F318289

General Info

Members Datasets Scaffolds Average Seq Length
208 142 198 286

Family's Representative Sequence

Representative Sequence 3300046810|Ga0495660_0011495|Ga0495660_0011495_2223_3170
Length 315
Sequence MSFPHSAKCLNTSDICIVNQIKTIMKKVFNQSGILRPVLSITLFFITMFQSNAQQNKPVQSGYAPVNGIKVYYEVYGEGKPIILLHGAFMTIEGNWAQIIPELSKTRKVIALEMQGHGHTPYSDRPLTHANMARDVEGVMDYLKVDSADVVGYSMGGSVAYKFAIQSPKRLKKLVIISSTYKSTGWNPEINAAFKTFKPEFFDKTPMHAAYDAVAPDKTKWTKFIEQMIAFAPQPFDFGDDNIAKITAPVLIIAGDNDGIDKVELAKTYKLLGGGVAADMAPMPKSHLAIVPAQSHVGLMMQTDVILGYLNGFLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
3 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
4 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
5 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
6 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
7 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
8 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
9 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
10 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
11 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
104 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
129 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.19
Metatranscriptomes 0
Isolates 4.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.69
Nodule 0
Rhizoplane 0
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3787179 2162886007 Bacteria 1788
2 JGI24736J21556_1005213 3300001904 Bacteria 2198
3 JGI24739J22299_10021033 3300001989 Bacteria 2326
4 JGI24737J22298_10003720 3300001990 Bacteria 5369
5 JGI24737J22298_10018452 3300001990 Bacteria 2239
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI25162J39368_1000056 3300002737 Bacteria 146755
8 JGI25162J39368_1002071 3300002737 Bacteria 8618
9 JGI25164J39214_1001707 3300002772 Bacteria 4438
10 JGI25165J46597_1001525 3300003214 Bacteria 11618
11 rootH2_10001521 3300003320 Bacteria 67147
12 rootH2_10116827 3300003320 Bacteria 2479
13 rootL2_10079710 3300003322 Bacteria 3023
14 rootH1_10087285 3300003323 Bacteria 4286
15 rootH1_10105137 3300003323 Bacteria 2350
16 rootH1_10165380 3300003323 Bacteria 2767
17 Ga0055536_1000010 3300003781 Bacteria 304614
18 Ga0055530_10000816 3300003791 Bacteria 25857
19 Ga0065165_1000888 3300005262 Bacteria 38643
20 Ga0065714_10008444 3300005288 Bacteria 2808
21 Ga0065704_10071392 3300005289 Bacteria 11347
22 Ga0070658_10208103 3300005327 Bacteria 1652
23 Ga0070676_10009577 3300005328 Bacteria 5233
24 Ga0070670_100029275 3300005331 Bacteria 4739
25 Ga0070670_100264487 3300005331 Bacteria 1500
26 Ga0070666_10041448 3300005335 Bacteria 3077
27 Ga0068868_100016338 3300005338 Bacteria 5511
28 Ga0068868_100081523 3300005338 Bacteria 2594
29 Ga0070660_100028358 3300005339 Bacteria 4188
30 Ga0070671_100040638 3300005355 Bacteria 3864
31 Ga0070659_100306733 3300005366 Bacteria 1325
32 Ga0070678_100026091 3300005456 Bacteria 3944
33 Ga0070662_100000117 3300005457 Bacteria 44433
34 Ga0068867_100008871 3300005459 Bacteria 7094
35 Ga0070685_10229495 3300005466 Bacteria 1220
36 Ga0068853_100004438 3300005539 Bacteria 10870
37 Ga0068853_100111779 3300005539 Bacteria 2427
38 Ga0068855_100174955 3300005563 Bacteria 2429
39 Ga0068855_100230948 3300005563 Bacteria 2072
40 Ga0068856_100005536 3300005614 Bacteria 12437
41 Ga0068856_100152033 3300005614 Bacteria 2324
