Ga0157375_10076723 3300013308 Bacteria 3370
111 Ga0157375_10104302 3300013308 Unclassified 2924
112 Ga0157375_11716186 3300013308 Unclassified 744
113 Ga0157375_11899302 3300013308 Bacteria 707
114 Ga0163163_10324552 3300014325 Bacteria 1593
115 Ga0163163_10387064 3300014325 Unclassified 1456
116 Ga0157380_10021651 3300014326 Bacteria 4825
117 Ga0157377_10000019 3300014745 Bacteria 171658
118 Ga0157379_10277297 3300014968 Bacteria 1525
119 Ga0213873_10000264 3300021358 Bacteria 9061
120 Ga0213876_10000012 3300021384 Bacteria 396530
121 Ga0207688_11081911 3300025901 Unclassified 506
122 Ga0207645_10055416 3300025907 Bacteria 2531
123 Ga0207645_10897514 3300025907 Bacteria 602
124 Ga0207684_10041794 3300025910 Bacteria 3886
125 Ga0207684_10315353 3300025910 Unclassified 1348
126 Ga0207654_11399729 3300025911 Unclassified 510
127 Ga0207646_11372852 3300025922 Unclassified 615
128 Ga0207681_10098051 3300025923 Bacteria 2108
129 Ga0207681_11418391 3300025923 Bacteria 583
130 Ga0207694_10000001 3300025924 Bacteria 4078485
131 Ga0207650_10363157 3300025925 Unclassified 1193
132 Ga0207687_10000003 3300025927 Bacteria 875159
133 Ga0207644_10512594 3300025931 Bacteria 990
134 Ga0207706_10184260 3300025933 Bacteria 1833
135 Ga0207686_11013888 3300025934 Bacteria 674
136 Ga0207686_11645124 3300025934 Unclassified 531
137 Ga0207709_10315572 3300025935 Bacteria 1168
138 Ga0207709_10433398 3300025935 Bacteria 1012
139 Ga0207709_11163023 3300025935 Unclassified 635
140 Ga0207670_10211514 3300025936 Bacteria 1479
141 Ga0207704_10521888 3300025938 Bacteria 961
142 Ga0207711_11971083 3300025941 Unclassified 527
143 Ga0207689_10002839 3300025942 Bacteria 15982
144 Ga0207689_10005442 3300025942 Bacteria 11396
145 Ga0207689_10041851 3300025942 Bacteria 3790
146 Ga0207661_10772969 3300025944 Bacteria 884
147 Ga0207712_10005291 3300025961 Bacteria 8151
148 Ga0207640_10029776 3300025981 Bacteria 3355
149 Ga0207677_10285048 3300026023 Bacteria 1358
150 Ga0207708_10045360 3300026075 Unclassified 3350
151 Ga0207708_10070488 3300026075 Unclassified 2676
152 Ga0207708_10507108 3300026075 Unclassified 1012
153 Ga0207648_10093178 3300026089 Bacteria 2635
154 Ga0207676_10971896 3300026095 Unclassified 836
155 Ga0207675_100593777 3300026118 Bacteria 1110
156 Ga0207428_10222712 3300027907 Bacteria 1413
157 Ga0268265_10110636 3300028380 Bacteria 2242
158 Ga0268265_10202937 3300028380 Bacteria 1721
159 Ga0268265_10205782 3300028380 Unclassified 1711
160 Ga0268264_10144988 3300028381 Bacteria 2122
161 Ga0307408_100261331 3300031548 Unclassified 1433
162 Ga0307408_101454840 3300031548 Unclassified 647
163 Ga0307406_10716741 3300031901 Unclassified 837
164 Ga0307409_100984574 3300031995 Bacteria 861
165 Ga0307409_101207202 3300031995 Bacteria 780
166 Ga0307416_100130822 3300032002 Unclassified 2259
167 Ga0307416_100697549 3300032002 Unclassified 1104
168 Ga0307416_100911050 3300032002 Bacteria 980
169 Ga0307416_101654296 3300032002 Bacteria 745
170 Ga0307416_102341826 3300032002 Unclassified 634
171 Ga0307415_100089028 3300032126 Unclassified 2229
172 Ga0395901_1084923 3300038443 Bacteria 772
173 Ga0395901_1239055 3300038443 Bacteria 710
174 Ga0436363_0719016 3300039450 Bacteria 953
175 Ga0436362_0155564 3300039453 Bacteria 12969
176 Ga0439434_0059894 3300042435 Bacteria 1189