42 Ga0068856_100682757 3300005614 Bacteria 1047
43 Ga0068852_100002089 3300005616 Bacteria 13647
44 Ga0068852_100086119 3300005616 Bacteria 2800
45 Ga0068852_100109264 3300005616 Bacteria 2511
46 Ga0068863_100408391 3300005841 Bacteria 1329
47 Ga0068860_100012793 3300005843 Bacteria 8250
48 Ga0081540_1002530 3300005983 Bacteria 14834
49 Ga0097621_100000780 3300006237 Bacteria 22337
50 Ga0068871_100000296 3300006358 Bacteria 34815
51 Ga0068865_100000025 3300006881 Bacteria 94590
52 Ga0105240_10000008 3300009093 Bacteria 618862
53 Ga0105240_10000044 3300009093 Bacteria 250257
54 Ga0105240_10000329 3300009093 Bacteria 89375
55 Ga0105240_10001190 3300009093 Bacteria 45471
56 Ga0105240_10028282 3300009093 Bacteria 7323
57 Ga0105240_10129165 3300009093 Unclassified 3033
58 Ga0105240_10318773 3300009093 Bacteria 1772
59 Ga0105240_10514392 3300009093 Unclassified 1329
60 Ga0111539_10948444 3300009094 Bacteria 1000
61 Ga0105243_10000127 3300009148 Bacteria 86196
62 Ga0105241_10000093 3300009174 Bacteria 67365
63 Ga0105241_10001239 3300009174 Bacteria 19476
64 Ga0105241_10019613 3300009174 Bacteria 4988
65 Ga0105242_10281191 3300009176 Bacteria 1511
66 Ga0105242_10461883 3300009176 Bacteria 1199
67 Ga0105237_10001395 3300009545 Bacteria 31908
68 Ga0105237_10041755 3300009545 Bacteria 4625
69 Ga0105237_10084578 3300009545 Bacteria 3163
70 Ga0105237_10086821 3300009545 Bacteria 3118
71 Ga0105238_10016309 3300009551 Bacteria 7519
72 Ga0105238_10072001 3300009551 Bacteria 3454
73 Ga0105238_10131908 3300009551 Bacteria 2477
74 Ga0105239_10000007 3300010375 Bacteria 385297
75 Ga0105239_10000355 3300010375 Bacteria 67024
76 Ga0105239_10000533 3300010375 Bacteria 55092
77 Ga0105239_10000610 3300010375 Bacteria 50916
78 Ga0105239_10003844 3300010375 Bacteria 18236
79 Ga0105239_10102394 3300010375 Bacteria 3169
80 Ga0105239_10497058 3300010375 Bacteria 1386
81 Ga0157373_10170922 3300013100 Bacteria 1529
82 Ga0157371_10027358 3300013102 Bacteria 4137
83 Ga0157371_10185640 3300013102 Bacteria 1488
84 Ga0157370_10114390 3300013104 Bacteria 2521
85 Ga0157369_10088836 3300013105 Bacteria 3299
86 Ga0157369_10153080 3300013105 Unclassified 2437
87 Ga0157369_10173074 3300013105 Bacteria 2274
88 Ga0157374_10001775 3300013296 Bacteria 18142
89 Ga0157374_10016593 3300013296 Bacteria 6477
90 Ga0157374_10674623 3300013296 Unclassified 1046
91 Ga0157378_10018667 3300013297 Bacteria 6097
92 Ga0157378_10069168 3300013297 Bacteria 3167
93 Ga0163162_10000441 3300013306 Bacteria 38333
94 Ga0157372_10018673 3300013307 Bacteria 7460
95 Ga0157372_10035633 3300013307 Bacteria 5479
96 Ga0157372_10346308 3300013307 Bacteria 1731
97 Ga0157375_10080542 3300013308 Bacteria 3295
98 Ga0157380_10000855 3300014326 Bacteria 19105
99 Ga0182008_10000233 3300014497 Bacteria 43334
100 Ga0157376_10431351 3300014969 Bacteria 1281
101 Ga0182006_1000011 3300015261 Bacteria 408647
102 Ga0163161_10000902 3300017792 Bacteria 23001
103 Ga0207427_100060 3300025231 Bacteria 186274
104 Ga0209437_100021 3300025233 Bacteria 646400
105 Ga0209437_100124 3300025233 Bacteria 199789
106 Ga0209129_1007610 3300025258 Bacteria 3183
107 Ga0209233_1000035 3300025261 Bacteria 568478
108 Ga0209676_1000009 3300025292 Bacteria 981719
109 Ga0209050_1000103 3300025298 Bacteria 229225
110 Ga0207680_10037272 3300025903 Bacteria 2806
111 Ga0207647_10000021 3300025904 Bacteria 121592
112 Ga0207645_10006715 3300025907 Bacteria 8225
113 Ga0207654_10000439 3300025911 Bacteria 23836
114 Ga0207654_10030884 3300025911 Bacteria 2946
115 Ga0207695_10000013 3300025913 Bacteria 821265
116 Ga0207695_10000021 3300025913 Bacteria 679399
117 Ga0207695_10000039 3300025913 Bacteria 454801
118 Ga0207695_10004645 3300025913 Bacteria 18607
119 Ga0207695_10008936 3300025913 Bacteria 12471
120 Ga0207695_10093606 3300025913 Unclassified 3014
121 Ga0207695_10220238 3300025913 Bacteria 1805
122 Ga0207671_10002343 3300025914 Bacteria 20429
123 Ga0207671_10008004 3300025914 Bacteria 9051
124 Ga0207671_10009451 3300025914 Bacteria 8149
125 Ga0207671_10023262 3300025914 Bacteria 4674
126 Ga0207671_10049895 3300025914 Bacteria 3099
127 Ga0207671_10051203 3300025914 Bacteria 3059
128 Ga0207657_10029432 3300025919 Bacteria 4999
129 Ga0207694_10034290 3300025924 Bacteria 3891
130 Ga0207650_10107254 3300025925 Bacteria 2158
131 Ga0207650_10234461 3300025925 Bacteria 1481
132 Ga0207644_10013125 3300025931 Bacteria 5515
133 Ga0207690_10055656 3300025932 Bacteria 2665
134 Ga0207706_10000088 3300025933 Bacteria 94903
135 Ga0207709_10000176 3300025935 Bacteria 86175
136 Ga0207669_10033081 3300025937 Bacteria 2913
137 Ga0207704_10000185 3300025938 Bacteria 32739
138 Ga0207691_10311926 3300025940 Bacteria 1350
139 Ga0207667_10000070 3300025949 Bacteria 180479
140 Ga0207667_10203595 3300025949 Bacteria 2030
141 Ga0207677_10094222 3300026023 Bacteria 2185
142 Ga0207677_10260807 3300026023 Bacteria 1412
143 Ga0207703_10114666 3300026035 Bacteria 2305
144 Ga0207639_10008221 3300026041 Bacteria 7145
145 Ga0207639_10012286 3300026041 Bacteria 5963
146 Ga0207702_10000402 3300026078 Bacteria 49308
147 Ga0207641_10686569 3300026088 Bacteria 1007
148 Ga0207648_10012348 3300026089 Bacteria 7998
149 Ga0207683_10077660 3300026121 Bacteria 2941
150 Ga0207698_10069465 3300026142 Bacteria 2786
151 Ga0207698_10200988 3300026142 Bacteria 1784
152 Ga0268264_10002288 3300028381 Bacteria 16965
153 Ga0316177_1156429 3300030731 Bacteria 4329
154 Ga0316176_1020492 3300030732 Bacteria 55335
155 Ga0307513_10270710 3300031456 Bacteria 1482
156 Ga0307509_10048188 3300031507 Unclassified 4578
157 Ga0307516_10003590 3300031730 Bacteria 19774
158 Ga0307407_10000007 3300031903 Bacteria 210716
159 Ga0307416_100000015 3300032002 Bacteria 210716
160 Ga0307507_10000144 3300033179 Bacteria 123842
161 Ga0395899_0001130 3300037312 Bacteria 23618
162 Ga0395900_0000115 3300037418 Bacteria 138474
163 Ga0395900_0016691 3300037418 Bacteria 7490
164 Ga0395898_0031064 3300037466 Bacteria 5342
165 Ga0395905_0000045 3300037471 Bacteria 241370
166 Ga0395905_0000579 3300037471 Bacteria 49357
167 Ga0395901_0000254 3300038443 Bacteria 66508
168 Ga0395901_0015933 3300038443 Bacteria 7658
169 Ga0466964_0055644 3300044706 Unclassified 1634
170 Ga0466968_0167386 3300044735 Unclassified 1017
171 Ga0466970_0234410 3300044765 Bacteria 1026
172 Ga0495638_0000006 3300046460 Bacteria 668846
173 Ga0495638_0093907 3300046460 Bacteria 1803
174 Ga0495596_0001478 3300046500 Bacteria 13427
175 Ga0495606_0004011 3300046507 Bacteria 15017
176 Ga0495610_0000001 3300046512 Bacteria 1620061
177 Ga0495610_0000347 3300046512 Bacteria 48803
178 Ga0495616_0002378 3300046513 Bacteria 12525