177 Ga0466966_0974262 3300044684 Bacteria 512
178 Ga0495610_0034920 3300046512 Bacteria 2586
179 Ga0495620_0262572 3300046515 Unclassified 658
180 Ga0495663_0000092 3300046525 Bacteria 39532
181 Ga0495598_0000258 3300046537 Bacteria 9546
182 Ga0495598_0309540 3300046537 Unclassified 599
183 Ga0495621_0021946 3300046539 Unclassified 2110
184 Ga0495656_0056676 3300046615 Unclassified 1694
185 Ga0495668_0143239 3300046616 Unclassified 1308
186 Ga0495677_0379643 3300047445 Bacteria 559
187 Ga0501291_143582 3300049514 Unclassified 534
188 Ga0501034_1135238 3300049571 Bacteria 662
189 Ga0501040_0724067 3300049576 Bacteria 720
190 Ga0501047_0910252 3300049581 Bacteria 693
191 Ga0501072_0338572 3300049588 Bacteria 1195
192 Ga0501251_037236 3300049681 Unclassified 721
193 Ga0501221_162928 3300049704 Unclassified 599
194 Ga0501225_0107048 3300049705 Unclassified 821
195 Ga0501083_0936670 3300049744 Bacteria 564
196 Ga0501264_040935 3300049761 Unclassified 568
197 Ga0501268_081249 3300049765 Unclassified 670
198 nmdc:mga05p37_1131295_c1 3300050507 Unclassified 816
199 nmdc:mga05p37_195609_c1 3300050507 Unclassified 2452
200 nmdc:mga05p37_636687_c1 3300050507 Bacteria 1197
201 nmdc:mga09592_551035_c1 3300050508 Bacteria 990
202 nmdc:mga08y16_166353_c1 3300050511 Bacteria 2291
203 nmdc:mga0n895_12819_c1 3300050512 Bacteria 7532
204 nmdc:mga0n895_297549_c1 3300050512 Bacteria 1636
205 nmdc:mga0rr50_249712_c1 3300050513 Bacteria 1473
206 nmdc:mga0a205_1150915_c1 3300050515 Unclassified 623
207 nmdc:mga0a205_11715_c1 3300050515 Bacteria 8089
208 Ga0590075_107808 3300059424 Bacteria 727
209 Ga0501201_053521
210 JGI25406J46586_10077190
211 Ga0065704_10698781
212 Ga0065712_10162275
213 Ga0065715_10090325
214 Ga0070690_100002217
215 Ga0070670_100284606
216 Ga0068869_100002356
217 Ga0068869_100057538
218 Ga0068869_100282191
219 Ga0070680_100621116
220 Ga0070682_100000091
221 Ga0070689_100181573
222 Ga0070689_101153460
223 Ga0070692_10322501
224 Ga0070669_100097139
225 Ga0070669_100109664
226 Ga0070669_101370212
227 Ga0070669_101525147
228 Ga0070675_100768762
229 Ga0070671_100633097
230 Ga0070674_101315164
231 Ga0070673_100884592
232 Ga0070701_10223835
233 Ga0070700_100088429
234 Ga0070700_100472068
235 Ga0070700_100750082
236 Ga0070700_100938523
237 Ga0070694_100008906
238 Ga0070694_100302578
239 Ga0070694_101624086
240 Ga0070708_100593175
241 Ga0068867_100052971
242 Ga0070706_100004218
243 Ga0070706_100724186
244 Ga0070707_101468129
245 Ga0070698_100030813
246 Ga0070698_101184628
247 Ga0070699_100029126
248 Ga0070699_100251435
249 Ga0070699_101415853
250 Ga0070684_101667556
251 Ga0070697_100000100
252 Ga0070697_100121300
253 Ga0070697_100239174
254 Ga0070697_100338375
255 Ga0070697_100545174
256 Ga0070686_100760553
257 Ga0070695_100034793
258 Ga0070696_100025225
259 Ga0070696_100261554
260 Ga0070696_100375666
261 Ga0070696_100451812
262 Ga0070696_100894214
263 Ga0070693_100016379
264 Ga0070693_100640558
265 Ga0070704_100051539
266 Ga0070704_100109650
267 Ga0070704_100192909
268 Ga0068855_101436954
269 Ga0068854_100036985
270 Ga0068854_101106078
271 Ga0070702_100647214
272 Ga0070702_101797872
273 Ga0068861_100489981
274 Ga0068861_101112251
275 Ga0068861_101205221
276 Ga0068861_101304469
277 Ga0068870_10629944