179 Ga0495609_0005796 3300046538 Bacteria 6413
180 Ga0495633_0005968 3300046558 Bacteria 7318
181 Ga0495668_0013953 3300046616 Bacteria 4723
182 Ga0495625_0000586 3300046660 Bacteria 52844
183 Ga0495661_0006795 3300046665 Bacteria 8017
184 Ga0495660_0011495 3300046810 Bacteria 5135
185 Ga0495687_000763 3300047443 Bacteria 34801
186 Ga0495686_0008390 3300047472 Bacteria 7582
187 Ga0496122_0000090 3300048925 Bacteria 205886
188 Ga0496123_0024103 3300048926 Bacteria 4635
189 Ga0496124_0101705 3300048927 Bacteria 2328
190 Ga0496126_0489837 3300048929 Bacteria 984
191 Ga0501033_0177606 3300049570 Bacteria 1527
192 Ga0501034_0079819 3300049571 Bacteria 3276
193 Ga0501034_0185150 3300049571 Bacteria 2046
194 Ga0501259_037789 3300049688 Bacteria 938
195 Ga0501035_0024748 3300049822 Bacteria 5504
196 Ga0501044_0054586 3300049823 Bacteria 4106
197 Ga0500644_0070160 3300053088 Bacteria 1261
198 Ga0500568_0121669 3300053139 Bacteria 972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_10000007 Ga0307407_1000000754 252
2 3300032002 Ga0307416_100000015 Ga0307416_100000015132 252
3 3300025940 Ga0207691_10311926 Ga0207691_103119261 256
4 iso_pu_bacteria 2945997725 2946002672 265
5 iso_pu_bacteria 2929921140 2929924675 267
6 3300013308 Ga0157375_10080542 Ga0157375_100805422 268
7 3300048929 Ga0496126_0489837 Ga0496126_0489837_134_946 270
8 3300003323 rootH1_10105137 rootH1_101051372 271
9 3300005262 Ga0065165_1000888 Ga0065165_100088828 271
10 3300005327 Ga0070658_10208103 Ga0070658_102081033 271
11 3300005843 Ga0068860_100012793 Ga0068860_1000127935 271
12 3300009093 Ga0105240_10000329 Ga0105240_1000032959 271
13 3300009094 Ga0111539_10948444 Ga0111539_109484441 271
14 3300009545 Ga0105237_10086821 Ga0105237_100868213 271
15 3300009551 Ga0105238_10016309 Ga0105238_100163096 271
16 3300010375 Ga0105239_10000007 Ga0105239_10000007320 271
17 3300013102 Ga0157371_10185640 Ga0157371_101856404 271
18 3300013105 Ga0157369_10088836 Ga0157369_100888364 271
19 3300013307 Ga0157372_10035633 Ga0157372_100356335 271
20 3300014326 Ga0157380_10000855 Ga0157380_1000085513 271
21 3300014497 Ga0182008_10000233 Ga0182008_1000023326 271
22 3300017792 Ga0163161_10000902 Ga0163161_100009026 271
23 3300025937 Ga0207669_10033081 Ga0207669_100330812 271
24 3300028381 Ga0268264_10002288 Ga0268264_100022884 271
25 3300046460 Ga0495638_0000006 Ga0495638_0000006_288162_288977 271
26 3300053088 Ga0500644_0070160 Ga0500644_0070160_18_833 271
27 3300053139 Ga0500568_0121669 Ga0500568_0121669_42_857 271
28 3300009093 Ga0105240_10000044 Ga0105240_10000044112 273
29 3300009174 Ga0105241_10000093 Ga0105241_1000009313 273
30 3300009174 Ga0105241_10001239 Ga0105241_1000123912 273
31 3300010375 Ga0105239_10003844 Ga0105239_100038449 273
32 3300013100 Ga0157373_10170922 Ga0157373_101709221 273
33 3300013102 Ga0157371_10027358 Ga0157371_100273583 273
34 3300013105 Ga0157369_10173074 Ga0157369_101730742 273
35 3300013296 Ga0157374_10001775 Ga0157374_100017754 273
36 3300025913 Ga0207695_10000013 Ga0207695_10000013586 273
37 3300046538 Ga0495609_0005796 Ga0495609_0005796_4783_5604 273
38 3300049688 Ga0501259_037789 Ga0501259_037789_73_894 273
39 3300013297 Ga0157378_10018667 Ga0157378_100186674 274
40 3300010375 Ga0105239_10000355 Ga0105239_1000035533 275
41 3300015261 Ga0182006_1000011 Ga0182006_100001126 276
42 3300031507 Ga0307509_10048188 Ga0307509_100481884 280
43 3300005983 Ga0081540_1002530 Ga0081540_10025305 281
44 3300009093 Ga0105240_10000008 Ga0105240_10000008341 281
45 3300025913 Ga0207695_10000021 Ga0207695_1000002159 281
46 3300025913 Ga0207695_10093606 Ga0207695_100936061 281
47 3300010375 Ga0105239_10000610 Ga0105239_1000061034 283
48 iso_pu_bacteria 2585428185 2588224197 283
49 iso_pu_bacteria 2905999023 2906003141 283
50 iso_pu_bacteria 2932082852 2932083151 283
51 3300005539 Ga0068853_100004438 Ga0068853_1000044382 284
52 3300005616 Ga0068852_100109264 Ga0068852_1001092642 284
53 3300009093 Ga0105240_10514392 Ga0105240_105143922 284
54 3300010375 Ga0105239_10102394 Ga0105239_101023942 284
55 3300013296 Ga0157374_10674623 Ga0157374_106746231 284
56 3300025913 Ga0207695_10008936 Ga0207695_100089366 284
57 3300026041 Ga0207639_10012286 Ga0207639_100122865 284
58 iso_pu_bacteria 2585428045 2587679729 284
59 iso_pu_bacteria 2588254255 2590601033 284
60 iso_pu_bacteria 2588254257 2590614215 284
61 iso_pu_bacteria 2739367874 2740057125 284
62 iso_pu_bacteria 2842083920 2842083967 284
63 3300005331 Ga0070670_100264487 Ga0070670_1002644872 286
64 3300025925 Ga0207650_10234461 Ga0207650_102344611 286
65 3300001989 JGI24739J22299_10021033 JGI24739J22299_100210331 287
66 3300001990 JGI24737J22298_10003720 JGI24737J22298_1000372011 287
67 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002515 287
68 3300003320 rootH2_10116827 rootH2_101168273 287
69 3300003323 rootH1_10087285 rootH1_100872852 287
70 3300003781 Ga0055536_1000010 Ga0055536_100001090 287
71 3300003791 Ga0055530_10000816 Ga0055530_100008168 287
72 3300005331 Ga0070670_100029275 Ga0070670_1000292754 287
73 3300005335 Ga0070666_10041448 Ga0070666_100414482 287
74 3300005338 Ga0068868_100016338 Ga0068868_1000163383 287
75 3300005466 Ga0070685_10229495 Ga0070685_102294951 287
76 3300005563 Ga0068855_100174955 Ga0068855_1001749551 287
77 3300005563 Ga0068855_100230948 Ga0068855_1002309482 287
78 3300005614 Ga0068856_100682757 Ga0068856_1006827571 287
79 3300009093 Ga0105240_10001190 Ga0105240_1000119021 287
80 3300009093 Ga0105240_10318773 Ga0105240_103187733 287
81 3300009176 Ga0105242_10461883 Ga0105242_104618831 287
82 3300009545 Ga0105237_10041755 Ga0105237_100417555 287
83 3300009545 Ga0105237_10084578 Ga0105237_100845783 287
84 3300009551 Ga0105238_10131908 Ga0105238_101319082 287
85 3300010375 Ga0105239_10497058 Ga0105239_104970581 287
86 3300013306 Ga0163162_10000441 Ga0163162_1000044125 287
87 3300025292 Ga0209676_1000009 Ga0209676_1000009785 287
88 3300025298 Ga0209050_1000103 Ga0209050_100010388 287
89 3300025903 Ga0207680_10037272 Ga0207680_100372722 287
90 3300025913 Ga0207695_10000039 Ga0207695_10000039193 287
91 3300025913 Ga0207695_10004645 Ga0207695_100046453 287
92 3300025913 Ga0207695_10220238 Ga0207695_102202383 287
93 3300025914 Ga0207671_10002343 Ga0207671_100023436 287
94 3300025914 Ga0207671_10008004 Ga0207671_100080046 287
95 3300025914 Ga0207671_10023262 Ga0207671_100232624 287
96 3300025914 Ga0207671_10049895 Ga0207671_100498952 287
97 3300025924 Ga0207694_10034290 Ga0207694_100342903 287
98 3300025925 Ga0207650_10107254 Ga0207650_101072542 287
99 3300026023 Ga0207677_10094222 Ga0207677_100942222 287
100 3300026035 Ga0207703_10114666 Ga0207703_101146663 287