278 Ga0068860_100197386
279 Ga0068860_101859267
280 Ga0068862_100042313
281 Ga0081538_10029146
282 Ga0081539_10000900
283 Ga0081539_10025971
284 Ga0081539_10032506
285 Ga0075433_10143078
286 Ga0075433_11459767
287 Ga0075434_100035890
288 Ga0075434_100616188
289 Ga0075434_100704381
290 Ga0075429_101840190
291 Ga0068865_101053107
292 Ga0075435_100308831
293 Ga0075435_100390683
294 Ga0111539_10015244
295 Ga0105245_10000024
296 Ga0105245_10229520
297 Ga0105245_10787312
298 Ga0114129_10034598
299 Ga0114129_10385714
300 Ga0114129_10710645
301 Ga0105243_10296998
302 Ga0105243_10387041
303 Ga0105243_12282022
304 Ga0105241_12034102
305 Ga0105242_10209940
306 Ga0105242_10258373
307 Ga0105242_10288716
308 Ga0105242_13050050
309 Ga0105237_10879227
310 Ga0105249_10015645
311 Ga0105246_10802383
312 Ga0105246_10969878
313 Ga0157374_10000010
314 Ga0157378_10455423
315 Ga0157378_10704038
316 Ga0157378_11890919
317 Ga0157372_11014894
318 Ga0157375_10076723
319 Ga0157375_10104302
320 Ga0157375_11716186
321 Ga0157375_11899302
322 Ga0163163_10324552
323 Ga0163163_10387064
324 Ga0157380_10021651
325 Ga0157377_10000019
326 Ga0157379_10277297
327 Ga0213873_10000264
328 Ga0213876_10000012
329 Ga0207688_11081911
330 Ga0207645_10055416
331 Ga0207645_10897514
332 Ga0207684_10041794
333 Ga0207684_10315353
334 Ga0207654_11399729
335 Ga0207646_11372852
336 Ga0207681_10098051
337 Ga0207681_11418391
338 Ga0207694_10000001
339 Ga0207650_10363157
340 Ga0207687_10000003
341 Ga0207644_10512594
342 Ga0207706_10184260
343 Ga0207686_11013888
344 Ga0207686_11645124
345 Ga0207709_10315572
346 Ga0207709_10433398
347 Ga0207709_11163023
348 Ga0207670_10211514
349 Ga0207704_10521888
350 Ga0207711_11971083
351 Ga0207689_10002839
352 Ga0207689_10005442
353 Ga0207689_10041851
354 Ga0207661_10772969
355 Ga0207712_10005291
356 Ga0207640_10029776
357 Ga0207677_10285048
358 Ga0207708_10045360
359 Ga0207708_10070488
360 Ga0207708_10507108
361 Ga0207648_10093178
362 Ga0207676_10971896
363 Ga0207675_100593777
364 Ga0207428_10222712
365 Ga0268265_10110636
366 Ga0268265_10202937
367 Ga0268265_10205782
368 Ga0268264_10144988
369 Ga0307408_100261331
370 Ga0307408_101454840
371 Ga0307406_10716741
372 Ga0307409_100984574
373 Ga0307409_101207202
374 Ga0307416_100130822
375 Ga0307416_100697549
376 Ga0307416_100911050
377 Ga0307416_101654296
378 Ga0307416_102341826
379 Ga0307415_100089028
380 Ga0395901_1084923
381 Ga0395901_1239055
382 Ga0436363_0719016
383 Ga0436362_0155564
384 Ga0439434_0059894
385 Ga0466966_0974262
386 Ga0495610_0034920
387 Ga0495620_0262572
388 Ga0495663_0000092
389 Ga0495598_0000258
390 Ga0495598_0309540
391 Ga0495621_0021946
392 Ga0495656_0056676
393 Ga0495668_0143239
394 Ga0495677_0379643
395 Ga0501291_143582
396 Ga0501034_1135238
397 Ga0501040_0724067
398 Ga0501047_0910252
399 Ga0501072_0338572
400 Ga0501251_037236
401 Ga0501221_162928
402 Ga0501225_0107048
403 Ga0501083_0936670
404 Ga0501264_040935
405 Ga0501268_081249
406 nmdc:mga05p37_1131295_c1
407 nmdc:mga05p37_195609_c1
408 nmdc:mga05p37_636687_c1
409 nmdc:mga09592_551035_c1
410 nmdc:mga08y16_166353_c1
411 nmdc:mga0n895_12819_c1
412 nmdc:mga0n895_297549_c1
413 nmdc:mga0rr50_249712_c1
414 nmdc:mga0a205_1150915_c1
415 nmdc:mga0a205_11715_c1
416 Ga0590075_107808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map