101 3300030731 Ga0316177_1156429 Ga0316177_11564293 287
102 3300030732 Ga0316176_1020492 Ga0316176_102049245 287
103 3300031456 Ga0307513_10270710 Ga0307513_102707102 287
104 3300044706 Ga0466964_0055644 Ga0466964_0055644_644_1516 287
105 3300044735 Ga0466968_0167386 Ga0466968_0167386_109_981 287
106 3300044765 Ga0466970_0234410 Ga0466970_0234410_132_1004 287
107 3300047472 Ga0495686_0008390 Ga0495686_0008390_4931_5800 287
108 3300048927 Ga0496124_0101705 Ga0496124_0101705_641_1513 287
109 2162886007 SwRhRL2b_contig_3787179 SwRhRL2b_0413.00001020 288
110 3300001904 JGI24736J21556_1005213 JGI24736J21556_10052132 288
111 3300001990 JGI24737J22298_10018452 JGI24737J22298_100184522 288
112 3300002737 JGI25162J39368_1000056 JGI25162J39368_100005635 288
113 3300002737 JGI25162J39368_1002071 JGI25162J39368_10020719 288
114 3300002772 JGI25164J39214_1001707 JGI25164J39214_10017076 288
115 3300003214 JGI25165J46597_1001525 JGI25165J46597_10015255 288
116 3300003320 rootH2_10001521 rootH2_1000152122 288
117 3300003322 rootL2_10079710 rootL2_100797102 288
118 3300003323 rootH1_10165380 rootH1_101653801 288
119 3300005288 Ga0065714_10008444 Ga0065714_100084443 288
120 3300005289 Ga0065704_10071392 Ga0065704_1007139210 288
121 3300005328 Ga0070676_10009577 Ga0070676_100095773 288
122 3300005338 Ga0068868_100081523 Ga0068868_1000815232 288
123 3300005339 Ga0070660_100028358 Ga0070660_1000283582 288
124 3300005355 Ga0070671_100040638 Ga0070671_1000406382 288
125 3300005366 Ga0070659_100306733 Ga0070659_1003067332 288
126 3300005456 Ga0070678_100026091 Ga0070678_1000260912 288
127 3300005457 Ga0070662_100000117 Ga0070662_10000011713 288
128 3300005459 Ga0068867_100008871 Ga0068867_1000088715 288
129 3300005539 Ga0068853_100111779 Ga0068853_1001117791 288
130 3300005614 Ga0068856_100005536 Ga0068856_1000055366 288
131 3300005614 Ga0068856_100152033 Ga0068856_1001520332 288
132 3300005616 Ga0068852_100002089 Ga0068852_1000020893 288
133 3300005616 Ga0068852_100086119 Ga0068852_1000861192 288
134 3300005841 Ga0068863_100408391 Ga0068863_1004083912 288
135 3300006237 Ga0097621_100000780 Ga0097621_1000007805 288
136 3300006358 Ga0068871_100000296 Ga0068871_10000029633 288
137 3300006881 Ga0068865_100000025 Ga0068865_10000002581 288
138 3300009093 Ga0105240_10028282 Ga0105240_100282822 288
139 3300009093 Ga0105240_10129165 Ga0105240_101291653 288
140 3300009148 Ga0105243_10000127 Ga0105243_1000012763 288
141 3300009174 Ga0105241_10019613 Ga0105241_100196134 288
142 3300009176 Ga0105242_10281191 Ga0105242_102811912 288
143 3300009545 Ga0105237_10001395 Ga0105237_100013954 288
144 3300009551 Ga0105238_10072001 Ga0105238_100720013 288
145 3300010375 Ga0105239_10000533 Ga0105239_1000053326 288
146 3300013104 Ga0157370_10114390 Ga0157370_101143903 288
147 3300013105 Ga0157369_10153080 Ga0157369_101530803 288
148 3300013296 Ga0157374_10016593 Ga0157374_100165934 288
149 3300013297 Ga0157378_10069168 Ga0157378_100691682 288
150 3300013307 Ga0157372_10018673 Ga0157372_100186733 288
151 3300013307 Ga0157372_10346308 Ga0157372_103463081 288
152 3300014969 Ga0157376_10431351 Ga0157376_104313511 288
153 3300025231 Ga0207427_100060 Ga0207427_10006072 288
154 3300025233 Ga0209437_100021 Ga0209437_100021468 288
155 3300025233 Ga0209437_100124 Ga0209437_10012437 288
156 3300025258 Ga0209129_1007610 Ga0209129_10076102 288
157 3300025261 Ga0209233_1000035 Ga0209233_1000035170 288
158 3300025904 Ga0207647_10000021 Ga0207647_1000002195 288
159 3300025907 Ga0207645_10006715 Ga0207645_100067153 288
160 3300025911 Ga0207654_10000439 Ga0207654_100004397 288
161 3300025911 Ga0207654_10030884 Ga0207654_100308843 288
162 3300025914 Ga0207671_10009451 Ga0207671_100094516 288
163 3300025914 Ga0207671_10051203 Ga0207671_100512034 288
164 3300025919 Ga0207657_10029432 Ga0207657_100294322 288
165 3300025931 Ga0207644_10013125 Ga0207644_100131253 288
166 3300025932 Ga0207690_10055656 Ga0207690_100556562 288
167 3300025933 Ga0207706_10000088 Ga0207706_1000008868 288
168 3300025935 Ga0207709_10000176 Ga0207709_1000017663 288
169 3300025938 Ga0207704_10000185 Ga0207704_1000018513 288
170 3300025949 Ga0207667_10000070 Ga0207667_10000070137 288
171 3300025949 Ga0207667_10203595 Ga0207667_102035953 288
172 3300026023 Ga0207677_10260807 Ga0207677_102608072 288
173 3300026041 Ga0207639_10008221 Ga0207639_100082216 288
174 3300026078 Ga0207702_10000402 Ga0207702_100004027 288
175 3300026088 Ga0207641_10686569 Ga0207641_106865691 288
176 3300026089 Ga0207648_10012348 Ga0207648_100123484 288
177 3300026121 Ga0207683_10077660 Ga0207683_100776601 288
178 3300026142 Ga0207698_10069465 Ga0207698_100694652 288
179 3300026142 Ga0207698_10200988 Ga0207698_102009883 288
180 3300031730 Ga0307516_10003590 Ga0307516_1000359014 288
181 3300033179 Ga0307507_10000144 Ga0307507_1000014478 288
182 3300037312 Ga0395899_0001130 Ga0395899_0001130_2674_3549 288
183 3300037418 Ga0395900_0000115 Ga0395900_0000115_53642_54517 288
184 3300037418 Ga0395900_0016691 Ga0395900_0016691_5516_6391 288
185 3300037466 Ga0395898_0031064 Ga0395898_0031064_3822_4697 288
186 3300037471 Ga0395905_0000045 Ga0395905_0000045_53448_54323 288
187 3300037471 Ga0395905_0000579 Ga0395905_0000579_22520_23395 288
188 3300038443 Ga0395901_0000254 Ga0395901_0000254_3261_4136 288
189 3300038443 Ga0395901_0015933 Ga0395901_0015933_2043_2918 288
190 3300046460 Ga0495638_0093907 Ga0495638_0093907_292_1167 288
191 3300046500 Ga0495596_0001478 Ga0495596_0001478_1885_2760 288
192 3300046507 Ga0495606_0004011 Ga0495606_0004011_806_1681 288
193 3300046512 Ga0495610_0000001 Ga0495610_0000001_1222590_1223456 288
194 3300046512 Ga0495610_0000347 Ga0495610_0000347_14106_14981 288
195 3300046513 Ga0495616_0002378 Ga0495616_0002378_9161_10036 288
196 3300046558 Ga0495633_0005968 Ga0495633_0005968_5612_6487 288
197 3300046616 Ga0495668_0013953 Ga0495668_0013953_1643_2518 288
198 3300046660 Ga0495625_0000586 Ga0495625_0000586_28262_29137 288
199 3300046665 Ga0495661_0006795 Ga0495661_0006795_6268_7143 288
200 3300046810 Ga0495660_0011495 Ga0495660_0011495_2223_3170 288
201 3300047443 Ga0495687_000763 Ga0495687_000763_6105_6980 288
202 3300048925 Ga0496122_0000090 Ga0496122_0000090_69558_70424 288
203 3300048926 Ga0496123_0024103 Ga0496123_0024103_2920_3786 288
204 3300049570 Ga0501033_0177606 Ga0501033_0177606_617_1492 288
205 3300049571 Ga0501034_0079819 Ga0501034_0079819_876_1751 288
206 3300049571 Ga0501034_0185150 Ga0501034_0185150_478_1353 288
207 3300049822 Ga0501035_0024748 Ga0501035_0024748_2936_3811 288
208 3300049823 Ga0501044_0054586 Ga0501044_0054586_3076_3951 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

80

228

0.91

PF03096

Ndr

Ndr family

114

208

0.9

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

82

306

0.74

PF12146

Hydrolase_4

Serine aminopeptidase, S33

79

279

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dst-assembly1.cif.gz_B crystal structure analysis of tt1977 0.8527 33 144
3bdi-assembly1.cif.gz_A crystal structure of predicted cib-like hydrolase (np_393672.1) from thermoplasma acidophilum at 1.45 a resolution 0.8298 33 287
2ocl-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase s122a mutant 0.8128 33 288
2oci-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase complexed with a product analogue 0.8054 33 288
2ocl-assembly1.cif.gz_A crystal structure of valacyclovir hydrolase s122a mutant 0.8039 33 288
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9055 33 119 3.40.50.12270
af_A0A0P0WIT7_2_163_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.872 46 153 3.40.50.1820
af_A0A1D6K8I4_16_172_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8671 33 157 3.40.50.1820
af_A0A1D6M0A7_18_159_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.862 33 138 3.40.50.1820
2dstB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8527 33 144 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A540WT41-F1-model_v4 Alpha/beta hydrolase 0.9693 45 287 GO:0016787
AF-A0A3N5SW78-F1-model_v4 deleted 0.9646 33 163
AF-X0YD31-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9641 35 153
AF-A0A3N4Q4W6-F1-model_v4 Alpha/beta hydrolase 0.9616 27 288 GO:0017171
AF-A0A2W4S683-F1-model_v4 Alpha/beta hydrolase 0.9582 29 287 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.89 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map